Datasets:
0xBreath
/
holistic-tokenized

Dataset card Data Studio Files Community
1
text
stringlengths
2.06k
25.5k
token_ids
sequencelengths
2.05k
2.05k
source
stringclasses
2 values
but it was Impossible to cure. A man suffering from this disease retells his story: "I tried various medicines in allopathy to stop the disease from spreading with no results. On June 12, 1960, I began storing my urine in bottles for massages. As soon as three bottles of one pound capacity each were filled, I began rubbing my entrre body with It. Next morning 160 my skin appeared to be soft and tender, and it surprised me. The dead cuticles on the skin had cleared. I felt still more softness of the body and I took a bath. Then I though of drinking urine. First I rubbed urine on my teeth, and on June 18th, I drank urine for the frrst time, and the next day, I submitted myself to my doctor for an examination. He was extremely glad to note the improvement. Since June 16th up to his day I continued drinking and rubbing urine. Daily I rub myself from head to toe, do some physical work, and then take a bath. The dead cuticles have been entirely gone, my skin appears o be very healthy. I do not recall any itching sensation after June 16th. I got rid of psoriasis completely, and my constipation has also been eliminated. My body is active, and my appetite is good.’ ” Urine Therapy by Dr. John O'Quinn PSORIASIS “A middle-aged woman presented with psoriasis which had been a continuous condition only on her head for the last 12 years. Had also tried many and varied things. I went through the usual protocol of different natural remedies and talked openly to her about urine therapy. Reluctant at first, but managed to open her mind about it all and after that she left me with the suggestion of, each morning she wash her hair then rinse the hair with first urine collected from mid-stream. Leave on head for up to 20 minutes, then wash out. To her utmost surprise her condition has stopped and her hair is so soft. She now wants to stop taking the pill so she can take her urine homeopathically each day. Hurray for Urine!” Urine: The Holy Water by Harald W. Tietze PUS in BLOOD “Patient, male, 49, was extremely nervous and irritable; he had wandering pains all over his body, headache and general lassitude. He complained a great deal of pain in the lumbar region and in the abdomen. He improved on nothing I gave him...microscopic urine examination showed red blood cells, pus cells, renal cells and abundance of calcium oxalate crystals. The treatment consisted of a twenty minim injection of urine diluted 1 to 100 with distilled water. He improved with this to a certain point but did not entirely recover until I used a less diluted urine, after which he made a prompt recovery. Two months after he recovered a urinalysis showed absence of pus and renal cells and a normal volume of urine.” 161 Dr. Deachman, New York PUS IN EARS Once a couple came to me with their son aged 7 years. The child was suffering from pus in ears for the last 11 months. Many Ayurvedic and Allopathic drops and other medicines were tried without much success. The effect of these medicines was temporary. The couple told me their problem and asked me to help them. I told them that I too have the same medicines which they have already tried and it is useless to try them again. However if they really want to get rid of this trouble permanently, they will have to take some radical measures which they may not like to hear even upon their insistence. I told them to wash the ear with urine four times a day and also to make the child drink one ounce of urine daily in the morning. They readily agreed to wash the ears with urine but drinking part did not appeal them. They were skeptical about this. However I told them that unless they follow my advice in toto, I can't take any guarantee of cure. They agreed to give it a try after some hesitation. After three days the results were so encouraging that they themselves came to me to tell that they were sure of the efficacy of the treatment. After fifteen days the child was all right. Urine drinking was stopped although washing was continued for few more days. Now the child is 15 years old and the trouble has never recurred again. The family has become convince of the power of urine therapy and have had many benefits from it during these years. This case was one of my earlier adventures in urine therapy which encouraged me a lot. Raojibhai has also described cases where loss of hearing has been restored. Although I have no first hand experience in this matter but I am sure that urine therapy is capable of working wonders unheard of. "Miracles of Urine Therapy" by Morarji Desai PUS IN URINE “Shrimati Kamaladevi Choradia, 30 years, of Sardar Shahr (Rajasthan) was suffering from backache and pus in her urine. Having been thoroughly disappointed with allopathic treatment she went to Momasar to get treated by Shri Bhojraj Sancheti in May 1972. Listening her tale of woe Shri Sancheti warned her : "There are possibilities in urine therapy of reactions and aggravations. Only after patiently and firmly braving them can One acquire freedom from disease." On her amusing him of her eagerness and faith Bhojraj began treatment of urine therapy. On the first day she suffered from frequent vomits and motions. On the second day motions subsided but vomiting continued till three days. But Kamaladevi was not disheartened. On the 14th day the fast was broken with mosambi juice. For some days she was kept on juice. Later she resumed her light diet. To be relieved of the gases, headache, etc. the usual reactions 162 of western medication she restored to hip-bath. For about two months she drank urine thrice and massaged for two hours. After three or four' months she was utterly well and completely regained her health and strength.” from Manav Mootra by R. M. Patel PYORRHOEA Another young man, 30 years of age, had pyorrhea. His lower front teeth were very weak and loose and dentist advised him to get them extracted. On my recommendation he tried urine therapy. But this particular young man had a strong will and determination. He followed the instructions literally. In the two months his teeth became firm and gums healthy. Even now after four years of this incident his oral health is perfect. No offensive discharge from gums and no loose teeth, but the fellow is still not taking tea etc. He has understood the secret of health, which is natural food and natural living. "Miracles of Urine Therapy" by Morarji Desai *********************** R *********************** RASHES “My son's class-mate used to get rashes on his body. My son, who was studying in the Engineering College of Patiala, used to keep two or three-bottles filled with his urine. They were labelled ‘Nectar of Life’ 1, 2, 3. Whenever anyone had an injury he would treat it with botte No. 1, which had urine several days old. Bottle No. 3 contained fresh urine which he used in eye-trouble and similar conditions. His class-mate came one day and said, 'You have some medicine called nectar. Give me some. I am at my wit's end owing to these rashes.' He gave some quantity from No. 1 and asked his class-mate to apply it both in mornings and evenings. With a week's application the rashes vanished.” from Manav Mootra by R. M. Patel RAT POISON “A frantic mother called me because her daughter had ingested rat poison accidentally. The child was vomiting and she didn't know what to do. I advised the mother to pee in a glass and give the child eight ounces of urine immediately. Meanwhile I called 911 to 163 get the poison control center and an ambulance to her. It was difficult convincing the child to drink the mother's urine, but by the time the paramedics arrived, the child was out of danger.” Uropathy by Martin J. Lara RECTAL BLEEDING Mr. M. Florida "If it is of interest to you for any research purposes, I nearly died from the reactions of several strong antibiotics administered over several months of lung infections. I have been hospitalized three times in the past year for the resulting gastrointestinal problems created by the medication. After the most recent hospital stay, I refused to continue with the medication. Most of the problems began to clear up within a few days. However, my rectal bleeding from colitis and internal hemorrhoids continued. In the meantime a friend told me that in the Tennessee Hills, where he was raised, urine enemas were used for similar problems. On July31, 1988, I began using urine for daily enemas. By the end of the following week, the bleeding had stopped completely, and as of this date (September25, 1988), I have not passed a single drop of blood." World-wide Case Histories of Urine Therapy by Gary Ward RHEUMATISM Ms. H.P., The Netherlands "I have suffered from rheumatism for years, especially in my hands. My son told me about urine therapy and suggested I use urine compresses. This surprised me, but I started treating my hands daily with urine. The result was extraordinary. Besides the fact that my hands felt much smoother, the most remarkable thing was that the pain practically disappeared" The Golden Fountain by Coen van der Kroon RHEUMATISM
[ 719, 433, 574, 83752, 311, 27208, 13, 362, 893, 16066, 505, 420, 8624, 2160, 6572, 813, 3446, 25, 330, 40, 6818, 5370, 39653, 304, 63747, 2398, 88, 311, 3009, 279, 8624, 505, 31135, 449, 912, 3135, 13, 1952, 5651, 220, 717, 11, 220, 5162, 15, 11, 358, 6137, 28672, 856, 40335, 304, 27474, 369, 64279, 13, 1666, 5246, 439, 2380, 27474, 315, 832, 220, 31123, 8824, 220, 1855, 1051, 10409, 11, 358, 6137, 57035, 856, 11751, 265, 2547, 449, 1102, 13, 9479, 6693, 220, 6330, 856, 6930, 9922, 311, 387, 8579, 323, 28682, 11, 323, 433, 14792, 757, 13, 578, 5710, 4018, 4440, 389, 279, 6930, 1047, 23803, 13, 358, 6612, 2103, 810, 8579, 2136, 315, 279, 2547, 323, 358, 3952, 264, 9061, 13, 5112, 358, 3582, 315, 16558, 40335, 13, 5629, 358, 67854, 40335, 389, 856, 18311, 11, 323, 389, 5651, 220, 972, 339, 11, 358, 54244, 40335, 369, 279, 282, 637, 267, 892, 11, 323, 279, 1828, 1938, 11, 358, 14976, 7182, 311, 856, 10896, 369, 459, 24481, 13, 1283, 574, 9193, 16089, 311, 5296, 279, 16048, 13, 220, 8876, 5651, 220, 845, 339, 709, 311, 813, 1938, 358, 8738, 16558, 323, 57035, 220, 40335, 13, 13690, 358, 10485, 7182, 505, 2010, 311, 31316, 11, 656, 1063, 7106, 990, 11, 323, 1243, 1935, 264, 9061, 13, 578, 5710, 4018, 4440, 617, 1027, 11622, 8208, 11, 856, 6930, 8111, 297, 387, 1633, 9498, 13, 358, 656, 539, 19635, 904, 86075, 37392, 1306, 5651, 220, 845, 339, 13, 358, 2751, 9463, 315, 4831, 93003, 6724, 11, 323, 856, 738, 49686, 706, 1101, 1027, 34373, 13, 3092, 2547, 374, 4642, 11, 323, 856, 38575, 374, 1695, 14639, 19524, 220, 17229, 483, 40143, 555, 2999, 13, 3842, 507, 6, 2232, 6258, 220, 11659, 878, 32922, 1669, 220, 1054, 32, 6278, 57859, 5333, 10666, 449, 4831, 93003, 902, 1047, 1027, 264, 19815, 3044, 1193, 389, 1077, 2010, 369, 279, 1566, 220, 717, 1667, 13, 24805, 1101, 6818, 1690, 323, 28830, 2574, 13, 358, 4024, 1555, 279, 13783, 11766, 315, 2204, 5933, 51236, 323, 15243, 30447, 311, 1077, 922, 40335, 15419, 13, 6649, 670, 519, 520, 1176, 11, 719, 9152, 311, 1825, 1077, 4059, 922, 433, 682, 323, 1306, 430, 1364, 2163, 757, 449, 279, 24710, 315, 11, 1855, 6693, 1364, 11623, 1077, 7013, 1243, 74341, 279, 7013, 449, 1176, 40335, 14890, 505, 5209, 39823, 13, 26257, 389, 2010, 369, 709, 311, 220, 508, 4520, 11, 1243, 11623, 704, 13, 2057, 1077, 54711, 13051, 1077, 3044, 706, 10717, 323, 1077, 7013, 374, 779, 8579, 13, 3005, 1457, 6944, 311, 3009, 4737, 279, 15530, 779, 1364, 649, 1935, 1077, 40335, 2162, 36211, 2740, 1855, 1938, 13, 473, 24648, 369, 17229, 483, 18319, 220, 17229, 483, 25, 578, 19229, 10164, 555, 5340, 4852, 468, 13, 350, 3978, 3059, 220, 126670, 304, 426, 90731, 220, 1054, 37692, 11, 8762, 11, 220, 2491, 11, 574, 9193, 23418, 323, 6348, 23349, 26, 568, 1047, 55063, 51266, 682, 927, 813, 2547, 11, 47846, 323, 4689, 326, 395, 3993, 13, 1283, 35070, 264, 2294, 3568, 315, 6784, 304, 279, 41263, 2308, 5654, 323, 304, 279, 64772, 13, 220, 1283, 13241, 389, 4400, 358, 6688, 1461, 1131, 41543, 58510, 40335, 24481, 8710, 2579, 6680, 7917, 11, 75676, 7917, 11, 63915, 7917, 323, 37492, 315, 35719, 19488, 278, 349, 48473, 13, 578, 6514, 44660, 315, 264, 17510, 21877, 26127, 315, 40335, 80703, 220, 16, 311, 220, 1041, 449, 89867, 3090, 13, 1283, 13241, 449, 420, 311, 264, 3738, 1486, 719, 1550, 539, 11622, 11993, 3156, 358, 1511, 264, 2753, 80703, 40335, 11, 1306, 902, 568, 1903, 264, 10137, 13654, 13, 9220, 4038, 1306, 568, 26403, 264, 4433, 992, 4548, 8710, 19821, 315, 75676, 323, 63915, 7917, 323, 264, 4725, 8286, 315, 40335, 2029, 220, 220, 10718, 2999, 13, 1611, 613, 1543, 11, 1561, 4356, 220, 126670, 2006, 469, 17485, 220, 9843, 264, 5743, 3782, 311, 757, 449, 872, 4538, 20330, 220, 22, 1667, 13, 578, 1716, 574, 16066, 505, 75676, 304, 25212, 369, 279, 1566, 220, 806, 4038, 13, 9176, 24852, 80627, 292, 323, 1708, 385, 2398, 292, 21701, 323, 1023, 39653, 1051, 6818, 2085, 1790, 2450, 13, 578, 2515, 315, 1521, 39653, 574, 13643, 13, 578, 5743, 3309, 757, 872, 3575, 323, 4691, 757, 311, 1520, 1124, 13, 358, 3309, 1124, 430, 358, 2288, 617, 279, 1890, 39653, 902, 814, 617, 2736, 6818, 323, 433, 374, 29948, 311, 1456, 1124, 1578, 13, 4452, 422, 814, 2216, 1390, 311, 636, 9463, 315, 420, 12544, 31859, 11, 814, 690, 617, 311, 1935, 1063, 18336, 11193, 902, 814, 1253, 539, 1093, 311, 6865, 1524, 5304, 872, 79397, 13, 358, 3309, 1124, 311, 11623, 279, 2487, 449, 40335, 3116, 3115, 264, 1938, 323, 1101, 311, 1304, 279, 1716, 7172, 832, 54808, 315, 40335, 7446, 304, 279, 6693, 13, 2435, 31368, 7378, 311, 11623, 279, 25212, 449, 40335, 719, 16558, 961, 1550, 539, 14638, 1124, 13, 2435, 1051, 44929, 922, 420, 13, 4452, 358, 3309, 1124, 430, 7389, 814, 1833, 856, 9650, 304, 117807, 11, 358, 649, 956, 1935, 904, 15803, 315, 27208, 13, 2435, 7378, 311, 3041, 433, 264, 1456, 1306, 1063, 65437, 13, 4740, 2380, 2919, 279, 3135, 1051, 779, 26921, 430, 814, 5694, 3782, 311, 757, 311, 3371, 430, 814, 1051, 2771, 315, 279, 41265, 315, 279, 6514, 13, 4740, 37755, 2919, 279, 1716, 574, 682, 1314, 13, 17229, 483, 16558, 574, 10717, 8051, 28786, 574, 8738, 369, 2478, 810, 2919, 13, 4800, 279, 1716, 374, 220, 868, 1667, 2362, 323, 279, 12544, 706, 2646, 1421, 8293, 1578, 13, 578, 3070, 706, 3719, 28008, 315, 279, 2410, 315, 40335, 15419, 323, 617, 1047, 1690, 7720, 505, 433, 2391, 1521, 1667, 13, 1115, 1162, 574, 832, 315, 856, 6931, 32078, 304, 40335, 15419, 902, 21190, 757, 264, 2763, 13, 89000, 73, 581, 26279, 706, 1101, 7633, 5157, 1405, 4814, 315, 11011, 706, 1027, 28101, 13, 10541, 358, 617, 912, 1176, 1450, 3217, 304, 420, 5030, 719, 358, 1097, 2771, 430, 40335, 15419, 374, 13171, 315, 3318, 40164, 86560, 315, 13, 220, 330, 59561, 18709, 315, 17229, 483, 40143, 1, 555, 8613, 277, 7910, 3959, 2192, 220, 126670, 2006, 35514, 4069, 220, 1054, 2059, 6417, 9491, 29549, 278, 1037, 10176, 921, 269, 53931, 11, 220, 966, 1667, 11, 315, 328, 569, 277, 1443, 15464, 320, 49, 1662, 72649, 8, 574, 16066, 505, 1203, 1815, 323, 75676, 304, 1077, 40335, 13, 20636, 1027, 27461, 25406, 449, 63747, 2398, 292, 6514, 1364, 4024, 311, 22969, 68038, 311, 636, 12020, 555, 1443, 462, 426, 6292, 73, 56486, 328, 3581, 51998, 304, 3297, 220, 4468, 17, 13, 77797, 1077, 24162, 315, 289, 4748, 1443, 462, 328, 3581, 51998, 19201, 1077, 551, 330, 3947, 527, 24525, 304, 40335, 15419, 315, 25481, 323, 46041, 811, 13, 8442, 1306, 79261, 323, 32620, 1437, 2370, 1124, 649, 3861, 21953, 11542, 505, 8624, 1210, 1952, 1077, 60986, 1461, 315, 1077, 79340, 29668, 323, 10082, 426, 6292, 73, 56486, 6137, 6514, 315, 40335, 15419, 13, 1952, 279, 1176, 1938, 1364, 16654, 505, 21420, 22752, 1220, 323, 54245, 13, 1952, 279, 2132, 1938, 54245, 5258, 4591, 719, 63571, 8738, 12222, 2380, 2919, 13, 2030, 29549, 278, 1037, 10176, 574, 539, 834, 18207, 6901, 13, 1952, 279, 220, 975, 339, 1938, 279, 5043, 574, 11102, 449, 23518, 89502, 23661, 13, 1789, 1063, 2919, 1364, 574, 8774, 389, 23661, 13, 25929, 1364, 58505, 1077, 3177, 10173, 13, 2057, 387, 51512, 315, 279, 45612, 11, 47846, 11, 5099, 13, 279, 13783, 25481, 220, 10674, 315, 19001, 24099, 1364, 28101, 311, 18638, 1481, 589, 13, 1789, 922, 1403, 4038, 1364, 54244, 40335, 8983, 560, 323, 3148, 3359, 369, 1403, 4207, 13, 4740, 2380, 477, 3116, 6, 4038, 1364, 574, 38631, 1664, 323, 6724, 86025, 1077, 2890, 323, 8333, 2029, 220, 505, 2418, 402, 386, 1944, 969, 555, 432, 13, 386, 13, 63855, 220, 43860, 878, 49, 24755, 19657, 220, 13596, 3995, 893, 11, 220, 966, 1667, 315, 4325, 11, 1047, 4611, 17847, 41033, 13, 5414, 4827, 4156, 18311, 1051, 1633, 7621, 323, 20784, 323, 50351, 26160, 1461, 311, 636, 1124, 28532, 13, 1952, 856, 28782, 568, 6818, 40335, 15419, 13, 2030, 420, 4040, 3995, 893, 1047, 264, 3831, 690, 323, 26314, 13, 1283, 8272, 279, 11470, 16280, 13, 763, 279, 1403, 4038, 813, 18311, 6244, 7626, 323, 98754, 9498, 13, 7570, 1457, 1306, 3116, 1667, 315, 420, 10672, 813, 21308, 2890, 374, 4832, 13, 2360, 15538, 32643, 505, 98754, 323, 912, 20784, 18311, 11, 719, 279, 12637, 374, 2103, 539, 4737, 15600, 5099, 13, 1283, 706, 16365, 279, 6367, 315, 2890, 11, 902, 374, 5933, 3691, 323, 5933, 5496, 13, 220, 330, 59561, 18709, 315, 17229, 483, 40143, 1, 555, 8613, 277, 7910, 3959, 2192, 220, 47946, 40138, 432, 47946, 40138, 220, 432, 9729, 1600, 220, 1054, 5159, 4538, 596, 538, 1474, 349, 1511, 311, 636, 436, 14380, 389, 813, 2547, 13, 3092, 4538, 11, 889, 574, 21630, 304, 279, 17005, 9304, 315, 7281, 532, 64, 11, 1511, 311, 2567, 1403, 477, 2380, 1481, 1751, 645, 10409, 449, 813, 40335, 13, 2435, 1051, 61336, 3451, 45, 39916, 315, 9601, 529, 220, 16, 11, 220, 17, 11, 220, 18, 13, 43633, 5606, 1047, 459, 11134, 568, 1053, 4322, 433, 449, 11164, 668, 2360, 13, 220, 16, 11, 902, 1047, 40335, 3892, 2919, 2362, 13, 55085, 2360, 13, 220, 18, 13282, 7878, 40335, 902, 568, 1511, 304, 8071, 10398, 1222, 323, 4528, 4787, 13, 220, 5414, 538, 1474, 349, 3782, 832, 1938, 323, 1071, 11, 364, 2675, 617, 1063, 16088, 2663, 308, 39916, 13, 21335, 757, 1063, 13, 358, 1097, 520, 856, 38467, 596, 842, 56612, 311, 1521, 436, 14380, 3238, 1283, 6688, 1063, 12472, 505, 2360, 13, 220, 16, 323, 4691, 813, 538, 1474, 349, 311, 3881, 433, 2225, 304, 58302, 323, 59938, 13, 3161, 264, 2046, 596, 3851, 279, 436, 14380, 59581, 2029, 220, 505, 2418, 402, 386, 1944, 969, 555, 432, 13, 386, 13, 63855, 220, 98980, 13228, 53076, 220, 1054, 32, 89706, 6691, 2663, 757, 1606, 1077, 10003, 1047, 6892, 10185, 11494, 21109, 33484, 13, 578, 1716, 574, 63571, 323, 1364, 3287, 956, 1440, 1148, 311, 656, 13, 358, 26160, 279, 6691, 311, 65238, 304, 264, 9168, 323, 3041, 279, 1716, 8223, 49138, 315, 40335, 7214, 13, 26982, 358, 2663, 220, 17000, 311, 220, 9892, 636, 279, 21109, 2585, 4219, 323, 459, 51632, 311, 1077, 13, 1102, 574, 5107, 40661, 279, 1716, 311, 7172, 279, 6691, 596, 40335, 11, 719, 555, 279, 892, 279, 1719, 81811, 11721, 11, 279, 1716, 574, 704, 315, 8137, 2029, 220, 549, 897, 19682, 555, 11826, 622, 13, 73257, 220, 76903, 984, 52818, 1507, 1753, 220, 4491, 13, 386, 13, 9784, 330, 2746, 433, 374, 315, 2802, 311, 499, 369, 904, 3495, 10096, 11, 358, 7154, 8636, 505, 279, 25481, 315, 3892, 3831, 46850, 38018, 927, 3892, 4038, 315, 21271, 30020, 13, 358, 617, 1027, 70340, 2380, 3115, 304, 279, 3347, 1060, 369, 279, 13239, 80311, 5435, 3549, 555, 279, 24099, 13, 4740, 279, 1455, 3293, 8952, 4822, 11, 358, 16436, 311, 3136, 449, 279, 24099, 13, 7648, 315, 279, 5435, 6137, 311, 2867, 709, 2949, 264, 2478, 2919, 13, 4452, 11, 856, 7763, 278, 35763, 505, 1400, 20000, 323, 5419, 71417, 17390, 8738, 13, 220, 763, 279, 33953, 264, 4333, 3309, 757, 430, 304, 279, 24097, 25964, 11, 1405, 568, 574, 9408, 11, 40335, 665, 35262, 1051, 1511, 369, 4528, 5435, 13, 1952, 5887, 2148, 11, 220, 3753, 23, 11, 358, 6137, 1701, 40335, 369, 7446, 665, 35262, 13, 3296, 279, 842, 315, 279, 2768, 2046, 11, 279, 35763, 1047, 10717, 6724, 11, 323, 439, 315, 420, 2457, 320, 30649, 914, 11, 220, 3753, 23, 705, 358, 617, 539, 5946, 264, 3254, 6068, 315, 6680, 1210, 220, 4435, 25480, 11799, 67005, 2490, 315, 17229, 483, 40143, 555, 24765, 27738, 220, 432, 1837, 2864, 835, 47905, 256, 16450, 13, 473, 1087, 2637, 578, 26746, 330, 40, 617, 16654, 505, 68132, 46313, 2191, 369, 1667, 11, 5423, 304, 856, 6206, 13, 3092, 4538, 3309, 757, 922, 40335, 15419, 323, 12090, 358, 1005, 40335, 25633, 288, 13, 1115, 14792, 757, 11, 719, 358, 3940, 27723, 856, 6206, 7446, 449, 40335, 13, 578, 1121, 574, 24674, 13, 31909, 279, 2144, 430, 856, 6206, 6612, 1790, 61405, 11, 279, 1455, 23649, 3245, 574, 430, 279, 6784, 32367, 29496, 1, 256, 578, 18288, 78324, 555, 3623, 268, 5355, 2761, 68917, 263, 220, 432, 1837, 2864, 835, 47905, 220 ]
0xBreath/holistic-books
their walls that gas exchange takes place in the human body. The work of the lungs during inhalation and exhalation can be compared with the work of blacksmiths. Special intercostal muscles and diaphragm help the chest to shrink and expand. When you inhale the muscles raise the chest, the diaph ragm is reduced and thickened. As a result of this process, the volume of the lungs increases and air enters them as if through a pump. When you exhale, the intercosta l muscles relax, the diaphragm rises and theair is pushed out of the body. The brain coordinates this work transmitting the orders through the peripheral nerves. Chapter 4. Types of breathing In a healthy person, gas exch ange occurs with the same frequency of inhalation and exhalation (16–20 breaths per minute). In children, respiratory rate is higher. It is 20-30 respiratory movements per minute; in infants, 30–40; in newborns - 40–60. Respiratory rate can vary depending on physical activity, emotional state, health. Moreover, each person is able to arbitrarily change the rhythm, depth, structure and level of breathing, to use different types of breathing in different situations. Depending on which muscles work, breathing can be abdominal, chest (it in turn is divided into upper and lower), mixed (it is divided into deep and superficial). Abdominal br eathing It is carried out with the help of contraction of the diaphragm and the muscles of the abdominal cavity with relative rest of the chest wall. When you inhale: the shoulders fall, the pectoral muscles weaken and the diaphragm contr acts and falls. As a result, the negative pressure in the chest cavity increases. The lower part of the lungs is filled with air and the abdomen bulges out. During exhalatio n, the diaphragm relaxes and rises, and the abdominal wall returns to its original position. Most often, such breathing occur s in men. It also occurs when a person rests, usually during sleep. Lower chest br eathing It involves intercostal muscles. As a result of muscle contractio n, the chest expands outward and upward, air enters the lungs, and inhalation occurs. During lower breathing, only part of the lungs is filled, only the ribs are involved. The rest of the body remains stationary. As a result, there is no full-fledged gas exchange process. Upper chest br eathing It occurs due to the work of the clavicle muscles. When inhaling, the clavicle and shoulders rise, and air enters the lungs. In this case, it is necessary to make a lot of effort, since the frequency of inhalation and exhalation increases, and the oxygen supply turns out to be insignificant. Such breathing can be deliberate ly caused if the stomach is drawn in. In the upper chest respiration only an insignificant part of the lungs is involved and gas exchange is incomplete. As a result, the air is not properly cleaned or warmed up. This type of breathing is resorted to by women during childbirth. Mixed br eathing It sets in motion the entire breathing apparatus. At the same time all types of musc les and a diaphragm work, and lungs are fully ventilated. Mixed breathing can be either deep or shallow. Surface breathing is light and fast. The frequency of respiratory movements is up to 60 movements per minute. During mixed breathing people make a silent breath and noisy intense exhalation. This allows you to relieve tension from all the muscles of the body. In superficial breathing, the lungs are only partially filled with air. Only small children breathe superficially. The older the child becomes, thefewer breaths per minute he takes. The breathing of an adult person acquires a deep character. During deep breathing, the frequency slows down; the lungs fill with air as much as possibl e. The volume of breath in this case exceeds the permissible rate. It is widel y believed that exactly deep breathing is correct, because during it our body is best saturated with oxygen. However, this is not at all the case. The idea that deep breathing enriches the body with oxygen as fully as possible is erroneous. For the body to function normally, it is necessary to maintain the balance of carbon dioxide and oxygen established by nature. The desire to increase the oxygen content due to deep breathing leads to oxygen starvation. From deep breathing in 1-3 minutes there is a decrease in pressure or hypotension, edema, bags under the eyes appear, the thyroid gland is disturbed, the metabolism increases, the concentration of cholesterol increases, regardless of diet. In addition, insomnia, irritability develops, memory deteriorates, and as a result, asthma, heart attacks, strokes, etc. How to maintain an optimal balance of respiration depth, the balance between oxygen and carbon dioxide, so as not to harm the body? And how is breathing right in general? Chapter 5. What should be proper breathing? Most people are limited to only shallow breathing, or vice versa, emphasize deep. And believe that it does not affect their health. In fact, all of the above types’ respiration deviates from the norm and after a while manifest itself in the form of diseases. Proper breathing involves the use of the entire lung volume and provides the body suf ficient oxygen, therefore, has a healing ef fect. It consists of three phases: 1) Involuntary silent breath (necessarily through the nose); 2) Exhalation; 3) A brief pause - respite. All three phases are always present in the act of breathing. Exhalation is about one second and then followed by a pause - about one and a half seconds and the return of breathing - about a second. Time relationship may vary depending on the type and intensity of the load. An untrained person has a cycle of three phases are repeated on average 16 times per minute, and that of a trained person - about 8–10 times per minute. Three-phase breathing is provided for by the laws of nature. And I can assure you, it is the most optimal and effective. Proper breath ing restores normal activity of the nervous system, increases the vital capacity of the lungs, blood and tissues actively saturated with oxygen, which affects a significant improvement in overall health and performance. By the way, it is in a dream that a healthy person breathes as correctly as possible, since breathing not consciously controlled. The management ofthis process is entirely transferred to the respiratory center. Breathing test Now that you know what proper breathing is, try checking how you breathe. To do this, conduct a small test. Sit on a chair in a free, relaxed position. Clothin g should not constrain the body. Close your eyes and wait for the moment when you hear your own breath. Follow him, but do not consciously interfere with the process. Your task is to follow the sequence of filling and emptying the lungs. At the same time, first smoothly fill the lower part of the lungs with air so that the stomach moves forward, the diaphragm goes down, then the middle part (the ribs and chest rise) and finally the upper part (the clavicle should rise, and the stomach should be pulled up to the spine). During exhalatio n, your stomach should be drawn in, the diaphr agm should rise, and then the chest and shoulders should lower. Movement during inhalation and exhalation shoul d be soft, smooth, without sharp jolts and tension. Repeat them 3 times. On the fourth breath, hold your breath and record the time in seconds. Then exhale and fix again the time during which you can do without air entering the lungs. Compar e the r esults In most cases, the duration of inhalation and exhalation will be different. Someone breath es too short, and someone breathes out. With proper breathing, the duration of inhalation and exhalation should be the same. So it is time to seriously take up your health. As soon as you master the technique of proper breathing, it will become your primary need and habit. Chapter 6. Curative breath by K. Buteyko The system of therapeutic respiration, or the so-called strong-willed elimination of deep breathing, was developed by K. Buteyko, a doctor, a Russian scientis t who for many years headed the laboratory of functional diagnostics at the Institute of Experimental Biology and Medicine of the Siberian Academy of Medical Sciences of the USSR in Novosibirsk. Due to his profe ssion, Buteyko more than once had to see how people were dying. He noticed that before death, a person began to breathe deeply. Buteyko suggested that such intense breathing brings death closer, and therefore could be the cause of a number of diseases. Then Buteyko decided to perform an experiment with his own breath: he changed the rhythm, depth, intensity. After a while, he noticed that the tormenting attacks of hypertension became less frequent, moreover, they were easily removed by breathing exercises, without the help of medications. So the method of Volitional Elimination of Deep Breathing (VEDB) was born. Why you need to learn how to br eathe
[ 198, 50828, 14620, 430, 6962, 9473, 5097, 2035, 304, 279, 3823, 2547, 16853, 791, 990, 315, 279, 45274, 2391, 77773, 367, 323, 506, 12130, 367, 649, 387, 7863, 198, 4291, 279, 990, 315, 3776, 34117, 82, 13, 9984, 958, 16845, 278, 24569, 323, 1891, 95896, 76, 198, 8823, 279, 15489, 311, 30000, 323, 9407, 13, 3277, 499, 60537, 1604, 279, 24569, 4933, 279, 198, 27417, 11, 279, 1891, 1366, 21108, 76, 374, 11293, 323, 12314, 6901, 13, 1666, 264, 1121, 315, 420, 1920, 345, 1820, 8286, 315, 279, 45274, 12992, 323, 3805, 29933, 1124, 439, 422, 1555, 264, 14155, 627, 4599, 499, 57759, 1604, 11, 279, 958, 16845, 64, 326, 24569, 12234, 11, 279, 1891, 95896, 76, 38268, 323, 279, 1334, 374, 15753, 704, 315, 279, 2547, 662, 578, 8271, 14259, 420, 990, 78768, 198, 1820, 10373, 1555, 279, 35688, 50581, 13, 15957, 220, 19, 13, 21431, 315, 27027, 27907, 644, 264, 9498, 1732, 11, 6962, 506, 331, 33275, 13980, 449, 279, 1890, 11900, 315, 198, 258, 12130, 367, 323, 506, 12130, 367, 320, 845, 4235, 508, 11745, 82, 824, 9568, 570, 763, 2911, 345, 417, 5682, 5382, 4478, 374, 5190, 662, 1102, 374, 220, 508, 12, 966, 42631, 19567, 824, 9568, 26, 304, 198, 13885, 1821, 11, 220, 966, 4235, 1272, 26, 304, 46397, 82, 482, 220, 1272, 4235, 1399, 13, 77934, 5382, 4478, 649, 13592, 11911, 198, 263, 7106, 5820, 1174, 14604, 1614, 11, 2890, 13, 23674, 1174, 1855, 1732, 374, 3025, 198, 998, 86757, 2349, 279, 37390, 11, 8149, 11, 6070, 323, 2237, 315, 27027, 11, 311, 198, 817, 2204, 4595, 315, 27027, 304, 2204, 15082, 13, 40730, 389, 902, 198, 38827, 19153, 990, 11, 27027, 649, 387, 57056, 11, 15489, 320, 275, 304, 2543, 374, 18255, 1139, 198, 13886, 323, 4827, 705, 9709, 320, 275, 374, 18255, 1139, 5655, 323, 59915, 4390, 720, 5953, 5717, 992, 1437, 384, 44661, 27907, 2181, 374, 11953, 704, 449, 279, 1520, 315, 71895, 315, 279, 1891, 95896, 76, 323, 279, 198, 38827, 19153, 315, 279, 57056, 56429, 449, 8844, 2800, 315, 279, 15489, 7147, 13, 3277, 198, 9514, 60537, 1604, 25, 279, 28004, 4498, 11, 279, 281, 1279, 278, 24569, 33556, 323, 279, 198, 8747, 95896, 76, 6155, 14385, 323, 17503, 13, 1666, 264, 1121, 11, 279, 8389, 7410, 220, 304, 279, 15489, 198, 66, 11980, 12992, 627, 791, 4827, 961, 315, 279, 45274, 374, 10409, 449, 3805, 323, 279, 64772, 220, 7173, 4282, 704, 627, 16397, 506, 12130, 6400, 308, 11, 279, 1891, 95896, 76, 12234, 288, 323, 38268, 11, 323, 279, 57056, 7147, 198, 4310, 311, 1202, 4113, 2361, 13, 7648, 3629, 11, 1778, 27027, 12446, 274, 304, 3026, 13, 1102, 198, 19171, 13980, 994, 264, 1732, 54331, 11, 6118, 2391, 6212, 627, 720, 9230, 15489, 1437, 384, 44661, 198, 1102, 18065, 958, 16845, 278, 24569, 13, 1666, 264, 1121, 315, 16124, 5226, 822, 308, 11, 279, 15489, 198, 4683, 2914, 52046, 323, 40872, 11, 3805, 29933, 279, 45274, 11, 323, 77773, 367, 13980, 627, 16397, 4827, 27027, 11, 1193, 961, 315, 279, 45274, 374, 10409, 11, 1193, 279, 56249, 527, 198, 14386, 8905, 13, 578, 2800, 315, 279, 2547, 8625, 53735, 662, 1666, 264, 1121, 11, 220, 1070, 374, 912, 198, 9054, 2269, 93724, 6962, 9473, 1920, 627, 720, 14585, 15489, 1437, 384, 44661, 27907, 2181, 13980, 4245, 311, 279, 990, 315, 279, 1206, 402, 2045, 24569, 13, 3277, 60537, 6260, 11, 279, 198, 566, 402, 2045, 323, 28004, 10205, 11, 323, 3805, 29933, 279, 45274, 13, 763, 420, 1162, 11, 433, 374, 198, 95317, 311, 1304, 264, 2763, 315, 5149, 11, 2533, 279, 11900, 315, 77773, 367, 323, 198, 327, 12130, 367, 12992, 11, 323, 279, 24463, 8312, 10800, 704, 311, 387, 73521, 627, 21365, 27027, 649, 387, 46072, 14869, 9057, 422, 279, 23152, 374, 15107, 304, 13, 763, 279, 198, 13886, 15489, 594, 29579, 1193, 459, 73521, 961, 315, 279, 45274, 374, 6532, 198, 438, 6962, 9473, 374, 33243, 13, 1666, 264, 1121, 11, 279, 3805, 374, 539, 10489, 28822, 198, 269, 82830, 709, 13, 1115, 955, 315, 27027, 374, 594, 13909, 311, 555, 3278, 2391, 198, 3124, 28813, 627, 720, 87533, 1437, 384, 44661, 27907, 2181, 7437, 304, 11633, 220, 279, 4553, 27027, 41705, 13, 2468, 279, 1890, 892, 682, 4595, 198, 1073, 3167, 66, 3625, 323, 264, 1891, 95896, 76, 990, 11, 323, 45274, 527, 7373, 71702, 660, 13, 51268, 198, 21152, 44661, 649, 387, 3060, 5655, 477, 26682, 662, 28061, 27027, 374, 3177, 323, 5043, 627, 791, 11900, 315, 42631, 19567, 374, 709, 311, 220, 1399, 19567, 220, 824, 9568, 627, 16397, 9709, 27027, 1274, 1304, 264, 21737, 11745, 323, 50380, 19428, 198, 327, 12130, 367, 13, 1115, 6276, 499, 311, 48839, 24408, 505, 682, 279, 24569, 315, 279, 198, 2664, 662, 763, 59915, 27027, 11, 279, 45274, 527, 1193, 26310, 10409, 449, 3805, 627, 7456, 2678, 2911, 37397, 59915, 398, 662, 578, 9191, 279, 1716, 9221, 11, 279, 71830, 261, 11745, 82, 824, 9568, 568, 5097, 13, 578, 27027, 315, 459, 6822, 1732, 198, 582, 18164, 264, 5655, 3752, 16853, 16397, 5655, 27027, 11, 279, 11900, 70270, 1523, 26, 279, 45274, 5266, 449, 3805, 439, 198, 59178, 439, 2278, 581, 75, 384, 13, 578, 8286, 315, 11745, 304, 420, 1162, 36375, 279, 76345, 198, 7853, 13, 1102, 374, 9923, 301, 379, 11846, 430, 7041, 5655, 27027, 374, 4495, 11, 1606, 198, 82977, 433, 1057, 2547, 374, 1888, 50585, 449, 24463, 13, 4452, 1174, 420, 374, 539, 520, 682, 198, 1820, 1162, 627, 791, 4623, 430, 5655, 27027, 31518, 288, 279, 2547, 449, 24463, 220, 439, 7373, 439, 198, 10236, 374, 77772, 13, 1789, 279, 2547, 311, 734, 14614, 1174, 433, 374, 5995, 311, 198, 67913, 467, 279, 8335, 315, 12782, 40589, 323, 24463, 9749, 555, 7138, 627, 791, 12876, 311, 5376, 279, 24463, 2262, 4245, 311, 5655, 27027, 11767, 311, 198, 78, 19472, 78245, 13, 720, 3915, 5655, 27027, 304, 220, 16, 12, 18, 4520, 1070, 374, 264, 18979, 304, 7410, 477, 198, 79343, 354, 2711, 11, 1608, 9355, 11, 18381, 1234, 279, 6548, 5101, 1174, 279, 54060, 67169, 374, 198, 12489, 75325, 11, 279, 39097, 12992, 11, 279, 20545, 315, 39086, 198, 43842, 2315, 11, 15851, 315, 10173, 13, 763, 5369, 11, 83511, 11, 30118, 2968, 39671, 345, 17717, 39436, 988, 11, 323, 439, 264, 1121, 11, 51643, 11, 4851, 8951, 11, 53572, 11, 5099, 13, 720, 4438, 311, 10519, 459, 23669, 8335, 315, 594, 29579, 8149, 11, 279, 8335, 198, 42967, 24463, 323, 12782, 40589, 11, 779, 439, 539, 311, 11682, 279, 2547, 30, 1628, 1268, 198, 285, 27027, 1314, 304, 4689, 30, 15957, 220, 20, 13, 3639, 1288, 387, 6300, 27027, 5380, 720, 13622, 1274, 527, 7347, 311, 1193, 26682, 27027, 11, 477, 17192, 46391, 1174, 47032, 198, 33980, 13, 1628, 4510, 430, 433, 1587, 539, 7958, 872, 2890, 13, 763, 2144, 11, 682, 315, 279, 3485, 198, 9426, 529, 594, 29579, 3567, 43398, 505, 279, 7617, 323, 1306, 264, 1418, 14794, 5196, 304, 198, 1820, 1376, 315, 19338, 627, 1360, 716, 27027, 18065, 279, 1005, 315, 279, 4553, 21271, 8286, 323, 5825, 198, 1820, 2547, 56868, 282, 5499, 24463, 11, 9093, 11, 706, 264, 21730, 31469, 282, 440, 627, 2181, 17610, 315, 2380, 35530, 512, 16, 8, 763, 12821, 60056, 21737, 11745, 320, 77, 74753, 1555, 279, 19689, 317, 17, 8, 1398, 12130, 367, 280, 18, 8, 362, 10015, 18579, 482, 594, 6100, 627, 2460, 2380, 35530, 527, 2744, 3118, 304, 279, 1180, 315, 27027, 13, 1398, 12130, 367, 374, 198, 9274, 832, 2132, 323, 1243, 8272, 555, 264, 18579, 482, 922, 832, 323, 264, 4376, 198, 17859, 323, 279, 471, 315, 27027, 482, 922, 264, 2132, 13, 4212, 5133, 1253, 198, 84076, 11911, 389, 279, 955, 323, 21261, 315, 279, 2865, 13, 1556, 653, 36822, 1732, 198, 4752, 264, 11008, 315, 2380, 35530, 527, 11763, 389, 5578, 220, 845, 3115, 824, 9568, 11, 323, 198, 9210, 315, 264, 16572, 1732, 482, 922, 220, 23, 4235, 605, 3115, 824, 9568, 627, 20215, 82710, 27027, 374, 3984, 369, 555, 279, 7016, 315, 7138, 13, 1628, 358, 649, 198, 395, 554, 499, 11, 433, 374, 279, 1455, 23669, 323, 7524, 13, 65658, 11745, 6892, 88855, 198, 8416, 5820, 315, 279, 23418, 1887, 11, 12992, 279, 16595, 8824, 315, 279, 198, 75, 29222, 11, 6680, 323, 39881, 22815, 50585, 449, 24463, 11, 902, 22223, 264, 198, 91645, 16048, 304, 8244, 2890, 323, 5178, 627, 1383, 279, 1648, 11, 433, 374, 304, 264, 8063, 430, 264, 9498, 1732, 11745, 288, 439, 12722, 439, 198, 10236, 11, 2533, 27027, 539, 70903, 14400, 13, 578, 6373, 315, 576, 1920, 374, 11622, 23217, 311, 279, 42631, 4219, 16853, 720, 51329, 44661, 1296, 27907, 7184, 430, 499, 1440, 1148, 6300, 27027, 374, 11, 1456, 13598, 1268, 499, 198, 65, 1244, 383, 13, 2057, 656, 420, 11, 6929, 264, 2678, 1296, 13, 29508, 389, 264, 10716, 304, 264, 1949, 11, 31467, 198, 3571, 13, 19197, 64771, 342, 1288, 539, 80799, 279, 2547, 662, 13330, 701, 6548, 323, 3868, 198, 2000, 279, 4545, 994, 499, 6865, 701, 1866, 11745, 13, 11359, 1461, 11, 719, 656, 539, 198, 444, 71888, 40978, 449, 279, 1920, 13, 4718, 3465, 374, 311, 1833, 279, 8668, 198, 1073, 21973, 323, 4384, 287, 279, 45274, 627, 1688, 279, 1890, 892, 11, 1176, 39511, 220, 5266, 279, 4827, 961, 315, 279, 45274, 449, 3805, 779, 198, 9210, 279, 23152, 11031, 4741, 1174, 279, 1891, 95896, 76, 5900, 1523, 11, 1243, 279, 6278, 198, 4581, 320, 1820, 56249, 323, 15489, 10205, 8, 323, 5616, 279, 8582, 961, 320, 1820, 1206, 402, 2045, 1288, 198, 32609, 11, 323, 279, 23152, 1288, 387, 13541, 709, 311, 279, 35776, 4390, 16397, 506, 12130, 6400, 308, 11, 701, 23152, 1288, 387, 15107, 304, 11, 279, 1891, 1366, 81, 945, 76, 1288, 198, 32609, 11, 323, 1243, 279, 15489, 323, 28004, 1288, 4827, 662, 29098, 2391, 198, 258, 12130, 367, 323, 506, 12130, 367, 559, 11206, 294, 387, 8579, 11, 11113, 11, 2085, 17676, 503, 337, 2641, 323, 198, 83, 2711, 13, 45901, 1124, 220, 18, 3115, 13, 1952, 279, 11999, 11745, 11, 3412, 701, 11745, 323, 198, 8716, 279, 892, 304, 6622, 13, 5112, 57759, 1604, 323, 5155, 1578, 279, 892, 2391, 902, 198, 9514, 649, 656, 2085, 3805, 16661, 279, 45274, 627, 720, 17561, 384, 279, 436, 1560, 122761, 27907, 644, 1455, 5157, 11, 279, 8250, 315, 77773, 367, 323, 506, 12130, 367, 690, 387, 2204, 627, 55611, 11745, 1560, 2288, 2875, 11, 323, 4423, 11745, 288, 704, 13, 3161, 6300, 198, 21152, 44661, 11, 279, 8250, 315, 77773, 367, 323, 506, 12130, 367, 1288, 387, 279, 1890, 13, 2100, 198, 275, 374, 892, 311, 14243, 1935, 709, 701, 2890, 13, 1666, 5246, 439, 499, 7491, 279, 198, 26522, 2428, 315, 6300, 27027, 11, 433, 690, 3719, 701, 6156, 1205, 323, 14464, 13, 15957, 220, 21, 13, 13182, 1413, 11745, 555, 735, 13, 426, 1088, 88, 9509, 27907, 791, 1887, 315, 37471, 594, 29579, 11, 477, 279, 779, 19434, 3831, 2695, 4473, 198, 40895, 2617, 315, 5655, 27027, 11, 574, 8040, 555, 735, 13, 426, 1088, 88, 9509, 11, 220, 264, 10896, 1174, 264, 198, 48807, 7330, 285, 259, 889, 369, 1690, 1667, 19946, 279, 27692, 315, 16003, 198, 8747, 15920, 520, 279, 10181, 315, 57708, 40023, 323, 19152, 315, 279, 198, 50, 8799, 1122, 16192, 315, 13235, 23199, 315, 279, 73315, 304, 4723, 437, 83560, 4991, 627, 34160, 311, 813, 463, 1897, 11107, 290, 11, 426, 1088, 88, 9509, 810, 1109, 3131, 1047, 311, 1518, 1268, 1274, 1051, 198, 67, 7169, 13, 1283, 14000, 430, 1603, 4648, 11, 264, 1732, 6137, 311, 37397, 17693, 16853, 33, 1088, 88, 9509, 12090, 430, 1778, 19428, 27027, 12716, 4648, 12401, 1174, 323, 198, 19041, 1348, 1436, 387, 279, 5353, 315, 264, 1396, 315, 19338, 627, 12487, 426, 1088, 88, 9509, 6773, 311, 2804, 459, 9526, 449, 813, 1866, 11745, 25, 568, 198, 17805, 279, 37390, 11, 8149, 11, 21261, 662, 4740, 264, 1418, 11, 568, 14000, 430, 279, 198, 11222, 479, 287, 8951, 315, 63308, 6244, 2753, 21420, 11, 44643, 1174, 814, 198, 52898, 6847, 7108, 555, 27027, 23783, 11, 2085, 279, 1520, 315, 198, 2106, 124085, 13, 2100, 279, 1749, 315, 11119, 3079, 43420, 2617, 315, 18682, 11681, 44661, 198, 12692, 1507, 33, 8, 574, 9405, 627, 720, 10445, 499, 1205, 311, 4048, 1268, 311, 1437, 8343, 383 ]
0xBreath/holistic-books
, and the feelings of attraction or repulsion. This energy body, which is the locus of the sense of ‘I’, exists independently of the physical body, as anyone who has ever gone out of body will remember. This ‘karmic body’ is made up of the collected tracks of positionalities. The field of consciousness is an infinite sea of interacting energy fields with various levels that can be calibrated. The fate of an energy body of an individual’s soul is therefore similar to a floating object in space or a cork in the sea in that its innate buoyancy determines the level at which it will settle and float. The nonmaterial realms of existence are composed of energy bodies at various levels in the frequencies of the sea of consciousness that tend to settle into realms. Each of these realms congregates about an attractor field. When the energy body or soul, with its historical collection of frequencies and patterns, separates from the physical body, it then gravitates to a compatible field or domain. These constitute the post- physical life potentialities or choices between the various levels, such as hells, purgatories, limbos, or heavens. Obviously, for some souls, there is also the opportunity, choice, or fate of choosing another physical lifetime. If we ask with muscle testing whether this is a fairly accurate depiction of spiritual reality, we get the answer “yes.” People have definite opinions about such matters, and the question ofreincarnation is a favorite area for argument. All religions, however, agree that the energy body, after physical death, goes on to a fate determined by one’s actions during the physical lifetime. Therefore, the fate is determined primarily by the spiritual decisions and actions that were made, with great importance given to intention, responsibility, and the assent of the Will. Spiritually speaking, whether an actual physical reincarnation occurs or not is really quite academic. The same principles and fate of the energy body remain the same whether it would resume as a physical existence or continue on an energy plane. One’s fate, obviously, will either be for the better or for the worse, depending on the choices made by the spiritual will. It would seem from studies of the spiritual nature of consciousness that the choice to resume another human physical life would be an option that is determined by the innate patterns of a specific soul. Of more importance is the interpretation and understanding of the factors that determine the fate of the soul/energy body and its destiny after physical death. From the foregoing analysis and spiritual research, it appears that one’s ultimate fate is the automatic and impersonal consequence of the energy patterns that have been set up in the aura of the spirit body, i.e., one’s fate after physical death is merely the inevitable consequence of one’s own choice and not a reward or a punishment meted out arbitrarily by some external figure, energy, or power. The self in the infinite sea of the Self gravitates to its fate solely by virtue of its own essence. This is the absolute justice of Almighty God that guarantees absolute fairness and impartiality. Judgment is therefore merely a semantic invention (like causality or heliotropism) that serves as a plausible ‘explanation’ derived from the anthropomorphic presumptions of the human mind. Inasmuch as one’s spiritual destiny is sealed and determined by one’s own hand and its actions, each person, with absolute fairness, determines their own fate. Thus, God’s justice is indeed perfectly self-fulfilling. Mankind then needs to take responsibility for its own fate and stop blaming God, who has been much maligned. In reality, the love of God, like the sun, shines equally on all. With understanding, the spiritual domain makes sense, and there is no need for superstitious, anthropomorphic inventions, and fantasies to explain it. Most of what has been said thus far is in agreement with most of mankind’s accumulated spiritual information and experience. If, spiritually, everything happens as a consequence of Free Will, and there are no ‘forces’ to ‘cause’ anything that is not in accordance, then the question of physical reincarnation becomes clarified. If it occurs, it wouldhave to be by choice and assent of the spiritual will, and it would then be determined by ‘karmic’ propensities. The stronger one identifies with the physical body and earthly life, the stronger will be the pull or attraction of another earthly life. It is obvious that an attraction to reincarnating would be to undo or propitiate for past spiritual mistakes. Many souls apparently do decide that the only just propitiation is to suffer the same fate they have meted out to others. We certainly see that millions of souls choose lifetimes with disastrous endings. Even the chosen form of death is frequently so unique and specific that one intuits there must have been strong karmic determining factors involved in the specificity of the choice. Suicides also frequently take very specifically chosen forms and styles, with very specific meanings. We can postulate that if lifetimes of the soul can be lived either in or out of the physical domain on either the physical or energy planes, then an almost infinite sequence of lifetimes is obviously quite possible. This formulation is in agreement with the ancient sages, the Vedas , and the teachings of Krishna, Buddha, and Hinduism, as well as other ancient religions. At very advanced levels of consciousness, enlightened sages are able to recall prior lifetimes that are often described as having been very numerous. In the out-of-body experience, also, people remember that their energy body has inhabited prior physical bodies. Young children are also prone to recalling prior lifetimes, and studies show this to be a rather frequent occurrence. A sage was asked how real previous incarnations are and he replied that they are as real as this one—no more, no less. The interest in whether one has had previous lifetimes is more than just a reflection of the ego’s vanity or self-interest. Of more importance is that the understanding of how divine justice works out clarifies misunderstandings about the nature of the ego. It also clarifies Christian teachings that “As ye sow, so shall ye reap”; “People who live in glass houses shouldn’t throw stones;” “Those who live by the sword die by the sword”; “Not a hair
[ 11, 53577, 33188, 1186, 96551, 826, 44323, 198, 3064, 1335, 82266, 74831, 34003, 13, 41065, 197, 17947, 36502, 11, 197, 8370, 20501, 33188, 72228, 355, 44323, 33188, 1942, 1137, 44323, 198, 14336, 40, 20182, 8285, 1705, 17886, 20080, 4501, 44323, 33188, 197, 47692, 36502, 11, 61551, 197, 3852, 606, 197, 14965, 64355, 197, 2099, 198, 46696, 14294, 44323, 36502, 6831, 484, 197, 30380, 13, 41065, 197, 14336, 74, 2227, 292, 36502, 529, 20501, 2157, 1037, 60910, 44323, 33188, 198, 2119, 2258, 26665, 7977, 44323, 29264, 3079, 1385, 627, 465, 33026, 40350, 44323, 38303, 23995, 2136, 20501, 80557, 17886, 26806, 197, 37541, 44323, 60015, 36022, 197, 17947, 56376, 198, 4291, 2462, 1245, 197, 43664, 64442, 94036, 74242, 92853, 61666, 13, 33026, 1186, 349, 44323, 80557, 197, 17947, 36502, 44323, 80557, 198, 55977, 753, 1942, 11206, 20501, 197, 19041, 1348, 1942, 79962, 32809, 11575, 1186, 29593, 36898, 17886, 1942, 1330, 82266, 11575, 1470, 672, 198, 258, 33188, 197, 37541, 17886, 64442, 197, 1220, 197, 6258, 349, 2282, 84, 2303, 6709, 2765, 16890, 288, 33188, 54843, 36547, 197, 8370, 24263, 6831, 484, 198, 751, 11489, 53577, 8302, 627, 465, 33026, 197, 6414, 8407, 92974, 1026, 44323, 8285, 81624, 197, 548, 33910, 3950, 44323, 197, 17947, 2282, 10233, 36547, 198, 959, 1245, 197, 43664, 17886, 33188, 1186, 72831, 44323, 33188, 197, 37541, 44323, 38303, 23995, 2136, 64442, 3324, 408, 32809, 198, 751, 11489, 2129, 78, 92974, 1026, 13, 197, 4959, 44323, 197, 45010, 92974, 1026, 38303, 8157, 988, 197, 9274, 80557, 36547, 55866, 198, 2630, 13, 197, 4599, 33188, 197, 17947, 36502, 82266, 1942, 11206, 11, 48048, 197, 1220, 9793, 96798, 1470, 1947, 44323, 198, 69, 72831, 53577, 3303, 3307, 82, 11, 85786, 1768, 988, 43827, 33188, 197, 47692, 36502, 11, 24263, 59733, 198, 36490, 82829, 32809, 11575, 197, 35942, 40350, 82266, 2765, 3199, 13, 197, 9673, 4882, 275, 1088, 33188, 52272, 7058, 47692, 8986, 1643, 3303, 354, 2335, 1385, 82266, 197, 25825, 2282, 10259, 33188, 2462, 1245, 197, 43664, 11, 1942, 1412, 61551, 198, 71, 6572, 11, 3303, 5673, 38270, 11, 197, 4763, 79548, 11, 82266, 197, 383, 402, 729, 13, 197, 49314, 11, 2066, 1942, 638, 1942, 283, 4835, 11, 197, 19041, 20501, 198, 19171, 33188, 40803, 68164, 11, 197, 12008, 11, 82266, 1186, 349, 44323, 197, 971, 14759, 197, 43063, 197, 47692, 8986, 29615, 627, 2746, 197, 906, 197, 1091, 48048, 2157, 355, 9326, 197, 9016, 197, 49864, 2090, 20501, 11575, 1186, 1334, 398, 197, 37021, 349, 197, 15237, 2538, 44323, 198, 86390, 940, 17643, 2786, 11, 197, 906, 10582, 33188, 73670, 197, 2118, 9891, 49216, 465, 10230, 68, 1184, 9793, 525, 7604, 16235, 40803, 84996, 197, 9274, 1942, 1412, 2157, 10385, 11, 53577, 33188, 197, 7998, 44323, 265, 2910, 55149, 20501, 11575, 1186, 15995, 96168, 2066, 197, 14819, 13, 197, 2460, 197, 3833, 343, 919, 11, 197, 98936, 11, 197, 69200, 198, 9210, 33188, 197, 17947, 36502, 11, 197, 10924, 197, 47692, 59451, 589, 11, 3253, 7217, 25653, 32809, 11575, 1186, 349, 2765, 47737, 197, 1729, 198, 606, 753, 197, 4109, 2765, 1711, 33188, 197, 47692, 8986, 29615, 13, 197, 55915, 11, 33188, 1186, 349, 20501, 2765, 47737, 198, 18375, 6751, 197, 1729, 33188, 1942, 53829, 940, 197, 8332, 6948, 53577, 197, 4109, 64442, 6831, 486, 2157, 1037, 11, 48048, 3253, 1244, 198, 475, 685, 3253, 2116, 32809, 2129, 3012, 11, 10413, 2805, 3225, 11, 53577, 33188, 197, 395, 306, 44323, 33188, 197, 10149, 627, 465, 7721, 53829, 1870, 1942, 375, 1802, 11, 197, 49864, 80557, 89914, 197, 47692, 17643, 2910, 55149, 197, 14310, 1759, 82266, 198, 1962, 20501, 17643, 750, 197, 84270, 197, 91356, 13, 33026, 1942, 373, 26736, 5824, 645, 53577, 1186, 349, 44323, 33188, 197, 17947, 198, 2664, 197, 48684, 33188, 1942, 373, 197, 49864, 24263, 6831, 619, 10413, 3972, 61551, 11575, 197, 47692, 8285, 81624, 82266, 198, 9726, 25653, 80557, 197, 17947, 197, 19563, 13, 197, 4054, 753, 1186, 349, 11, 64453, 18785, 11, 6831, 484, 7883, 2544, 74242, 2066, 33188, 198, 58234, 82266, 2066, 33188, 6831, 11073, 11, 197, 81580, 25653, 33188, 197, 25825, 2157, 1037, 197, 1729, 33188, 1942, 53829, 940, 198, 14724, 13, 62635, 6831, 619, 85786, 336, 43827, 18895, 58787, 44323, 33188, 1942, 53829, 940, 9215, 1598, 44323, 38303, 23995, 2136, 198, 9210, 33188, 197, 12008, 32809, 10413, 3972, 197, 43063, 9793, 7282, 197, 47692, 8986, 1643, 6831, 619, 74242, 80557, 81945, 198, 9210, 20501, 2765, 47737, 197, 1729, 33188, 197, 6258, 349, 3303, 3307, 82, 44323, 11575, 1942, 15934, 1942, 11206, 13, 197, 2173, 2157, 461, 198, 475, 685, 20501, 33188, 60015, 8203, 367, 53577, 197, 8154, 10276, 44323, 33188, 1186, 21846, 64442, 198, 67, 25296, 33188, 1186, 349, 44323, 33188, 1942, 11206, 14, 17947, 36502, 53577, 197, 1220, 50716, 6577, 197, 10924, 197, 47692, 198, 63007, 627, 465, 197, 3915, 33188, 1186, 461, 9738, 197, 35584, 53577, 1942, 53829, 940, 17643, 1874, 11, 24263, 197, 34531, 1590, 64442, 197, 606, 753, 198, 67666, 1186, 349, 20501, 33188, 197, 84556, 53577, 197, 6802, 1293, 278, 38303, 15880, 44323, 33188, 197, 17947, 198, 27061, 64442, 9793, 525, 74242, 268, 8360, 60910, 17886, 33188, 197, 22290, 44323, 33188, 1942, 53829, 36502, 11, 8394, 1770, 2637, 197, 606, 753, 1186, 349, 198, 10924, 197, 47692, 59451, 589, 20501, 197, 1195, 989, 33188, 197, 483, 85, 15729, 38303, 15880, 44323, 197, 606, 753, 197, 785, 198, 12008, 53577, 98366, 11575, 17643, 1637, 82266, 11575, 3303, 359, 16409, 2157, 25489, 14294, 70440, 4590, 81, 6751, 197, 1729, 1942, 638, 198, 21591, 197, 18257, 11, 197, 17947, 11, 82266, 3303, 1223, 13, 33026, 5311, 17886, 33188, 17886, 26806, 197, 37541, 44323, 33188, 7721, 491, 198, 36490, 82829, 32809, 197, 1220, 1186, 349, 197, 1575, 398, 197, 1729, 5306, 2154, 361, 44323, 197, 1220, 197, 785, 197, 434, 768, 13, 41065, 20501, 33188, 198, 17625, 197, 39868, 44323, 197, 2149, 68405, 9796, 347, 64442, 3253, 19253, 5048, 288, 197, 17625, 1186, 1334, 2136, 53577, 198, 318, 38520, 488, 13, 17538, 664, 9247, 20501, 197, 19041, 1348, 197, 1195, 989, 11575, 197, 48958, 17886, 7611, 197, 7, 4908, 198, 936, 355, 2786, 82266, 9793, 301, 11345, 897, 2191, 8, 64442, 1942, 13583, 61551, 11575, 73313, 43736, 197, 14336, 327, 36990, 529, 197, 51182, 198, 1527, 33188, 197, 32329, 897, 71017, 3303, 417, 372, 1324, 44323, 33188, 9793, 7282, 2157, 485, 627, 465, 71267, 10753, 1412, 61551, 197, 606, 753, 1942, 53829, 940, 50716, 6577, 20501, 197, 77040, 53577, 2765, 47737, 197, 1729, 197, 606, 753, 198, 785, 9793, 438, 53577, 197, 1220, 197, 4109, 11, 7883, 613, 99905, 11, 48048, 197, 17625, 1186, 1334, 2136, 11, 2765, 16890, 288, 198, 50828, 197, 785, 1186, 349, 13, 197, 45600, 11, 9796, 347, 753, 197, 39868, 20501, 17886, 451, 291, 197, 64185, 398, 5311, 12, 1285, 7712, 287, 627, 44, 70370, 59733, 197, 56345, 32809, 3324, 731, 10413, 2805, 3225, 2066, 197, 1220, 197, 785, 1186, 349, 53577, 63744, 198, 2067, 6605, 9796, 347, 11, 197, 14965, 64355, 74242, 268, 2157, 1412, 2157, 48242, 13, 71267, 17643, 2786, 11, 33188, 197, 31153, 44323, 9796, 347, 345, 4908, 33188, 1942, 359, 11, 37296, 1572, 7883, 447, 750, 25653, 52060, 13, 197, 2409, 197, 8154, 10276, 11, 33188, 1942, 53829, 940, 198, 12482, 2157, 2094, 1942, 1137, 11, 53577, 197, 19041, 20501, 73204, 197, 17483, 2066, 12750, 3781, 1245, 345, 32329, 897, 71017, 17886, 31759, 11, 53577, 1186, 77914, 552, 32809, 8285, 21435, 24263, 627, 465, 9391, 537, 44323, 197, 12840, 64355, 74242, 268, 1942, 3864, 197, 34232, 1186, 277, 20501, 17886, 197, 351, 17589, 48048, 2157, 537, 44323, 198, 76, 70370, 753, 197, 40031, 7913, 1942, 53829, 940, 17886, 1659, 53577, 8285, 13267, 13, 52792, 345, 86390, 1870, 11, 7883, 1225, 1626, 9793, 680, 729, 61551, 11575, 38303, 15880, 44323, 197, 11180, 197, 10149, 11, 53577, 197, 19041, 198, 548, 73204, 197, 14336, 49896, 529, 32809, 197, 14336, 1593, 529, 197, 73254, 64442, 20501, 98366, 17886, 197, 4575, 541, 685, 11, 59733, 33188, 198, 7998, 44323, 197, 47692, 17643, 2910, 55149, 2282, 762, 20969, 197, 13115, 1908, 13, 52792, 24263, 197, 14310, 1759, 11, 24263, 6831, 619, 19553, 32809, 74242, 197, 1729, 197, 12008, 53577, 197, 395, 306, 44323, 33188, 1942, 53829, 940, 6831, 484, 11, 53577, 24263, 6831, 619, 59733, 74242, 198, 67, 47737, 197, 1729, 197, 14336, 74, 2227, 292, 529, 80344, 729, 1385, 627, 465, 33026, 197, 4620, 261, 197, 606, 197, 1748, 9803, 48048, 33188, 197, 47692, 36502, 53577, 197, 28641, 398, 8986, 1643, 11, 33188, 198, 4620, 261, 6831, 484, 74242, 33188, 3303, 620, 82266, 62043, 1335, 44323, 197, 43063, 197, 28641, 398, 8986, 1643, 13, 62635, 20501, 64453, 2528, 198, 9210, 80557, 62043, 1335, 32809, 17643, 2910, 1923, 1113, 6831, 619, 74242, 32809, 197, 13807, 82266, 80344, 275, 6629, 2066, 3303, 561, 198, 86390, 940, 2157, 380, 2094, 13, 197, 8607, 1942, 283, 4835, 29336, 31227, 20530, 197, 8332, 579, 64442, 33188, 197, 3323, 197, 4345, 198, 2741, 275, 7246, 20501, 32809, 1942, 2084, 33188, 1942, 373, 1186, 349, 197, 20670, 9793, 525, 2157, 25489, 14294, 32809, 23021, 3058, 13, 197, 1687, 198, 66, 7770, 398, 197, 4151, 64442, 2157, 91387, 44323, 1942, 283, 4835, 197, 28150, 8986, 333, 7034, 48048, 2765, 10994, 496, 788, 198, 408, 826, 13, 197, 13461, 33188, 23918, 8477, 38510, 44323, 59451, 589, 20501, 1186, 70941, 197, 708, 197, 9782, 53577, 198, 52340, 64442, 197, 606, 2129, 12059, 197, 19041, 2157, 592, 9793, 525, 74242, 268, 197, 4620, 16868, 2227, 292, 2765, 16890, 287, 198, 69, 21846, 197, 14386, 8905, 17886, 33188, 1942, 15934, 488, 44323, 33188, 197, 12008, 13, 7721, 84, 76195, 197, 19171, 1186, 70941, 198, 23609, 197, 1225, 1942, 15934, 750, 23918, 8477, 197, 10008, 53577, 197, 4041, 11, 48048, 197, 1225, 1942, 15934, 198, 14622, 826, 627, 465, 197, 1687, 94036, 52272, 6468, 64442, 748, 8986, 333, 7034, 44323, 33188, 1942, 11206, 94036, 74242, 8986, 2270, 7883, 2544, 17886, 82266, 198, 412, 44323, 33188, 197, 47692, 2765, 3199, 25653, 7883, 2544, 33188, 197, 47692, 82266, 197, 17947, 197, 39157, 11, 59733, 80557, 198, 60301, 17886, 26806, 197, 15880, 44323, 8986, 333, 7034, 20501, 64453, 18785, 197, 84270, 197, 10236, 13, 41065, 198, 630, 2987, 20501, 17886, 197, 351, 17589, 48048, 33188, 197, 1149, 1188, 1942, 1154, 11, 33188, 1602, 53, 291, 300, 198, 11, 53577, 33188, 198, 668, 613, 826, 44323, 40440, 95007, 3458, 11, 13083, 8512, 4317, 11, 53577, 13595, 485, 84, 2191, 11, 61551, 6831, 616, 61551, 197, 1605, 197, 1149, 1188, 198, 3833, 343, 919, 627, 465, 197, 1688, 197, 1225, 197, 42879, 197, 43664, 44323, 38303, 23995, 2136, 11, 82948, 4238, 6901, 1942, 1154, 197, 548, 197, 481, 32809, 198, 94928, 3303, 3334, 8986, 333, 7034, 64442, 197, 548, 197, 61917, 54012, 17890, 61551, 9793, 2370, 74242, 268, 197, 1225, 198, 76696, 788, 13, 71267, 33188, 14294, 8838, 9534, 8285, 13267, 11, 197, 19171, 11, 197, 16455, 197, 30380, 64442, 33188, 404, 198, 17947, 36502, 64355, 17886, 10796, 1639, 3303, 3334, 197, 47692, 2282, 10233, 13, 197, 41672, 83570, 197, 548, 197, 19171, 198, 652, 606, 32809, 69004, 17157, 3303, 3334, 8986, 333, 7034, 11, 53577, 18895, 58787, 33827, 2090, 32809, 74242, 11575, 7145, 1894, 198, 69, 70791, 197, 14310, 21201, 13, 23845, 1942, 425, 6831, 300, 197, 1091, 291, 197, 5269, 92974, 197, 20281, 197, 2910, 1923, 811, 197, 548, 198, 438, 197, 383, 17643, 3523, 64442, 197, 20670, 197, 548, 61551, 92974, 61551, 2090, 197, 606, 2345, 2201, 2157, 461, 11, 73204, 197, 1752, 627, 465, 33026, 60015, 478, 17886, 197, 49864, 197, 606, 64355, 9793, 329, 197, 20281, 8986, 333, 7034, 20501, 2157, 461, 197, 54895, 197, 4345, 198, 64, 60604, 1191, 44323, 33188, 197, 13546, 753, 5306, 39370, 82266, 5311, 65873, 13, 197, 2173, 2157, 461, 22682, 685, 20501, 64442, 198, 1820, 197, 8154, 10276, 44323, 197, 5269, 64378, 483, 197, 39868, 197, 19033, 14294, 197, 13115, 9803, 198, 34965, 8154, 2752, 826, 197, 9274, 33188, 9215, 1598, 44323, 33188, 197, 13546, 13, 62635, 197, 19171, 197, 13115, 9803, 197, 42042, 198, 668, 613, 826, 64442, 197, 61553, 197, 9188, 1942, 363, 11, 197, 708, 197, 19549, 197, 9188, 17643, 391, 66545, 197, 2118, 16298, 197, 14965, 8986, 535, 17886, 3253, 448, 198, 37841, 197, 5562, 77, 1431, 9776, 18895, 3233, 26, 863, 197, 2118, 23025, 197, 14965, 8986, 535, 197, 1729, 33188, 1942, 1178, 38004, 197, 1729, 33188, 198, 80138, 66545, 197, 2118, 2688, 11575, 9793, 1334 ]
0xBreath/holistic-books
-- -- -- Southwest -- West Facing southwest, pose as if you were about to fight. Bend the knees slightly. Bend the anns slightly and clench the fists. Make your eyes bulge out with rage. Your mind must be with your body. Hold this pose as long as you wish. This exercise benefits the digestive system, lungs, and nerves. Facing west, stand with your feet shoulder-width apart. Point the toes slightly inward. Raise one hand up in the air. Then bring the hand down and raise the other hand. Try to keep your abdomen still. As you do this your mind should follow these actions. Do this exercise as many times as you like, as this exercise helps lower back pain, shoul­ der pain, kidney problems, and spinal problems. 68 The lnterMl Exercises Figure 17. Western Exe rcis e. These exercises are extremely versati le as they can be done anywhere, anytime. In two min utes, a homemaker, an executive, soldier, athlete, or anyone else can energize their tired bodies and minds. When the body is energized, business problems are solved easily, durab ility of the body is increased-anything is simplified. TWELVE ZODIAC EXERCISES Life is to live, and livin g is a functi on. This function is described by a Taoist formula, which is as follows : 69 The Internal Exe rcises Let f = function o =organ e =energy f=o+e In order to function, both organ and energy must be present. An organ without energy is dead. Pure energy without an organ is a ghost. Life will be meaningful-have a function-on ly when organ and energy are together. Apart from the many methods of harnessing and utilizing energy to balance the organ systems, Taoists have also created methods for maintaining the energy balance of specific organs. These involve the usage oftime as measured by the biorhythmic clock to adjust imbalances by either dispersing (weakening) energy or toning (strengthening) energy. Biorhythm-often referred to as the biological clock-is the regulation of the flow of energy within the body in relation to both solar and lunar time measurement. The word ''biorhythm '' encompasses all those concepts that denote the natural, inherent pulse underlying all functional aspects of life. In many ways this rhythm is taken for granted because being aware of it would, in a sense, be the same as being constantly aware of the rhythmical basis of one's own breathing. Because it has such a subtle and elusive nature, biorhythm is best exempl ified when it is disrupted. Jet fatigue-the consequence of suddenly traveling from one time zone to another-is a perfect example of how the body's natural rhythm is disrupted as a result of long-di stance travel in a short period of time. It is sometimes difficult to conceive of the body functioning on a strict time schedule until one is abruptly placed in an environment regulated by a different schedule. The stress of having to readjust to an environment in relation to time makes one intensely aware of how rigidly scheduled the bodily functions are. Taoists, after observing the circulation of energy throughout the body, fonnulated biorhythm cycles that precisely account for the energy flow along the meridian circuit during every second of the day. It was discovered that each of the main meridians has two-hour periods, called "watches", during which energy has a maximum intensity of circulation. For example, between 9 and 11 a.m., energy is at its peak in the spleen-pancreas meridian. It is during this time interval that the spleen-pancreas works the hardest. Between 11 a.m. and 1 p.m., when the energy activates the heart 70 The lnt�rnal Ex�rcis�s meridian, it is simultaneously at a minimum intensity in the spleen­ pancreas meridian. There are twelve "watches" in a day, and they corre­ spond to the twelve houses of the Zodiac. The following table lists the ''watches'' and the hours during which energy reaches its peak in each of the organs and bowels and their respective meridians. Table 3. Biorhythm Cycles. 1-3 A.M. Liver � A.M. Lung 5-7 A.M. Large Intestine 7-9 A.M. Stom ach 9-11 A.M. Spleen-P ancreas 11-1 P.M. Heart 1-3 P.M. Small Intestine 3-5 P.M. Bladder 5-7 P.M. Kidn ey 7-9 P.M. Heart Constrict or 9-11 P.M. Triple Heater 11-1 A.M. Gallbladder Utilizing the biorhythm table will prove to be especially benefic ial in pinpointing the specific organic causes of discomfort and balancing the energy level of that organ through the application of exercises that will either disperse or intromit energy, according to the needs of the organ. For example, if insomnia causes you to wake up between 1 and 3 o'clock in the morning regularly, a look at the table will tell you that the cause of the insomnia is a disorderly liver or nervous system. The aftereff ects of insomnia-poor performance at work, tiredne ss, feeling of guilt, etc.­ can be eliminated by applying the exercise appropriated for the I to 3 o'clock time interval. If you are constip ated, the cause can be traced to untimely bowel movements. The recommended and biorhythmical ly de­ termined time for bowel movements is from 5 to 7 o'clock in the morning. If you follow this schedule for bowel movemen ts, you will not have to suffer from drugs, enemas, etc. 71 The Internal Exercises The exercises for these and other prob lems are called Twelve Zodiac Exercises, and they are listed in the order of the "watches" they corre­ spond to. They are: Watch A (1-3 a.m.) If ever you are awake during this time interval, you might want to sit with your legs crossed and try to see the tip of your nose. Drop your eyelids halfway to do this. Repeated attempts will enable you to see the tip of your nose. Also wrap the fingers around the thumb to make a closed fist and rest the fists on your knees. (Closing the fist retains the energy emitted from the fingers.) Breathe deeply and relax. Do this exerc ise for S to 30 minutes-the length of time is detennined by you. Figure 18. Watch A. 72 The Internal Exercises Watc h B (3-5 a.m.) If ever you are awake during this time interval, sit with your legs crossed or in a position most com­ fortab le to you. Close your eyes halfway and look at your nose. Do this as you hold your head by lacing your fingers behin d the head and support­ ing with your palms. Then click your teeth. Deep­ ly and slowly inhale and exhale nine times. Re­ peat this exerc ise for 5 to 30 minut es. Figure 19. Watch B. Watch C (5-7 a.m.) Cover the ears with the palms of your hands. Tap on the back of your head with your middle or index fingers so that a drum-like sound is made. This is called''Beating the Heaven ly Drum ''. Then count your breaths. Inhale and count "one". Exhale and count "two". Inhale and count "three". And so on. Do this very slowly until you have reached the count of nine. (More about this exercise later.) 73 The Internal Exercises Figure 20. Watch C. Watch D (7-9 a.m.) Sitwithyourlegscrossed. Nowuseyourhandsto hold the shins of your legs to support your upper body as you move your upper body around in circles. Make the circles as large as you can. Move freely. Reverse directions now and then to prevent dizziness. Do this exercise several times. Figure 21. Watch D. 74 The Internal Exe rcises Watch E (9-11 a.m.) Brush your teeth with your tongue. This creates saliva. Save the saliva until you have a mouthful. Then rinse your mouth with the saliva by swishing the saliva around in the your mouth as if it were mouthwash. Swallow the saliva slowly by divid­ ing the mouthful of saliva into three swallows. Do this exercise several times. (More about this later.) Watch F Figure 22. Watch E. (11 a.m. to 1 p.m.) Remove clothing. Sit in a comfortable position. Inhale and hold your breath. Rub your hands together vigorously to generate heat and im­ mediately place them on your back in the area of Figure 23. Watch F. 75 The Internal Exe rcises the kidneys and rub until you cannot
[ 720, 7233, 7233, 7233, 26070, 11285, 720, 7233, 24188, 96418, 54085, 11, 17477, 439, 422, 499, 1051, 922, 311, 720, 21828, 13, 48838, 279, 31624, 10284, 13, 48838, 279, 3008, 82, 720, 3306, 73048, 323, 1206, 20345, 279, 81784, 13, 7557, 701, 6548, 720, 16501, 713, 704, 449, 34049, 13, 4718, 4059, 2011, 387, 449, 701, 720, 2664, 13, 23588, 420, 17477, 439, 1317, 439, 499, 6562, 13, 1115, 720, 64562, 7720, 279, 60071, 1887, 11, 45274, 11, 323, 720, 77, 13583, 13, 720, 70957, 9909, 11, 2559, 449, 701, 7693, 17308, 9531, 720, 391, 472, 13, 5236, 279, 45713, 10284, 63018, 13, 43646, 832, 720, 10888, 709, 304, 279, 3805, 13, 5112, 4546, 279, 1450, 1523, 323, 720, 19223, 279, 1023, 1450, 13, 9934, 311, 2567, 701, 64772, 720, 44466, 13, 1666, 499, 656, 420, 701, 4059, 1288, 1833, 1521, 720, 4109, 13, 3234, 420, 10368, 439, 1690, 3115, 439, 499, 720, 4908, 11, 439, 420, 10368, 8779, 4827, 1203, 6784, 11, 559, 11206, 5879, 198, 1126, 6784, 11, 39042, 5435, 11, 323, 50112, 5435, 662, 720, 2614, 578, 326, 406, 261, 44, 75, 91554, 720, 22804, 220, 1114, 13, 720, 55924, 1398, 68, 10402, 285, 384, 13, 720, 9673, 23783, 527, 9193, 5553, 9491, 514, 439, 814, 649, 387, 2884, 12660, 11, 720, 3852, 1712, 13, 763, 1403, 1332, 220, 2142, 1174, 264, 5105, 59775, 11, 459, 11145, 1174, 27202, 11, 34880, 1174, 477, 720, 3852, 606, 775, 649, 4602, 553, 872, 19781, 13162, 323, 20663, 662, 3277, 279, 2547, 374, 720, 804, 70, 1534, 1174, 2626, 5435, 527, 29056, 6847, 1174, 10878, 370, 220, 1429, 315, 279, 2547, 374, 720, 43842, 1503, 12, 73254, 374, 44899, 662, 720, 48169, 2818, 4592, 1901, 2114, 40, 1741, 4154, 28534, 9311, 50, 720, 26833, 374, 311, 3974, 11, 323, 15471, 258, 342, 374, 264, 42151, 72, 389, 13, 1115, 734, 374, 7633, 555, 264, 720, 51, 3524, 380, 15150, 11, 902, 374, 439, 11263, 551, 720, 3076, 578, 15774, 1398, 68, 10402, 5014, 720, 10267, 282, 284, 734, 720, 78, 284, 8629, 720, 68, 284, 17947, 720, 69, 86976, 10, 68, 720, 644, 2015, 311, 734, 11, 2225, 2942, 323, 4907, 2011, 387, 3118, 13, 1556, 2942, 720, 30096, 4907, 374, 5710, 13, 30688, 4907, 2085, 459, 2942, 374, 264, 20457, 13, 9601, 690, 720, 1395, 23222, 69584, 264, 734, 10539, 14869, 994, 2942, 323, 4907, 527, 720, 998, 3522, 13, 35802, 505, 279, 1690, 5528, 315, 33508, 287, 323, 35988, 4907, 720, 998, 8335, 279, 2942, 6067, 1174, 60608, 1705, 617, 1101, 3549, 5528, 369, 720, 67913, 2101, 279, 4907, 8335, 315, 3230, 36853, 13, 4314, 21736, 279, 10648, 720, 14450, 547, 439, 17303, 555, 279, 293, 2521, 23394, 21914, 9042, 311, 7652, 737, 76527, 555, 3060, 720, 30895, 388, 287, 320, 906, 74462, 8, 4907, 477, 8941, 287, 320, 67523, 18972, 287, 8, 4907, 13, 720, 33, 2521, 61254, 12, 61917, 14183, 311, 439, 279, 24156, 9042, 31530, 279, 19812, 720, 1073, 279, 6530, 315, 4907, 2949, 279, 2547, 304, 12976, 311, 2225, 13238, 323, 57811, 892, 720, 82525, 13, 578, 3492, 3436, 65, 2521, 61254, 3436, 71010, 682, 1884, 19476, 430, 720, 5294, 1295, 279, 5933, 11, 38088, 28334, 16940, 682, 16003, 13878, 315, 2324, 13, 720, 644, 1690, 5627, 420, 37390, 374, 4529, 369, 11938, 1606, 1694, 8010, 315, 433, 720, 41450, 11, 304, 264, 5647, 11, 387, 279, 1890, 439, 1694, 15320, 8010, 315, 279, 37390, 950, 720, 89926, 315, 832, 596, 1866, 27027, 13, 9393, 433, 706, 1778, 264, 27545, 323, 66684, 720, 67812, 11, 293, 2521, 61254, 374, 1888, 39039, 422, 1142, 994, 433, 374, 69627, 13, 720, 36741, 36709, 10826, 29774, 315, 15187, 21646, 505, 832, 892, 10353, 720, 998, 2500, 31530, 264, 4832, 3187, 315, 1268, 279, 2547, 596, 5933, 37390, 374, 720, 4338, 87054, 439, 264, 1121, 315, 1317, 51389, 30031, 5944, 304, 264, 2875, 4261, 315, 892, 13, 1102, 374, 720, 57753, 5107, 311, 77151, 315, 279, 2547, 31301, 389, 264, 7452, 892, 720, 29730, 3156, 832, 374, 60845, 9277, 304, 459, 4676, 35319, 555, 264, 720, 64750, 9899, 13, 578, 8631, 315, 3515, 311, 1373, 4345, 311, 459, 4676, 304, 720, 23013, 311, 892, 3727, 832, 70733, 8010, 315, 1268, 33956, 398, 13847, 279, 720, 65, 347, 1570, 5865, 527, 13, 720, 51, 3524, 1705, 11, 1306, 46071, 279, 35855, 315, 4907, 6957, 279, 2547, 11, 720, 22188, 77, 7913, 293, 2521, 61254, 25492, 430, 24559, 2759, 369, 279, 4907, 6530, 720, 39393, 279, 4809, 36742, 16622, 2391, 1475, 2132, 315, 279, 1938, 13, 1102, 574, 11352, 720, 9210, 1855, 315, 279, 1925, 4809, 307, 5493, 706, 1403, 21925, 18852, 11, 2663, 330, 86, 9296, 498, 720, 82977, 902, 4907, 706, 264, 7340, 21261, 315, 35855, 13, 1789, 3187, 11, 720, 42967, 220, 24, 323, 220, 806, 264, 749, 2637, 4907, 374, 520, 1202, 16557, 304, 279, 87450, 268, 12, 857, 846, 300, 720, 1195, 36742, 13, 1102, 374, 2391, 420, 892, 10074, 430, 279, 87450, 268, 12, 857, 846, 300, 4375, 279, 720, 13279, 5086, 13, 28232, 220, 806, 264, 749, 13, 323, 220, 16, 281, 749, 2637, 994, 279, 4907, 75042, 279, 4851, 720, 2031, 578, 326, 406, 5809, 36722, 278, 1398, 5809, 1310, 285, 52063, 720, 1195, 36742, 11, 433, 374, 25291, 520, 264, 8187, 21261, 304, 279, 87450, 268, 5879, 198, 857, 846, 300, 4809, 36742, 13, 2684, 527, 30335, 330, 86, 9296, 1, 304, 264, 1938, 11, 323, 814, 12603, 5879, 198, 82, 3595, 311, 279, 30335, 15316, 315, 279, 98179, 13, 578, 2768, 2007, 11725, 279, 720, 4708, 86, 9296, 4708, 323, 279, 4207, 2391, 902, 4907, 25501, 1202, 16557, 304, 1855, 315, 720, 1820, 36853, 323, 15631, 2053, 323, 872, 20081, 4809, 307, 5493, 13, 720, 2620, 220, 18, 13, 426, 2521, 61254, 356, 16182, 13, 720, 16, 12, 18, 362, 1345, 13, 22617, 720, 5809, 362, 1345, 13, 78336, 720, 20, 12, 22, 362, 1345, 13, 20902, 1357, 478, 483, 720, 22, 12, 24, 362, 1345, 13, 800, 316, 34361, 720, 24, 12, 806, 362, 1345, 13, 328, 698, 268, 9483, 459, 846, 300, 720, 806, 12, 16, 393, 1345, 13, 18449, 720, 16, 12, 18, 393, 1345, 13, 15344, 1357, 478, 483, 720, 18, 12, 20, 393, 1345, 13, 2563, 21473, 720, 20, 12, 22, 393, 1345, 13, 32666, 77, 3999, 720, 22, 12, 24, 393, 1345, 13, 18449, 1221, 6765, 477, 720, 24, 12, 806, 393, 1345, 13, 37749, 88528, 720, 806, 12, 16, 362, 1345, 13, 25919, 2067, 21473, 720, 2810, 4954, 279, 293, 2521, 61254, 2007, 690, 12391, 311, 387, 5423, 4270, 292, 220, 532, 304, 720, 13576, 2837, 287, 279, 3230, 17808, 11384, 315, 44776, 323, 44463, 279, 720, 17947, 2237, 315, 430, 2942, 1555, 279, 3851, 315, 23783, 430, 690, 720, 50998, 834, 82344, 477, 528, 442, 275, 4907, 11, 4184, 311, 279, 3966, 315, 279, 2942, 13, 1789, 720, 8858, 11, 422, 83511, 11384, 499, 311, 15508, 709, 1990, 220, 16, 323, 220, 18, 297, 63510, 304, 279, 720, 57902, 1251, 15870, 1174, 264, 1427, 520, 279, 2007, 690, 3371, 499, 430, 279, 5353, 315, 279, 720, 1354, 50405, 374, 264, 19823, 398, 26587, 477, 23418, 1887, 13, 578, 1306, 6581, 384, 62003, 315, 720, 1354, 50405, 2320, 10922, 5178, 520, 990, 11, 19781, 818, 11107, 11, 8430, 315, 34951, 11, 5099, 13, 5879, 198, 4919, 387, 34373, 555, 19486, 279, 10368, 87513, 369, 279, 358, 311, 220, 18, 720, 78, 63510, 892, 10074, 662, 1442, 499, 527, 738, 575, 520, 291, 11, 279, 5353, 649, 387, 51400, 311, 720, 3935, 318, 989, 66358, 19567, 13, 578, 11349, 323, 293, 2521, 61254, 950, 14869, 409, 5879, 198, 23827, 291, 892, 369, 66358, 19567, 374, 505, 220, 20, 311, 220, 22, 297, 63510, 304, 279, 6693, 13, 720, 2746, 499, 1833, 420, 9899, 369, 66358, 2016, 16737, 10814, 11, 499, 690, 539, 617, 311, 720, 82, 2084, 505, 11217, 11, 665, 35262, 1174, 5099, 13, 720, 6028, 578, 15774, 91554, 720, 791, 23783, 369, 1521, 323, 1023, 3650, 514, 1026, 527, 2663, 70332, 98179, 720, 849, 48815, 11, 323, 814, 527, 10212, 304, 279, 2015, 315, 279, 330, 86, 9296, 1, 814, 12603, 5879, 198, 82, 3595, 311, 13, 2435, 527, 25, 720, 14581, 362, 320, 16, 12, 18, 264, 749, 6266, 1442, 3596, 499, 527, 35447, 2391, 420, 892, 10074, 1174, 720, 9514, 2643, 1390, 311, 2503, 449, 701, 14535, 28129, 323, 720, 1568, 311, 1518, 279, 11813, 315, 701, 19689, 662, 16110, 701, 54957, 3447, 720, 38106, 3195, 311, 656, 420, 13, 1050, 43054, 13865, 690, 7431, 720, 9514, 311, 1518, 279, 11813, 315, 701, 19689, 662, 7429, 15411, 279, 720, 69, 14437, 2212, 279, 25015, 311, 1304, 264, 8036, 40902, 323, 720, 4014, 279, 81784, 389, 701, 31624, 13, 320, 37394, 279, 40902, 720, 2171, 1771, 279, 4907, 48042, 505, 279, 19779, 662, 8, 720, 33, 1244, 383, 17693, 323, 12234, 662, 3234, 420, 7584, 77193, 369, 328, 311, 720, 966, 4520, 10826, 3160, 315, 892, 374, 3474, 2734, 1619, 555, 720, 9514, 13, 720, 22804, 220, 972, 13, 10573, 362, 13, 720, 5332, 578, 15774, 91554, 720, 77604, 66, 305, 426, 320, 18, 12, 20, 264, 749, 6266, 1442, 3596, 499, 527, 35447, 2391, 420, 892, 10074, 11, 2503, 720, 4291, 701, 14535, 28129, 477, 304, 264, 2361, 1455, 470, 5879, 198, 4057, 370, 514, 311, 499, 13, 13330, 701, 6548, 42436, 323, 1427, 720, 266, 701, 19689, 662, 3234, 420, 439, 499, 3412, 701, 2010, 555, 720, 75, 4628, 701, 19779, 2824, 258, 294, 279, 2010, 323, 1862, 5879, 198, 287, 449, 701, 75818, 13, 5112, 4299, 701, 18311, 662, 18682, 5879, 198, 398, 323, 14297, 60537, 1604, 323, 57759, 1604, 11888, 3115, 662, 1050, 5879, 198, 11221, 420, 7584, 77193, 369, 220, 20, 311, 220, 966, 82470, 1560, 13, 720, 22804, 220, 777, 13, 10573, 426, 13, 720, 14581, 356, 320, 20, 12, 22, 264, 749, 6266, 18230, 279, 25212, 449, 279, 75818, 315, 701, 6206, 13, 37234, 720, 263, 279, 1203, 315, 701, 2010, 449, 701, 6278, 477, 720, 1275, 19779, 779, 430, 264, 24074, 12970, 5222, 374, 1903, 13, 720, 2028, 374, 2663, 364, 364, 3513, 1113, 279, 32450, 14869, 46506, 43963, 720, 12487, 1797, 701, 11745, 82, 13, 763, 71, 1604, 323, 1797, 720, 1, 606, 3343, 1398, 71, 1604, 323, 1797, 330, 20375, 3343, 763, 71, 1604, 323, 720, 1868, 330, 28956, 3343, 1628, 779, 389, 13, 3234, 420, 1633, 14297, 720, 39830, 499, 617, 8813, 279, 1797, 315, 11888, 13, 320, 7816, 720, 9274, 420, 10368, 3010, 6266, 720, 5958, 578, 15774, 91554, 720, 22804, 220, 508, 13, 720, 14581, 356, 13, 720, 14581, 423, 320, 22, 12, 24, 264, 749, 6266, 29508, 4291, 22479, 1978, 2445, 2177, 291, 13, 4800, 817, 22479, 10888, 34152, 720, 6416, 279, 559, 1354, 315, 701, 14535, 311, 1862, 701, 8582, 720, 2664, 439, 499, 3351, 701, 8582, 2547, 2212, 304, 720, 44398, 645, 13, 7557, 279, 26432, 439, 3544, 439, 499, 649, 13, 720, 10061, 26662, 13, 25263, 18445, 1457, 323, 1243, 311, 720, 93755, 294, 97745, 13, 3234, 420, 10368, 3892, 3115, 662, 720, 22804, 220, 1691, 13, 720, 14581, 423, 13, 720, 5728, 578, 15774, 1398, 68, 10402, 5014, 720, 14581, 469, 320, 24, 12, 806, 264, 749, 6266, 34088, 701, 18311, 449, 701, 25466, 13, 1115, 11705, 720, 19776, 10126, 13, 10467, 279, 85657, 3156, 499, 617, 264, 11013, 1285, 13, 720, 12487, 74341, 701, 11013, 449, 279, 85657, 555, 2064, 11218, 720, 1820, 85657, 2212, 304, 279, 701, 11013, 439, 422, 433, 1051, 720, 33780, 70545, 13, 4593, 7331, 279, 85657, 14297, 555, 29932, 5879, 198, 287, 279, 11013, 1285, 315, 85657, 1139, 2380, 2064, 56967, 13, 3234, 720, 576, 10368, 3892, 3115, 13, 320, 7816, 922, 420, 720, 68676, 6266, 720, 14581, 435, 19575, 220, 1313, 13, 720, 14581, 469, 13, 720, 7, 806, 264, 749, 13, 311, 220, 16, 281, 749, 6266, 11016, 17895, 13, 29508, 304, 264, 10882, 2361, 13, 720, 644, 71, 1604, 323, 3412, 701, 11745, 13, 13134, 701, 6206, 720, 998, 3522, 77849, 311, 7068, 8798, 323, 737, 5879, 198, 44287, 2035, 1124, 389, 701, 1203, 304, 279, 3158, 315, 720, 22804, 220, 1419, 13, 720, 14581, 435, 13, 720, 2075, 578, 15774, 1398, 68, 10402, 5014, 720, 1820, 81960, 323, 10485, 3156, 499, 4250 ]
0xBreath/holistic-books
oneofhundredsofothercharitableandcommunityorganizations.Youcouldalsolendyourspecialtalentsandenergies toanyofanumberofstate,national,andinternationalorganizations.Makeacommitmenttotakethetimetogetinvolvedin oneormoreofthesetypesofactivities.Yourhealingsystemwillbenefitfromtheseactivities,sodothemfirstforyourself,know ingalsothatotherswilllaterbenefitfromyourgenerosity. GettingStarted 275 RestandAloneTimeforYourHealingSystem InsharpcontrasttowhatIrecommendforsocialconnectedness, I alsofeelitisimportanttolearnhowtosociallywithdraw,torestand bealone.Manypeoplespendpracticallyeverywakingmomenttak ingcareofothers,ortheyareinvolvedintoomanyactivitiesthat leavethememotionally,mentally,andphysicallydrained.Thispat terncanresultinchronicfatigue,“burnout,”andevenseriousill ness.Ifyouareoneofthesepeople,itisimperativetolearnhowto say“No”toothersandcarveoutachunkofdailytimeforyourself. Torejuvenateyourhealth,rechargeyourbatteries,andstrengthenandfortifyyourhealingsystem,doingthisisabasicnecessityoflife. Hereareafewtips: oEachday,take10to15minutestobealone,shuttingyourself offfromtheworldandtheconstantonslaughtofothers.Makearrangementstohavetrustedfamilyorfriendsperformyourdutiesandtakeonyourresponsibilitiesduringthisperiod.Find asafe,quiet,upliftingplace,eitheroutdoorsinnature,orina roominyourhouseorapartment. oYoumaywishtousethistimetomeditate,breathe,pray,paint,listentomusic,ordoabsolutelynothing. oHonoringyourspecialtimealone,whichyourhealingsystemrequirestomaintainitsstrengthandvigor,isimportant.Ifyoudon’tinsistontherighttobealonetorestandrejuvenate,yourhealingsystemwillhavedifficultyfunctioningoptimally. IntheEvening DinnerforYourHealingSystem Trynottoeattooheavy,ortoolate.Eatingheavyorlatewillcauseindigestionanddisturbsleep,causingyoutowakeuptiredandlow onenergyinthemorning.Inaddition,eatpeacefully,withoutthe TVorstereoblaring,andwithoutdiscussingbusinessorotherpotentiallystressfultopics.Keepthefamilydinnertimeconversa tionslightandharmonious,whichwillimprovedigestionwhileitstrengthensandfortifiesyourhealingsystem.Hereareafewsuggestionsfordinnertimemeals: 276ActivatingYourHealingSystemWhenYou’reSick Tryavegetablesoup,suchassquash,splitpea,orcarrot,which canbehearty,nourishing,andsoothing. nTryadinnersalad,withleafygreenssuchaslettuce,spinach,andoneormorevegetables,includingtomatoes,cucumbers,olives,mushrooms,artichokehearts,orgarbanzobeans(chickpeas). uYoucaneatcookedwholegrains,suchasfluffybrownriceorbarley,ororganicpasta,separatelyormixedtogetherwithavegetableorproteinsidedish. LIAvegetablecasseroleormixed-vegetablestirfrycanbetastyandnourishing.Youcanaddtofu,atouchoflightcheese,oranother leanprotein.Minimizetheuseofheavyoilsandbutterwhen youcookthesedishes. oYoumayalsohavealightdessertsuchasyogurt,sherbet,orfreshfruit.(Ifyouarediabetic,youcanhavealightdessertwith asugarsubstitute.) oDrinkwatereitherbeforeorafterdessert. EmotionalWell-BeingforYourHealingSystem Aswediscussedearlier,emotionsarepowerfulsensationsofenergyfeltinthebody.Forhealthyliving,mostemotionsneedtobereleased andexpressedinyourlife.Iftheyaresuppressedandallowedtoremaininyourbodylongerthanisnecessary,ordraggedaroundasenergy-drainingemotionalbaggage,emotionscanseverelyhinder theworkofyourhealingsystemandcancontributetoillness.Toknowhowyouarefeelingatanygivenmoment,andthenhavethe couragetosharethesefeelingswithothers,isoneofthemostpowerfulwaystostrengthenandfortifyyourhealingsystem.Hereare somesuggestionsforexpressingyouremotionsinabeneficialway: oTolearntoexpressyouremotionsinahealthyway,itisoftenhelpfultojoinagroupandlearntoparticipateingroupactivi ties.Joinagroupthatmeetsatleastonceaweek,or,ifyouhave thetime,moreoften.Thegroupcouldbeasupportgrouporatherapeuticgroup.Itshouldbeagroupthatyoufeelcomfort ableandsafewith,agroupthatyoufeelwillnotsitinjudgment GettingStarted 277 ofyoushouldyouchoosetoairyour“dirtylaundry”inpublic.Manynon-alcoholicsjoinAA(AlcoholicsAnonymous),which hasgroupsinnearlyeverymajorU.S.city,justforthesakeofbeinginagroupandlearningtosharetheirfeelings.Takethe timetofindoutaboutgroupsinyourarea,andmakeacommit menttoparticipateinone. *Ifyouarenotcomfortableinagroup,oryoucannotfindonein yourarea,professionalcounselingisavailableandmightbeofferedthroughyourhouseofworship,localYMCAorYWCA, orothercommunityorganizations.One-on-onecounseling,especiallywithaneffectivecounselor,isalsoavaluablewayto expressyourfeelings.Findoutaboutcounselorsinyourarea, andmakeadeterminedefforttoparticipateinthisactivity. *Getasmallnotebookandpen,andstartwritingaboutyourfeel ings.Writinginajournal,expressingallthatisinsideofyouand allthatyouarefeeling,canoftenbeaneffectivewaytorelease youremotions,yourthoughts,anddeepestfeelings,evenifyouwriteforonly5to10minuteseachday. *Eachday,inaconversationwithyourfamily,friends,orloved ones,speakfromyourheartandshareyourdeepestfeelings.If youarenotcomfortabledoingthis,writealettertosomeone withwhomyouwishtoshareyourdeepestfeelings. SpiritualWell-BeingforYourHealingSystem Yourhealingsystemfunctionsbestwhenyouarespirituallyhealthy.Manyphysicaldiseaseshavetheiroriginsinthespiritualrealm.Forexample,whenyourspiritsarecontinuallydown,youcanbecomedepressed,whichisaformofmentaldisease.Asnotedearlier,depressionhasbeenshowntocontributetoheartdisease,diabetes, cancer,andmanyotherseriousailments. Ifyouareanatheist,youcanstillenjoyspiritualhealthandwellbeing.Trytoconnecttoahighercause,purpose,orforceotherthanyourself.Ponderthefactthatsomeintelligent,powerful,creative energyhasputyouonthisplanet.Doingthiswilltakeahugebur denofstressoffyourshouldersandallowyourhealingsystemtoworkmoreeffectively.Thinkingthateverythingintheworldand yourlifedependssolelyonyourconstantmentalvigilanceandsurveil 278ActivatingYourHealingSystemWhenYou’reSick lancecreatestensionandstress,drainsvitalenergies,andcanbeemotionallyandphysicallyexhausting.Thesefactorsconspireagainstyourhealingsystemandcaneventuallyleadtophysicalillness. IfyoubelieveinGodorahigherpower,yourplightisnotmuchdifferentfromthatoftheatheist.DoubtsaboutGodandtheDivine stillmightbombardyouwhenyouencounterroughwatersorcome upagainstabrickwall,andsoitisnecessarytocontinuallyrenew yourfaithmanytimesthroughouteachday,andponderthemean ingandpurposeofyourexistence. oThisweek,takeabriefrespitefromyourworkandhecticsched ule,andthinkaboutyourlifeanditssignificance.Thinkabout ahigherpower,adivine,creative,intelligentenergyatworkin theuniverseandyourlife.Dothisforatleast5to10minutes eachday. oIfyouarecomfortabledoingso,prayfor5to10minuteseach day. oBeforegoingtobed,take5to10minuteseachnighttoreadscripturesorotherrelatedbooksthatcanupliftyourspirits. SleepforYourHealingSystem Sleepisfundamentaltoalllivingthingsandisanintrinsicpartof thenaturalrhythmsandcyclesoflife.Sleepisarequiredphysiolog icalactivityinalllivingspecies,abasicbiologicalprincipleoflife.Someanimalshibernateandgointoacavetosleepformonthsata timetorestoretheirbodies’healthandenergies;humansgenerallyrequirebetween8and
[ 606, 1073, 71, 7259, 708, 831, 700, 1799, 15729, 438, 29502, 70353, 39537, 29177, 1147, 337, 408, 88, 2530, 3037, 51977, 812, 438, 804, 68469, 198, 998, 3852, 1073, 276, 900, 1073, 2513, 10337, 1697, 51526, 98697, 70353, 51233, 45670, 1800, 479, 28879, 587, 774, 102873, 11269, 456, 14386, 8905, 258, 198, 606, 494, 461, 1073, 6509, 68653, 1073, 33078, 7659, 414, 383, 278, 826, 615, 14724, 68244, 275, 1527, 45010, 33078, 10900, 6132, 49818, 3983, 69, 683, 414, 726, 16539, 3409, 198, 287, 19171, 339, 4428, 3058, 14724, 68676, 68244, 275, 1527, 22479, 7642, 22828, 627, 29755, 33627, 220, 14417, 198, 12698, 438, 2149, 606, 1489, 2000, 7927, 1548, 6260, 2374, 198, 644, 54017, 85324, 83, 363, 9379, 40, 67689, 69, 1105, 2772, 15647, 2136, 11, 358, 198, 19171, 57676, 20000, 15693, 998, 12964, 5269, 43681, 2772, 398, 63546, 14287, 461, 2752, 198, 1395, 32676, 31002, 500, 27522, 3825, 652, 533, 2740, 30115, 86, 1802, 29699, 119711, 198, 287, 10727, 78, 831, 3058, 11, 2419, 1216, 548, 14386, 8905, 396, 4285, 3852, 9035, 12583, 478, 9379, 198, 273, 402, 774, 336, 74453, 750, 11, 479, 750, 51526, 42305, 2740, 3696, 2692, 29845, 4781, 198, 466, 1031, 276, 1407, 258, 7562, 292, 45283, 22711, 102305, 22464, 412, 2476, 438, 5230, 60544, 1245, 484, 198, 2136, 34001, 9514, 548, 606, 1073, 45010, 16455, 11, 20000, 318, 716, 20053, 295, 1286, 1923, 5269, 998, 198, 37890, 61559, 863, 37227, 3058, 438, 7063, 588, 412, 613, 3200, 1073, 49174, 1712, 69, 683, 414, 726, 627, 51, 461, 63231, 349, 22479, 12393, 39225, 14215, 22479, 65, 1683, 552, 51526, 67523, 18972, 438, 4057, 1463, 22479, 383, 278, 826, 615, 11, 45359, 576, 285, 370, 6099, 77, 4093, 488, 1073, 14789, 627, 8586, 548, 2642, 365, 46554, 512, 78, 4959, 1316, 14287, 731, 605, 998, 868, 1083, 332, 478, 15784, 32676, 11, 939, 75081, 22479, 726, 198, 1885, 1527, 16142, 1410, 438, 1820, 18568, 2439, 4355, 3948, 78, 831, 3058, 51233, 1138, 57733, 267, 2319, 402, 17820, 28244, 19521, 269, 30562, 29588, 22479, 67, 332, 552, 438, 23609, 3633, 414, 82689, 13757, 82977, 576, 19862, 10203, 198, 300, 5763, 11, 44750, 11, 455, 53003, 2050, 23379, 2544, 412, 28404, 6258, 1598, 11, 269, 2259, 198, 3039, 6577, 414, 7830, 269, 391, 3275, 627, 78, 2675, 18864, 49143, 427, 283, 751, 21843, 86366, 316, 3671, 349, 8568, 1244, 383, 11, 91704, 7385, 1673, 77451, 306, 316, 11785, 11, 52372, 3518, 9887, 42312, 627, 78, 71907, 5620, 88, 2530, 3037, 1712, 32676, 11, 8370, 22479, 383, 278, 826, 615, 4408, 267, 316, 1673, 467, 1220, 75337, 438, 85, 71070, 62510, 15693, 2506, 31695, 3023, 263, 1431, 1354, 59919, 700, 492, 83, 15784, 44711, 295, 461, 2752, 265, 63231, 349, 7509, 414, 383, 278, 826, 615, 14724, 71, 4234, 3168, 27081, 1723, 287, 19680, 750, 627, 644, 1820, 13461, 287, 198, 35, 4481, 2000, 7927, 1548, 6260, 2374, 198, 22170, 1962, 998, 68, 17173, 78, 89945, 11, 371, 1786, 349, 5253, 1113, 89945, 269, 5185, 14724, 1593, 485, 15505, 290, 438, 12489, 324, 1302, 3583, 11, 936, 985, 88, 412, 363, 731, 7717, 2757, 438, 10516, 198, 263, 17947, 48121, 336, 80675, 5450, 723, 684, 23379, 266, 55225, 3725, 11, 30096, 1820, 198, 16027, 66396, 486, 38834, 3329, 51526, 30096, 17242, 1892, 287, 27243, 269, 1605, 19644, 31668, 95290, 69, 495, 454, 1233, 13, 19999, 339, 830, 5285, 67, 6258, 70841, 444, 3078, 64, 198, 83, 919, 4238, 438, 13279, 1677, 1245, 11, 8370, 14724, 318, 96608, 15505, 290, 3556, 275, 75337, 729, 438, 4057, 9803, 22479, 383, 278, 826, 615, 91173, 548, 2642, 28844, 38982, 69, 6114, 77, 531, 318, 3981, 1147, 512, 16660, 24055, 1113, 7927, 1548, 6260, 2374, 4599, 2675, 3207, 50, 875, 198, 22170, 525, 456, 4893, 13649, 10900, 1412, 395, 447, 1003, 11, 7105, 375, 64, 11, 269, 7063, 4744, 11, 8370, 198, 4919, 1395, 383, 6862, 10337, 414, 11218, 51526, 708, 78, 1626, 627, 77, 22170, 32084, 5079, 278, 329, 11, 4291, 25126, 88, 82826, 21470, 300, 28163, 10743, 11, 42682, 613, 51526, 606, 494, 461, 83571, 4893, 11, 16564, 38501, 20798, 10317, 1791, 372, 1941, 11, 337, 1924, 13387, 1136, 9949, 11, 472, 718, 4845, 383, 7183, 11, 1813, 277, 6993, 89, 15784, 598, 7672, 875, 375, 300, 4390, 84, 2675, 66, 2194, 266, 99797, 67733, 911, 1771, 10900, 1412, 300, 1517, 30977, 65561, 23994, 269, 2308, 3258, 11, 269, 61694, 79, 14635, 11, 325, 1768, 2718, 494, 3366, 998, 3522, 4291, 525, 456, 481, 269, 782, 668, 1354, 4591, 819, 627, 43, 5987, 83571, 481, 66, 34858, 1286, 494, 3366, 12, 83571, 481, 267, 404, 69, 894, 4919, 29651, 15329, 438, 77, 414, 11218, 39537, 4919, 723, 998, 33721, 11, 266, 283, 971, 39490, 1557, 2423, 11, 269, 43063, 198, 2742, 79565, 17507, 101256, 19030, 817, 1073, 89945, 78, 8839, 438, 65, 6339, 9493, 198, 9514, 87895, 6509, 291, 21168, 627, 78, 2675, 18864, 19171, 19553, 278, 492, 34107, 15916, 1412, 6539, 540, 5757, 11, 90605, 29651, 11, 33942, 2548, 36698, 13127, 2746, 9514, 1636, 72, 45938, 7509, 283, 4919, 19553, 278, 492, 34107, 531, 4291, 198, 300, 773, 1590, 392, 7815, 29275, 78, 86037, 59147, 486, 2544, 15145, 6347, 1064, 34107, 531, 627, 2321, 41964, 11649, 12, 34242, 2000, 7927, 1548, 6260, 2374, 198, 2170, 68467, 3510, 59942, 686, 5741, 11, 336, 41356, 548, 13477, 1285, 82, 42725, 708, 69, 17947, 66922, 258, 1820, 2664, 27774, 12393, 4010, 2299, 11, 3646, 336, 41356, 17483, 83, 677, 486, 4778, 198, 438, 14107, 291, 6577, 414, 14789, 34001, 20670, 5518, 455, 14655, 438, 21642, 83, 461, 3902, 6577, 414, 2664, 4930, 261, 54895, 285, 95317, 11, 541, 4193, 3640, 20019, 300, 17947, 19158, 2101, 336, 41964, 21946, 15292, 11, 336, 41356, 4919, 325, 424, 989, 71, 5863, 198, 339, 2504, 1073, 22479, 383, 278, 826, 615, 438, 4919, 48210, 332, 11269, 484, 2136, 844, 564, 3409, 5269, 9514, 548, 1897, 20659, 266, 3852, 43068, 29699, 51526, 3473, 71, 402, 19030, 198, 67971, 85163, 9451, 548, 6509, 46053, 301, 826, 4291, 59961, 62510, 606, 1073, 49818, 537, 13477, 1285, 3195, 267, 537, 265, 18972, 438, 4057, 1463, 22479, 383, 278, 826, 615, 91173, 548, 198, 82, 20969, 38982, 1348, 87, 1911, 287, 9514, 1864, 41356, 258, 41408, 830, 7235, 3195, 512, 78, 1271, 1576, 406, 78, 14107, 9514, 1864, 41356, 2259, 38128, 3195, 11, 20000, 61917, 8823, 69, 495, 78, 6115, 351, 896, 438, 1576, 406, 454, 472, 8608, 349, 42381, 9035, 72, 198, 29646, 23165, 351, 896, 9210, 2727, 1441, 266, 56371, 13486, 85277, 1247, 11, 269, 11, 1463, 283, 19553, 198, 339, 4199, 11, 6518, 61917, 11829, 4166, 29177, 1395, 300, 2870, 4166, 269, 1894, 32486, 4166, 28628, 5562, 1395, 351, 896, 9210, 9514, 57676, 19975, 198, 481, 2914, 2642, 98909, 11, 351, 896, 9210, 9514, 57676, 14724, 1962, 47965, 258, 18631, 9247, 198, 29755, 33627, 220, 16367, 198, 1073, 88, 788, 71, 619, 9514, 971, 437, 11269, 1334, 22479, 2118, 54588, 4355, 28346, 863, 258, 898, 31002, 1910, 263, 19308, 11353, 1233, 6115, 6157, 7, 2149, 11353, 1233, 33784, 705, 8370, 198, 4752, 17171, 6258, 22928, 30115, 37605, 52, 815, 27473, 11, 4345, 2000, 6509, 731, 1073, 35214, 258, 351, 896, 438, 21656, 83, 9451, 548, 50828, 57676, 826, 844, 587, 19030, 198, 20693, 295, 1073, 485, 412, 9274, 17171, 6577, 414, 4903, 51526, 7072, 45670, 1800, 198, 479, 3565, 472, 8608, 349, 258, 606, 627, 9, 2746, 9514, 548, 1962, 19975, 481, 258, 351, 896, 11, 683, 283, 34360, 3990, 606, 258, 198, 22479, 4903, 11, 66886, 66, 94741, 287, 285, 10547, 438, 46068, 1395, 1885, 12616, 20322, 22479, 7830, 1073, 50810, 5383, 11, 2497, 64887, 5158, 269, 99217, 5158, 345, 269, 1605, 29502, 70353, 38167, 10539, 19101, 66, 94741, 287, 11, 36046, 4291, 2194, 40784, 66, 94741, 269, 62510, 19171, 22510, 13429, 3195, 998, 198, 14107, 22479, 57676, 826, 10203, 412, 9274, 66, 94741, 1105, 6577, 414, 4903, 345, 438, 7072, 329, 47737, 6581, 371, 3565, 472, 8608, 349, 258, 576, 7323, 627, 9, 1991, 10753, 543, 10179, 2239, 438, 2821, 51526, 2527, 26372, 9274, 22479, 57676, 198, 826, 1196, 12479, 258, 1662, 5036, 11, 14107, 287, 543, 339, 3689, 42450, 1073, 9514, 438, 198, 543, 9210, 9514, 548, 1897, 20659, 11, 4919, 61917, 1395, 2194, 1740, 344, 25754, 83, 46314, 198, 9514, 1864, 41356, 7509, 414, 61665, 82, 51526, 58994, 30223, 57676, 826, 11, 17206, 1463, 283, 5040, 2000, 3323, 20, 998, 605, 38137, 9739, 1316, 627, 9, 4959, 1316, 11, 2259, 62737, 4291, 22479, 19521, 17514, 12337, 11, 269, 385, 2111, 198, 3233, 10900, 23635, 1527, 22479, 18207, 438, 19930, 22479, 58994, 30223, 57676, 826, 34001, 198, 9514, 548, 1962, 19975, 2364, 78, 287, 576, 11, 5040, 64, 9638, 83, 32554, 606, 198, 4291, 1336, 5650, 283, 49143, 427, 9451, 548, 22479, 58994, 30223, 57676, 826, 627, 87475, 940, 11649, 12, 34242, 2000, 7927, 1548, 6260, 2374, 198, 7927, 383, 278, 826, 615, 22124, 16241, 9493, 9514, 5518, 53829, 1870, 38128, 40734, 47692, 67, 1082, 2315, 71, 402, 19030, 404, 4775, 1354, 258, 6509, 53829, 940, 70997, 10749, 87, 1545, 11, 9493, 22479, 50177, 1220, 548, 22025, 1870, 2996, 7509, 283, 4919, 17106, 25111, 752, 14715, 11, 8370, 10994, 630, 1073, 479, 4852, 56407, 20855, 1962, 291, 686, 5741, 11, 451, 4099, 4752, 1395, 729, 5269, 406, 78, 48210, 332, 11269, 18207, 67, 56407, 11, 8747, 16629, 345, 66, 11967, 51526, 1543, 16417, 3058, 261, 1245, 607, 1392, 627, 2746, 9514, 548, 276, 70036, 380, 7509, 283, 4919, 44466, 268, 7453, 1065, 53829, 940, 12393, 438, 9336, 35214, 20411, 998, 6595, 998, 1494, 1108, 261, 1593, 7385, 30349, 11, 269, 9009, 1605, 339, 3852, 414, 726, 1087, 14518, 339, 830, 533, 339, 1900, 638, 396, 21149, 7385, 1223, 1285, 11, 52817, 198, 17947, 4752, 631, 9514, 263, 576, 51174, 34696, 287, 576, 14724, 23609, 1494, 4838, 11490, 198, 5294, 1073, 95290, 1885, 22479, 5562, 388, 438, 7331, 22479, 383, 278, 826, 615, 83, 363, 672, 6518, 27153, 3210, 5221, 16113, 339, 349, 1225, 1626, 258, 16142, 1410, 438, 198, 22479, 113276, 291, 752, 1438, 1575, 398, 3633, 414, 18568, 93221, 92347, 321, 685, 2914, 74147, 321, 198, 16949, 24055, 1113, 7927, 1548, 6260, 2374, 4599, 2675, 3207, 50, 875, 198, 75, 685, 3261, 267, 2711, 438, 95290, 11, 3696, 1771, 85, 2223, 804, 68469, 51526, 4919, 1395, 74453, 750, 438, 42305, 2740, 327, 15424, 287, 5221, 288, 830, 21846, 444, 2203, 556, 69849, 22479, 383, 278, 826, 615, 438, 66, 2194, 688, 1870, 27152, 3565, 71, 19506, 484, 2136, 627, 2746, 88, 5599, 301, 19704, 258, 28622, 269, 1494, 1108, 261, 13477, 7509, 414, 501, 492, 285, 1962, 59178, 64750, 1527, 9210, 1073, 1820, 70036, 380, 920, 5599, 2641, 9274, 28622, 438, 1820, 12792, 483, 198, 44466, 46068, 79444, 569, 9514, 9493, 9514, 967, 41014, 1458, 99759, 269, 2063, 198, 455, 33871, 68588, 12938, 16836, 51526, 708, 20000, 95317, 998, 22025, 1870, 265, 943, 198, 22479, 75710, 1543, 16820, 4350, 71, 1458, 2182, 613, 1316, 51526, 20949, 9224, 276, 198, 287, 438, 77763, 1073, 9514, 38639, 81624, 627, 78, 2028, 10476, 14287, 731, 370, 4462, 417, 6100, 1527, 22479, 1816, 438, 383, 302, 1233, 2454, 198, 1130, 51526, 27963, 9274, 22479, 14789, 438, 275, 784, 625, 100104, 5221, 771, 9274, 198, 1494, 1108, 261, 13477, 11, 329, 344, 483, 11, 52817, 10072, 21149, 17947, 266, 1816, 258, 198, 1820, 359, 8194, 13634, 414, 14789, 34696, 576, 2000, 266, 56371, 20, 998, 605, 38137, 198, 9739, 1316, 627, 78, 2746, 9514, 548, 19975, 2364, 78, 287, 708, 11, 91704, 2000, 20, 998, 605, 38137, 9739, 198, 1316, 627, 78, 10438, 9738, 83, 677, 291, 14287, 731, 20, 998, 605, 38137, 9739, 9471, 83, 461, 329, 2334, 1439, 269, 1605, 9920, 2239, 267, 9379, 4919, 455, 75, 39724, 414, 50177, 1220, 627, 42845, 2000, 7927, 1548, 6260, 2374, 198, 42845, 285, 58703, 44186, 998, 543, 64275, 58174, 438, 17570, 258, 46102, 4581, 1073, 198, 3473, 4688, 81, 23394, 1026, 438, 49521, 1073, 14789, 32686, 285, 548, 3004, 42305, 72, 1640, 198, 950, 7323, 258, 543, 34667, 826, 89721, 11, 370, 6099, 8385, 5848, 652, 16379, 1073, 14789, 87933, 48999, 939, 19348, 438, 70, 787, 78, 582, 402, 295, 437, 3583, 630, 6167, 82, 460, 198, 20693, 295, 461, 4412, 50828, 65, 10233, 529, 12393, 438, 804, 68469, 26, 28400, 598, 7642, 750, 4408, 42967, 23, 438 ]
0xBreath/holistic-books
al adjustment, cleansing the liver supports it greatly in its effort to keep the rest of the body healthy. 2. Keep Your Colon Clean A weak, irritated, and congested large intestine becomes a breeding place for bacteria that are simply doing their job—decomposing potentially hazardous waste material. As a side effect of their life-saving activities, the microbes produce poisonous substances. Some of these toxins produced by the bacteria enter the blood, which sends them straight to the liver. Constant exposure of the liver cells to these toxins impairs their performance and reduces bile secretion. This leads to a further disruption of digestive functions. When you eat highly processed foods that have been stripped of most nutrients and natural fiber, the colon has difficulty moving the food mass, or “chyme,” along. Processed foods tend to make for a dry, hard, or sticky chyme that passes only with difficulty through the intestinal tract. Normally, the muscles wrapped around the colon can easily squeeze and push fibrous, bulky chyme along, but they struggle greatly dealing with gooey, sticky chyme that is devoid of fiber. When chyme sits too long in the colon, it becomes harder and drier. If that were the only thing that happened—chyme turning into hard, dry feces—we would only need to worry about constipation (from which millions of Americans suffer) and taking laxatives. But there is more to it. After the chyme is plastered onto the walls of the colon, it will undergo biochemical changes and do the following things. It will: • Ferment or putrefy, thereby becoming a breeding ground for parasites and pathogens as well as a storehouse for toxic chemicals. These can pollute the blood and lymph and, thereby, gradually poison the body. • Form a barrier that prevents the colon from interacting with the chyme and absorbing nutrients from it.. • Restrict peristaltic movement by the colon walls, making it difficult for the colon to rhythmically contract in order to force the chyme along its way. How well could you do your job if you were covered with thick sludge? The following are some of the symptoms that may occur as a result of colon dysfunction: Lower back pain Neck and shoulder pain Pain in the lower and upper arms Skin problems Brain fog (difficulty concentrating) Fatigue or sluggishness Colds and flu Constipation or diarrhea Flatulence/gas or bloating Crohn’s disease Ulcerative colitis Colitis/irritable bowel syndrome (IBS) Diverticulitis/diverticulosis Leaky gut syndrome Pain in the lower part of the stomach (especially on the left side) The large intestine absorbs minerals and water. When the membrane of the large intestine is impacted with plaque, it cannot assimilate and absorb minerals (as well as some vitamins). A congested colon causes nutrient-deficiency diseases, regardless of how many supplements a person takes. Most health problems are, in fact, deficiency disorders. They arise when certain parts of the body suffer malnourishment; particularly of minerals (see also “ Take Ionic Essential Minerals ” on page 140). The following are a number of colon-cleansing methods that I recommend incombination with liver cleanses: 1. Keeping the colon clean through colonic irrigation, for example, is an effective preventive method to safeguard the liver against toxins generated in the large intestine. Colonic irrigation, also known as colon hydrotherapy, is perhaps one of the more effective colon therapies. A 30- to 50-minute session can eliminate large amounts of trapped waste that may have taken you many years to accumulate. During a colonic session, the therapist uses a total of 3 to 6 quarts of distilled or purified water to gently cleanse your colon. Through gentle abdominal massage, old deposits of mucoid fecal matter are loosened, detached from the colon wall, and subsequently removed with the water. Colonics tend to have a “relieving” effect. You will usually experience a feeling of lightness, cleanness, and increased clarity of mind following a colonic. However, during the procedure itself, you may feel slight discomfort from time to time, whenever larger quantities of toxic waste detach themselves from the intestinal walls and move toward the rectum. During the procedure, rubber tubing carries water into the colon and waste out of the colon. The released waste material can be seen floating through a tube, showing the type and quantity of waste eliminated. Once the colon has been thoroughly cleansed through 2, 3, or more colonics, thereafter diet, exercise, or other health programs are likely to be much more effective. It is estimated that 80 percent of all immune tissue resides in the intestines. Therefore, cleansing the colon from immune-suppressive toxic waste and removing gallstones from the liver can make all the difference in the treatment of cancer, heart disease, AIDS, or other serious illnesses. Colonic irrigation is a safe and hygienic system for cleansing the colon. Those who have never experienced a colonic, or who have a vested interest in dissuading others from having one, are the most likely people to raise safety concerns about colonics. 2. If you do not have access to a colon therapist, you may greatly benefit from using a colema board (see Suppliers List in the Appendix) as a second-best choice. The colema board allows you to clean your colon in the comfort of your own home. The colema is a do-it-yourself enema treatment that is easy to learn and perform. 3. Colosan is a blend of various oxides of magnesium designed to gently release oxygen into the digestive tract for cleansing it. Colosan is a powder that you either mix with water and chase down with citrus juice or take in capsule form, which is more convenient. Colosan releases large amounts of oxygen in the intestinal tract, thereby eliminating oldfecal material as well as parasites and hardened mucus (see Suppliers List in the Appendix). Oxypowder is a similar product that works just as well. 4. Another method of cleansing, which uses Epsom salts, cleanses not only the colon but also the small intestine. This may become necessary if you have major difficulties absorbing food, have repeated kidney/bladder congestion
[ 278, 197, 39819, 479, 11, 1470, 22451, 287, 33188, 8986, 1553, 1942, 2870, 82, 24263, 3253, 1244, 398, 17886, 197, 1220, 198, 6581, 371, 32809, 197, 13397, 33188, 197, 4014, 44323, 33188, 36502, 197, 38128, 627, 11367, 17, 13, 197, 19999, 197, 7927, 197, 89765, 6391, 2742, 18108, 32, 197, 13451, 11, 197, 404, 1018, 660, 11, 53577, 38303, 7114, 291, 8986, 2812, 2129, 478, 483, 2282, 762, 20969, 11575, 2282, 265, 16490, 197, 2050, 2066, 2282, 78852, 64442, 198, 548, 1942, 318, 2603, 20530, 287, 33188, 404, 69677, 2345, 451, 884, 8478, 3303, 354, 31668, 9793, 58757, 788, 6831, 5642, 2157, 2229, 13, 197, 2170, 11575, 94864, 198, 27153, 44323, 33188, 404, 8986, 1643, 59085, 197, 33078, 11, 33188, 2157, 2823, 9620, 197, 98374, 3303, 78, 3416, 788, 29724, 9623, 13, 7721, 638, 44323, 198, 45010, 32809, 87, 1354, 197, 8723, 2041, 197, 1729, 33188, 2282, 78852, 197, 1992, 33188, 2282, 4659, 11, 197, 8370, 1942, 1438, 197, 49818, 11609, 7538, 32809, 33188, 198, 75, 1553, 13, 197, 15839, 8285, 12313, 44323, 33188, 8986, 1553, 1470, 6572, 32809, 197, 45010, 32809, 87, 1354, 197, 6802, 4825, 33188, 404, 197, 62344, 53577, 198, 265, 1072, 1634, 2282, 458, 197, 21107, 290, 13, 41065, 197, 99470, 32809, 11575, 1186, 4004, 35697, 14455, 44323, 2765, 15505, 535, 7679, 82, 627, 1602, 4599, 197, 9514, 7883, 266, 9793, 1108, 398, 197, 35122, 197, 96420, 64442, 9793, 525, 74242, 268, 18895, 462, 7069, 44323, 2157, 537, 9215, 332, 32930, 53577, 198, 53980, 1186, 8799, 11, 33188, 47740, 263, 64355, 81664, 27081, 2157, 9308, 33188, 197, 14239, 2157, 395, 11, 82266, 197, 2118, 331, 31218, 2476, 197, 39393, 13, 197, 83635, 198, 96420, 3324, 408, 32809, 78538, 2066, 11575, 2765, 894, 11, 9793, 569, 11, 82266, 18895, 19501, 23918, 31218, 64442, 42531, 288, 197, 3323, 48048, 81664, 27081, 197, 20322, 198, 1820, 2129, 65050, 197, 2193, 13, 18822, 494, 750, 11, 33188, 2157, 355, 19153, 6831, 57389, 197, 20019, 33188, 47740, 263, 94036, 7883, 38367, 1942, 19901, 198, 438, 44255, 1186, 581, 27620, 11, 2282, 360, 8050, 23918, 31218, 197, 39393, 11, 2282, 332, 197, 20670, 11609, 50428, 3253, 1244, 398, 59451, 6260, 48048, 3253, 2689, 1216, 11, 18895, 19501, 198, 331, 31218, 64442, 20501, 59451, 1019, 44323, 1186, 8799, 13, 197, 4599, 23918, 31218, 1942, 1220, 32809, 78, 17972, 17886, 33188, 47740, 263, 11, 24263, 2282, 762, 20969, 9793, 569, 261, 198, 438, 2765, 7401, 13, 52792, 64442, 6831, 486, 33188, 197, 3323, 197, 1626, 64442, 9793, 680, 6901, 2345, 331, 31218, 197, 413, 287, 2129, 78, 9793, 569, 11, 2765, 894, 1186, 762, 288, 86319, 6831, 619, 197, 3323, 197, 17483, 32809, 6831, 8635, 197, 9274, 4882, 49686, 197, 17450, 197, 8370, 2157, 91387, 44323, 23845, 2165, 598, 198, 82, 2084, 8, 53577, 3324, 1802, 8986, 710, 5983, 13, 197, 4071, 197, 19041, 20501, 2157, 461, 32809, 24263, 13, 197, 6153, 33188, 23918, 31218, 20501, 73313, 88473, 197, 10138, 33188, 198, 87396, 44323, 33188, 47740, 263, 11, 24263, 6831, 484, 197, 8154, 3427, 2282, 822, 32056, 197, 19926, 53577, 20530, 33188, 1186, 1573, 287, 197, 58174, 13, 62635, 198, 14724, 512, 6806, 13017, 261, 479, 82266, 46162, 1116, 88, 11, 197, 19041, 1729, 2282, 762, 18238, 11575, 2282, 265, 16490, 197, 1993, 2066, 197, 1768, 300, 3695, 53577, 198, 2398, 57118, 61551, 6831, 616, 61551, 11575, 58379, 7830, 2066, 32809, 14668, 197, 32056, 82, 13, 197, 9673, 94036, 3303, 980, 1088, 33188, 2282, 4659, 198, 438, 197, 398, 56102, 53577, 11, 197, 19041, 1729, 11, 197, 6902, 1870, 3303, 78, 3416, 33188, 36502, 627, 6806, 197, 1876, 11575, 91809, 7401, 64442, 41446, 48764, 33188, 47740, 263, 43827, 60015, 36022, 48048, 33188, 23918, 31218, 53577, 198, 3518, 269, 7278, 9215, 332, 32930, 43827, 24263, 35047, 6806, 11391, 15462, 858, 197, 716, 380, 3223, 292, 2157, 14797, 197, 1729, 33188, 47740, 263, 6831, 5700, 11, 2157, 1802, 24263, 81664, 3951, 2066, 33188, 198, 77924, 32809, 7145, 61254, 2740, 197, 20871, 17886, 43345, 32809, 2066, 346, 33188, 23918, 31218, 197, 39393, 197, 1220, 197, 3195, 627, 1602, 4438, 6831, 616, 1470, 619, 197, 9514, 20530, 14862, 414, 69677, 748, 197, 9514, 6831, 486, 197, 21468, 48048, 71579, 875, 79726, 20132, 30, 33026, 1186, 1573, 287, 198, 548, 1942, 638, 44323, 33188, 1942, 1631, 52273, 64442, 2157, 352, 197, 511, 2407, 61551, 11575, 9753, 44323, 47740, 263, 2765, 1065, 1723, 512, 1602, 9230, 78546, 3303, 467, 1602, 8989, 377, 53577, 197, 5562, 261, 3303, 467, 1602, 47, 467, 17886, 33188, 8986, 1223, 53577, 197, 13886, 197, 16293, 1602, 38286, 197, 96440, 1602, 66177, 1186, 540, 197, 38224, 27081, 38303, 1189, 22696, 8, 1602, 69557, 22711, 82266, 79726, 2661, 819, 2136, 1602, 34, 18938, 53577, 1186, 10036, 1602, 19717, 49686, 82266, 2765, 72, 1138, 41033, 1602, 32119, 59566, 4951, 300, 82266, 2282, 29593, 1602, 96141, 25105, 753, 2765, 56407, 1602, 92159, 3913, 1413, 47740, 20000, 1602, 6255, 20000, 14, 404, 23349, 2282, 68157, 1942, 88, 303, 6786, 197, 99937, 50, 8, 1602, 12792, 531, 292, 360, 20000, 22787, 531, 292, 360, 10934, 1602, 2356, 29200, 3253, 332, 1942, 88, 303, 6786, 1602, 47, 467, 17886, 33188, 8986, 1223, 73972, 44323, 33188, 18895, 316, 613, 197, 7, 36046, 25653, 33188, 36357, 94864, 340, 50206, 791, 8986, 2812, 2129, 478, 483, 197, 3518, 269, 1302, 26388, 17822, 53577, 6831, 977, 13, 197, 4599, 33188, 14477, 88554, 44323, 33188, 8986, 2812, 198, 396, 478, 483, 20501, 197, 6802, 22955, 48048, 73313, 20234, 11, 24263, 1470, 3483, 197, 395, 318, 76457, 53577, 197, 3518, 30986, 26388, 17822, 197, 38051, 6831, 616, 61551, 198, 15031, 5306, 275, 38925, 570, 23845, 38303, 7114, 291, 47740, 263, 197, 936, 4881, 9215, 332, 13283, 29899, 10603, 2765, 1082, 2315, 11, 38113, 30920, 44323, 197, 5269, 198, 35676, 1942, 455, 4779, 11575, 99905, 3324, 2094, 13, 9391, 537, 197, 12393, 197, 96440, 197, 548, 11, 17886, 1186, 533, 11, 7604, 10603, 35697, 8076, 627, 7009, 70440, 1082, 61280, 1470, 7770, 3303, 7183, 44323, 33188, 36502, 1942, 2084, 2157, 106295, 414, 16409, 26, 73972, 49257, 44323, 26388, 17822, 198, 7, 4151, 197, 19171, 197, 2118, 198, 18293, 25494, 14338, 23626, 784, 2335, 197, 6349, 17822, 198, 863, 25653, 36372, 197, 6860, 4390, 1602, 791, 1186, 1573, 287, 197, 548, 11575, 58235, 44323, 47740, 263, 1824, 22451, 287, 43357, 82, 64442, 25494, 17643, 31628, 17886, 76128, 48048, 8986, 1553, 1470, 22451, 288, 512, 1602, 16, 627, 197, 72447, 33188, 47740, 263, 1470, 2742, 197, 20322, 1602, 2119, 14338, 197, 404, 14746, 367, 345, 2066, 8285, 1545, 11, 20501, 80557, 7883, 40784, 198, 93755, 535, 43357, 32809, 1942, 2642, 82971, 33188, 8986, 1553, 197, 69849, 32809, 87, 1354, 3253, 10766, 17886, 33188, 8986, 2812, 2129, 478, 483, 627, 6255, 14338, 197, 404, 14746, 367, 11, 197, 19171, 197, 5391, 61551, 1602, 77924, 197, 67229, 46755, 345, 20501, 197, 66372, 197, 606, 44323, 33188, 2157, 461, 7883, 40784, 198, 77924, 197, 700, 391, 552, 13, 23845, 197, 966, 12, 32809, 197, 1135, 24401, 26109, 94036, 197, 40895, 3357, 8986, 2812, 197, 6173, 82, 44323, 26665, 5795, 6831, 5642, 198, 9210, 2157, 352, 9793, 525, 3324, 3448, 197, 9514, 197, 35676, 197, 42820, 32809, 197, 99487, 13, 11198, 1711, 11575, 47740, 14338, 26109, 11, 33188, 197, 700, 60329, 198, 4881, 11575, 35593, 44323, 197, 18, 32809, 197, 21, 197, 447, 7183, 44323, 75582, 4473, 82266, 3303, 324, 1908, 6831, 977, 32809, 3253, 4501, 1470, 2742, 325, 14862, 414, 47740, 263, 627, 24798, 3253, 306, 273, 197, 370, 5717, 992, 2157, 39336, 11, 62928, 59451, 981, 1220, 44323, 1602, 76, 1791, 590, 1186, 98298, 2157, 1683, 198, 197, 548, 197, 385, 437, 6901, 345, 19842, 3939, 43827, 33188, 47740, 263, 6831, 543, 11, 53577, 29724, 39742, 197, 46856, 48048, 33188, 6831, 977, 627, 1602, 89765, 1233, 3324, 408, 32809, 9793, 525, 11575, 197, 2118, 3833, 84446, 863, 89170, 13, 197, 2675, 6831, 484, 197, 44066, 8285, 13267, 11575, 1186, 68, 20659, 44323, 198, 4238, 2136, 11, 1470, 273, 83133, 11, 53577, 17886, 846, 1503, 40507, 10981, 44323, 2157, 485, 1186, 1573, 287, 11575, 47740, 14338, 13, 197, 11458, 11, 2765, 1711, 198, 1820, 197, 21826, 24263, 726, 11, 197, 9514, 2157, 352, 1186, 96551, 1942, 4238, 35697, 19975, 43827, 22724, 32809, 22724, 11, 197, 1336, 31845, 8986, 42876, 198, 31548, 1385, 44323, 32809, 14668, 6831, 5642, 2765, 295, 613, 71579, 12116, 4372, 43827, 33188, 2129, 65050, 6831, 5700, 53577, 50388, 3324, 83071, 33188, 198, 2921, 372, 627, 1602, 16397, 33188, 197, 21826, 11, 7145, 92986, 3324, 392, 287, 1470, 277, 4108, 6831, 977, 2129, 78, 33188, 47740, 263, 53577, 6831, 5642, 14294, 44323, 33188, 198, 77924, 13, 33026, 17643, 4778, 6831, 5642, 2157, 2229, 94036, 74242, 197, 29412, 1186, 29593, 197, 20322, 11575, 3324, 3845, 11, 33827, 287, 33188, 13459, 198, 438, 197, 13832, 44323, 6831, 5642, 197, 40895, 15846, 627, 1602, 12805, 33188, 47740, 263, 64355, 74242, 268, 71579, 14776, 398, 1470, 22451, 291, 197, 20322, 197, 17, 11, 197, 18, 11, 82266, 2157, 461, 47740, 263, 1233, 11, 197, 19041, 10924, 198, 94942, 11, 8285, 18865, 11, 82266, 197, 1605, 197, 12393, 197, 74053, 197, 548, 197, 14617, 32809, 74242, 2157, 1412, 2157, 461, 7883, 40784, 13, 62635, 20501, 198, 45329, 64442, 197, 1490, 197, 25426, 44323, 52060, 197, 70155, 3324, 11407, 10413, 3422, 17886, 33188, 2129, 478, 1572, 13, 197, 55915, 345, 9326, 598, 287, 33188, 47740, 263, 43827, 197, 70155, 59615, 69563, 32809, 14668, 6831, 5642, 53577, 197, 1864, 9308, 3253, 543, 33610, 43827, 198, 1820, 8986, 1553, 94036, 78538, 52060, 33188, 2765, 18691, 17886, 33188, 3324, 35320, 44323, 1470, 11967, 11, 197, 18207, 2765, 56407, 11, 23845, 26696, 11, 82266, 198, 1605, 197, 94427, 197, 484, 2136, 288, 627, 1602, 6255, 14338, 197, 404, 14746, 367, 20501, 11575, 1942, 5763, 53577, 197, 8671, 88364, 292, 41393, 2066, 1470, 22451, 287, 33188, 47740, 263, 13, 197, 23025, 197, 14965, 198, 19553, 197, 37593, 8285, 45933, 11575, 47740, 14338, 11, 82266, 197, 14965, 9793, 525, 11575, 5306, 10185, 60015, 478, 17886, 2765, 1056, 84, 2277, 23021, 3058, 43827, 198, 69666, 197, 606, 11, 197, 548, 33188, 2157, 537, 197, 14617, 197, 16455, 32809, 55118, 1942, 39718, 38303, 29644, 82, 197, 9274, 47740, 263, 1233, 627, 1602, 17, 627, 52792, 197, 9514, 20530, 98366, 9793, 525, 197, 5323, 32809, 11575, 47740, 263, 197, 700, 60329, 11, 197, 9514, 2157, 352, 3253, 1244, 398, 2282, 89729, 43827, 27287, 11575, 198, 56745, 1764, 60968, 198, 197, 7, 4151, 1602, 10254, 15532, 10904, 198, 17886, 33188, 197, 24819, 953, 8, 61551, 11575, 197, 5686, 57701, 197, 12008, 13, 33026, 197, 56745, 1764, 198, 2541, 52060, 4336, 197, 9514, 32809, 1470, 2742, 14862, 414, 47740, 263, 17886, 33188, 197, 19975, 44323, 14862, 414, 197, 785, 197, 5227, 13, 33026, 197, 56745, 1764, 20501, 11575, 198, 3055, 38611, 53246, 726, 82948, 9355, 3324, 35320, 64442, 20501, 7883, 6539, 32809, 197, 12964, 53577, 197, 29588, 627, 1602, 18, 627, 1602, 6255, 437, 276, 198, 20501, 11575, 197, 83732, 44323, 2462, 1245, 197, 5241, 3422, 44323, 2157, 3326, 41930, 54012, 1571, 32809, 3253, 4501, 17643, 1655, 23021, 19472, 198, 18614, 33188, 2765, 15505, 535, 197, 2193, 2066, 1470, 22451, 287, 24263, 13, 197, 6255, 437, 276, 20501, 11575, 3303, 363, 1126, 64442, 197, 9514, 7883, 2544, 2157, 953, 48048, 6831, 977, 198, 438, 23918, 521, 2765, 785, 48048, 1470, 275, 20962, 197, 8783, 560, 82266, 3324, 731, 17886, 1470, 2690, 1130, 38510, 11, 197, 8370, 20501, 2157, 461, 38303, 48239, 627, 6255, 437, 276, 17643, 29399, 8986, 2812, 197, 6173, 82, 44323, 23021, 19472, 17886, 33188, 2129, 65050, 197, 2193, 11, 197, 19041, 1729, 197, 40895, 16252, 62928, 77626, 278, 2157, 2229, 61551, 6831, 616, 61551, 197, 1768, 300, 3695, 53577, 9793, 569, 6901, 2157, 38601, 197, 7, 4151, 1602, 10254, 15532, 10904, 198, 17886, 33188, 198, 24819, 953, 570, 49149, 87, 1100, 363, 1126, 20501, 11575, 1942, 79962, 70388, 64442, 197, 19033, 197, 4345, 61551, 6831, 616, 627, 1602, 19, 627, 197, 14364, 43357, 44323, 1470, 22451, 287, 11, 197, 8370, 197, 4881, 23626, 1725, 316, 1942, 278, 2641, 11, 1470, 22451, 288, 98366, 197, 3323, 33188, 47740, 263, 198, 8248, 197, 19171, 33188, 1942, 30632, 2129, 478, 483, 13, 41065, 2157, 352, 2282, 52521, 9215, 20726, 748, 197, 9514, 9793, 525, 2157, 3111, 81664, 3951, 552, 198, 3518, 269, 7278, 197, 14239, 11, 9793, 525, 17643, 43054, 16868, 307, 3520, 90293, 21473, 38303, 7114, 290 ]
0xBreath/holistic-books
love you.4. Using your name this time, look deeply into your eyes and say, I love you, [Name]. I r eally love you. These af firmations are worth repeating over and over again. 5. If you are having trouble in your relationships, look into your eyes, breathe deeply, and say, I am willing to r elease the need for r elationships that don’ t nourish and support me. Repeat this five times in the mirror, and each time you say it, give it more meaning. Think of specific relationships as you say it. The Power Is W ithin Y ou: Y our Day 16 Journaling Exercise 1. In your journal, write about how you experienced love as a child. Did you observe your parents expressing love and af fection? W ere you raised with lots of hugs? In your family was love hidden behind fighting, crying, or silence? 2. W rite ten af firmations of love and practice them in front of your mirror. Here are some examples: I am worthy of love. The mor e I open to love, the safer I am. T oday I r emember that life loves me. I let love find me at the perfect time. 3. W rite down ten things that you love to do. Pick five and do them today. 4. T ake several hours and pamper yourself: buy yourself flowers, treat yourself to a healthy meal, show yourself how special you are. 5. Repeat Step 3 every day this week! Y our Heart Thought for Day 16: I Live in a Circle of Love Envelop your family in a circl e of love, whether family members are living or not. Broaden the circle to include your friends, your loved ones,your co-workers, everyone from your past, and all the people you would like to for give but don’ t know how. Af firm that you have wonderful, harmonious rela tionships with them all, with respect and caring on both sides. Know th at you can live with dig nity and peace and joy. Let this circle of love envelop the entire planet, and let your heart open so tha t you have space within you for unconditional love. Y our Day 16 Meditation: Love Is Healing (Day 16 of the audio download) Love is the most powerful healing force there is. Send everyone you know lots of com fort and acceptance and support and love. Be aware that as you send these thoughts out, you also receive them in return. V isualize a circle of love that e mbraces your family members, whether living or not, as well as friends, co-workers, and everyone from your past. Put your self in the circle. Y ou are worth loving. Y ou are beautiful. Y ou are powerful. Open yourself to all good and to the unconditional love within you. Af firm: I open myself to love. I am willing to love and be loved. I see myself pr ospering. I see myself healthy. I see myself cr eatively fulfilled. I have wonderful, harmonious r elationships in which ther e is mutual r espect and caring.D A Y 1 7 L i v i n g S t r e s s F r e e Str ess is a fear r eaction to life and its constant changes. T oday you learn how to stop feeling so str essed. From yo ur letter s and your comm ents on my Facebook page, I notice that many of you are struggling wit h much stress in your lives. Do you know why you feel so stressed? Stress is a fear reaction to life and to the constant chang e that is inevitable. Str ess h as become a c atchword: we use it as an excuse for not taking responsibility for our feelings, above all our fear. But if you can equate str ess with fear— and understand that feeling stressed is really a fearful reaction—you can begin to eliminate the need for stress in your life. A peace ful, relax ed person is ne ither frightened nor stressed. So if you’re feeling s tressed, ask yourself what you are afraid of. Most people have a long list of worries, with things like work, money, family, and health at the top. Y ou r concern then becomes how to eliminate the fear and move through life feeling safe. Y ou can start by doing your mirror work and practicing positi ve af firmations. When you do this, you can r eplace your negative, constricting thoughts w ith positive thoughts that create peace, joy, harmony, and a stress-free life. There is an expression I like to use a lot: the total ity of possibilities. I learned it from one of my ear ly teachers in New Y ork. This expression always g ave me a taking-of f place for letting my mind go bey ond what I thought possible—far beyond the limited beliefs I grew up with.As a child, I did not understand how much of the criticism grown-ups heaped on me was not deserved. It was their reaction to a stressful or disappointing day. But I accepted their criticism as true, and the negative thoughts and beliefs about myself that I internalized were limitations that conditioned my life for many years. I may not have looked awkward or dumb or silly, but I sure felt it. Most of our beli efs about life and about ourselves are formed by the time we are five years old. W e may expand on them a little as te enagers and maybe a tiny bit more when we are older, but very little changes overall. If I were to ask you why you hold a certain belief, you would almost certainly trace it back to a decision you made when you were a young child. So we live in th e limitations of our five-year -old consciousne ss. These limitations often stop us from e xperiencing and expressing the totality of possibilities. W e think things like I’m not smart enough. I’m not o r ganized. I have too much on my plate. I don’ t have enough time. How many of you are letting limiting beliefs stop you? Y ou have a cho ice to accept t hese limitations or to go beyo nd them. Remember: the limitations you feel are all in your mind and hav e nothing to do with reality. When you learn to drop your limiting beliefs and allow yourself to move into the totality of possibilities, you will discover that you ar e good enough. Y ou do hav e wh at it takes. Y ou can handle whatever is on your pla te. And you have all the time you need. Y ou can see all sorts of possibilities, and you are capable of remarkable things. Let’ s af firm: I bec ome mor e c onfident and pr oficient every day. Ther e ar e no limits to my abilities. Y our Day 17 Mirror W ork Exercise 1. For this exercise, I’d like you to start by sitting in a comfortable chair with your hands in your lap and both feet flat on the floor. Now close your eyes and take three long, deep breaths. Breathe in slowly and breathe out. Breathe in and breathe out. Imagine that you are wearing your tension and fear as an overcoat. Imagine undoing the buttons and pulling the coat of f your shoulders, sliding it over your arms, and dropping it on the floor.Feel any fear and tension flowing out of your body. Feel your muscles relax. Allow your entire body to relax. 2. Now pick up your pocket mirror and look deeply into your eyes. Say: I r elease all fear. I let go of all tension. I am at peace. Fr eedom fr om str ess is my divine right. Keep repeating these af firmations over and over again. 3. Close your eyes and take a few more minutes to breathe deeply. Repeat these af firmations: I believe in ME. I am a capable person. I can do it. I can handle anything that comes my way. I believe in possibilities. 4. Anytime you see your reflection today, repeat these af firmations: I am at peace. I have all the time I need. I flow with life easily and effortlessly. The Power Is W ithin Y ou: Y our Day 17 Journaling Exercise 1. Close your eyes and drift back to your past. See yourself when you were five years old. Where are you? At school? At home? What do you like to do? How do you view the world? Open your eyes and write down whatever comes to mind. 2. Do you remember any of the worries or negative beliefs that you had when you were five years old? Do you remember any hurt feelings? W rite them all down. 3. Next to all the beliefs you wrote down in Step 2, write down the real reasons for these beliefs. Perhaps your parents were having a bad day at work and told you something that wasn’ t true. Perhaps a childhood friend who was unloved decided to take it out on you. W rite all your thoughts in your journal. 4. Make a list of some of the things that are causing you stress this week. Do any of them have to do with the limited thinking ofyour five-year -old consciousness
[ 3021, 499, 13, 19, 662, 12362, 701, 836, 420, 892, 11, 1427, 17693, 1139, 701, 6548, 323, 2019, 1174, 358, 198, 31153, 499, 11, 510, 678, 948, 358, 436, 384, 750, 3021, 499, 13, 220, 4314, 8136, 7626, 811, 527, 5922, 198, 265, 65977, 927, 323, 927, 1578, 627, 20, 662, 1442, 499, 527, 3515, 12544, 304, 701, 12135, 11, 1427, 1139, 701, 198, 58331, 11, 37397, 17693, 1174, 323, 2019, 1174, 358, 1097, 10032, 311, 436, 384, 1655, 279, 1205, 369, 198, 81, 658, 15838, 82, 430, 1541, 529, 259, 46798, 819, 323, 1862, 757, 13, 220, 45901, 420, 4330, 198, 15487, 304, 279, 18327, 1174, 323, 1855, 892, 499, 2019, 433, 11, 3041, 433, 810, 198, 57865, 13, 21834, 315, 3230, 12135, 439, 499, 2019, 433, 627, 791, 7572, 2209, 468, 78942, 258, 816, 6033, 25, 816, 1057, 6187, 220, 845, 10139, 287, 198, 53809, 198, 16, 662, 763, 701, 8486, 11, 3350, 922, 1268, 499, 10534, 3021, 439, 264, 1716, 627, 7131, 499, 23846, 701, 6699, 37810, 3021, 323, 8136, 1172, 407, 5380, 54, 39357, 499, 9408, 449, 10283, 315, 80342, 30, 763, 701, 3070, 574, 3021, 198, 6397, 4920, 11039, 11, 31299, 11, 477, 21847, 5380, 17, 662, 468, 436, 635, 5899, 8136, 7626, 811, 315, 3021, 323, 6725, 1124, 304, 4156, 315, 701, 198, 74325, 662, 5810, 527, 1063, 10507, 25, 358, 1097, 28390, 315, 3021, 13, 578, 4411, 384, 358, 198, 2569, 311, 3021, 11, 279, 30549, 358, 1097, 13, 350, 297, 1316, 358, 436, 991, 1402, 430, 2324, 16180, 757, 627, 40, 1095, 3021, 1505, 757, 520, 279, 4832, 892, 627, 18, 662, 468, 436, 635, 1523, 5899, 2574, 430, 499, 3021, 311, 656, 13, 20305, 4330, 323, 656, 1124, 198, 31213, 16853, 19, 662, 350, 264, 441, 3892, 4207, 323, 42290, 716, 6261, 25, 3780, 6261, 19837, 345, 83, 1244, 6261, 311, 264, 9498, 15496, 11, 1501, 6261, 1268, 3361, 499, 198, 548, 627, 20, 662, 45901, 15166, 220, 18, 1475, 1938, 420, 2046, 4999, 56, 1057, 18449, 36287, 369, 6187, 220, 845, 25, 358, 11406, 304, 264, 21918, 315, 10919, 198, 1737, 1851, 701, 3070, 304, 264, 30570, 566, 384, 315, 3021, 11, 3508, 3070, 3697, 527, 198, 64275, 477, 220, 539, 13, 16273, 268, 279, 12960, 311, 2997, 701, 4885, 11, 701, 10456, 6305, 7509, 414, 1080, 63384, 1174, 5127, 505, 701, 3347, 11, 323, 682, 279, 1274, 499, 1053, 198, 4908, 311, 369, 3041, 719, 1541, 529, 259, 1440, 1268, 662, 13203, 7626, 430, 499, 617, 11364, 345, 13279, 1677, 1245, 1375, 64, 259, 919, 34322, 449, 1124, 682, 11, 449, 5201, 323, 30598, 389, 2225, 198, 82, 3422, 627, 39512, 270, 520, 499, 649, 3974, 449, 4170, 308, 488, 323, 9096, 323, 16267, 662, 6914, 420, 12960, 315, 198, 31153, 54285, 279, 4553, 11841, 11, 323, 1095, 701, 4851, 1825, 779, 49588, 259, 499, 617, 198, 8920, 2949, 499, 369, 84663, 3021, 627, 56, 1057, 6187, 220, 845, 77571, 25, 10919, 2209, 49741, 198, 5549, 352, 220, 845, 315, 279, 7855, 4232, 340, 29351, 374, 279, 1455, 8147, 21730, 5457, 1070, 374, 13, 11244, 5127, 499, 198, 33134, 10283, 315, 470, 12108, 323, 26586, 323, 1862, 323, 3021, 13, 2893, 8010, 430, 439, 198, 9514, 3708, 1521, 11555, 704, 11, 499, 1101, 5371, 1124, 304, 471, 627, 53, 374, 940, 553, 264, 12960, 315, 3021, 430, 384, 296, 1347, 2492, 701, 3070, 3697, 1174, 3508, 198, 64275, 477, 539, 11, 439, 1664, 439, 4885, 11, 1080, 63384, 11, 323, 5127, 505, 701, 3347, 627, 19648, 701, 659, 304, 279, 12960, 13, 816, 6033, 527, 5922, 21955, 13, 816, 6033, 527, 6366, 13, 816, 6033, 527, 198, 13477, 1285, 13, 5377, 6261, 311, 682, 1695, 323, 311, 279, 84663, 3021, 2949, 198, 9514, 13, 13203, 7626, 512, 40, 1825, 7182, 311, 3021, 627, 40, 1097, 10032, 311, 3021, 323, 387, 10456, 627, 40, 1518, 7182, 550, 2709, 61818, 13, 358, 1518, 7182, 9498, 662, 358, 1518, 7182, 1589, 384, 8046, 41834, 627, 40, 617, 11364, 11, 18249, 1245, 436, 658, 15838, 82, 304, 902, 9139, 384, 374, 27848, 436, 95370, 198, 438, 30598, 920, 362, 816, 220, 220, 16, 220, 22, 198, 43, 602, 348, 602, 308, 342, 220, 328, 259, 436, 384, 274, 274, 220, 435, 436, 384, 384, 198, 2645, 4043, 374, 264, 8850, 436, 384, 1335, 311, 2324, 323, 1202, 6926, 4442, 13, 350, 297, 1316, 499, 198, 12964, 1268, 311, 3009, 8430, 779, 610, 4043, 291, 627, 3915, 30596, 4433, 6661, 274, 323, 701, 1081, 37952, 389, 856, 5690, 2199, 11, 358, 5406, 430, 198, 35676, 315, 499, 527, 20558, 38467, 305, 1790, 8631, 304, 701, 6439, 13, 3234, 499, 1440, 198, 35734, 499, 2733, 779, 32647, 5380, 626, 676, 374, 264, 8850, 13010, 311, 2324, 323, 311, 279, 6926, 2609, 384, 430, 374, 198, 483, 85, 15729, 13, 4610, 4043, 220, 305, 439, 3719, 264, 272, 520, 331, 1178, 25, 584, 1005, 433, 439, 459, 28391, 369, 539, 198, 89894, 12014, 369, 1057, 16024, 11, 3485, 682, 1057, 8850, 662, 2030, 422, 499, 649, 198, 68, 19684, 610, 4043, 220, 449, 8850, 2345, 323, 3619, 430, 8430, 32647, 374, 2216, 264, 198, 69, 686, 1285, 13010, 71480, 649, 3240, 311, 22472, 279, 1205, 220, 369, 8631, 304, 701, 2324, 627, 32, 9096, 5716, 11, 12234, 1608, 1732, 374, 841, 220, 2544, 60178, 6463, 32647, 13, 2100, 422, 499, 3207, 198, 1897, 20659, 274, 259, 14715, 11, 2610, 6261, 1148, 499, 527, 16984, 315, 13, 7648, 1274, 617, 264, 198, 4930, 1160, 220, 315, 38145, 11, 449, 2574, 1093, 990, 11, 3300, 1174, 3070, 1174, 323, 2890, 520, 279, 198, 3565, 13, 816, 6033, 436, 4747, 1243, 9221, 1268, 311, 22472, 279, 8850, 220, 323, 3351, 198, 20322, 2324, 8430, 6220, 13, 816, 6033, 649, 1212, 555, 3815, 701, 18327, 990, 323, 198, 652, 533, 10332, 1153, 12583, 5320, 8136, 7626, 811, 13, 3277, 499, 656, 420, 11, 499, 649, 436, 384, 2050, 701, 198, 43324, 11, 390, 6765, 287, 11555, 289, 78942, 6928, 11555, 430, 1893, 9096, 11, 16267, 13801, 13279, 65527, 1174, 323, 264, 8631, 12862, 2324, 627, 3947, 374, 220, 459, 7645, 358, 1093, 311, 1005, 264, 2763, 25, 279, 2860, 433, 88, 315, 24525, 13, 220, 358, 198, 12964, 291, 433, 505, 832, 315, 856, 2487, 14869, 13639, 304, 1561, 816, 477, 74, 13, 1115, 220, 7645, 198, 33222, 342, 42738, 757, 264, 4737, 8838, 282, 2035, 369, 20806, 856, 4059, 733, 7888, 389, 67, 1148, 358, 198, 61665, 3284, 2345, 24470, 7953, 279, 7347, 21463, 358, 14264, 709, 449, 20855, 264, 1716, 11, 358, 1550, 539, 3619, 1268, 1790, 315, 279, 19347, 15042, 27859, 198, 383, 10395, 389, 757, 574, 539, 45547, 13, 1102, 574, 872, 13010, 311, 264, 46883, 477, 198, 4338, 11933, 287, 1938, 662, 2030, 358, 11928, 872, 19347, 439, 837, 11, 323, 279, 8389, 198, 61665, 82, 323, 21463, 922, 7182, 430, 358, 5419, 1534, 1051, 9669, 430, 198, 9233, 291, 856, 220, 2324, 369, 1690, 1667, 13, 358, 1253, 539, 617, 7111, 29859, 477, 198, 67, 3635, 477, 30571, 1174, 719, 358, 2771, 6612, 433, 627, 13622, 315, 1057, 1689, 72, 384, 3933, 922, 2324, 323, 922, 13520, 527, 14454, 555, 220, 279, 892, 198, 906, 527, 4330, 1667, 2362, 13, 468, 384, 1253, 220, 9407, 389, 1124, 264, 2697, 439, 1028, 665, 11467, 323, 198, 37860, 264, 13987, 2766, 810, 994, 584, 527, 9191, 1174, 719, 1633, 2697, 4442, 220, 8244, 13, 1442, 358, 198, 52898, 311, 2610, 499, 3249, 499, 3412, 264, 220, 3738, 16801, 11, 499, 1053, 4661, 7995, 198, 15417, 433, 1203, 311, 264, 5597, 499, 1903, 994, 499, 1051, 264, 3995, 1716, 627, 4516, 584, 3974, 304, 270, 384, 9669, 315, 1057, 4330, 4771, 482, 820, 17371, 818, 11107, 13, 4314, 198, 74268, 3629, 3009, 603, 505, 384, 865, 32836, 11627, 323, 37810, 279, 2458, 2786, 315, 198, 9007, 13757, 13, 468, 384, 220, 1781, 2574, 1093, 358, 4344, 539, 7941, 3403, 13, 358, 4344, 539, 297, 436, 25893, 1534, 627, 40, 617, 2288, 1790, 389, 856, 12235, 13, 358, 1541, 529, 259, 617, 3403, 892, 13, 220, 2650, 1690, 315, 499, 198, 548, 20806, 33994, 21463, 3009, 499, 5380, 56, 6033, 617, 264, 2665, 10054, 311, 4287, 259, 305, 2423, 9669, 477, 311, 733, 7888, 78, 15953, 1124, 627, 29690, 25, 279, 9669, 499, 2733, 527, 682, 304, 701, 4059, 323, 31081, 384, 4400, 311, 198, 3055, 449, 220, 8903, 662, 3277, 499, 4048, 311, 6068, 701, 33994, 21463, 323, 2187, 198, 22479, 726, 311, 3351, 1139, 279, 2458, 2786, 315, 24525, 11, 499, 690, 7142, 430, 499, 198, 277, 384, 220, 1695, 3403, 13, 816, 6033, 656, 220, 31081, 384, 421, 520, 433, 5097, 13, 816, 6033, 649, 220, 3790, 8996, 374, 389, 198, 22479, 40852, 1028, 13, 1628, 220, 499, 617, 682, 279, 892, 499, 1205, 13, 816, 6033, 649, 1518, 220, 682, 21522, 315, 198, 9007, 13757, 11, 323, 499, 527, 13171, 315, 23649, 2574, 627, 10267, 529, 274, 8136, 7626, 25, 358, 106508, 297, 2727, 4411, 384, 272, 389, 69, 1748, 323, 550, 315, 5499, 1475, 1938, 662, 23258, 384, 802, 384, 198, 2201, 13693, 311, 856, 18000, 627, 56, 1057, 6187, 220, 1114, 34954, 468, 477, 74, 33918, 198, 16, 662, 1789, 420, 10368, 11, 358, 7070, 1093, 499, 311, 1212, 555, 11961, 304, 264, 10882, 198, 35296, 449, 701, 6206, 304, 701, 24301, 323, 2225, 7693, 10269, 389, 279, 6558, 16853, 7184, 3345, 701, 6548, 323, 1935, 2380, 1317, 11, 5655, 11745, 82, 13, 426, 1244, 383, 198, 258, 14297, 323, 37397, 704, 13, 426, 1244, 383, 304, 323, 37397, 704, 13, 38891, 198, 9210, 499, 527, 12512, 701, 24408, 323, 8850, 439, 459, 927, 68512, 627, 52157, 29821, 287, 279, 12706, 323, 23062, 279, 23724, 315, 282, 701, 198, 5562, 388, 11, 34932, 433, 927, 701, 11977, 11, 323, 26156, 433, 389, 279, 6558, 662, 34027, 904, 8850, 323, 24408, 36612, 704, 315, 701, 2547, 662, 32833, 701, 198, 38827, 19153, 12234, 13, 27628, 701, 4553, 2547, 311, 12234, 627, 17, 662, 4800, 3820, 709, 701, 18301, 18327, 323, 1427, 17693, 1139, 701, 6548, 627, 46864, 25, 358, 436, 384, 1655, 682, 8850, 662, 358, 1095, 733, 315, 682, 24408, 13, 358, 1097, 520, 9096, 627, 23376, 384, 8944, 1448, 8019, 610, 4043, 374, 856, 30467, 1314, 13, 220, 13969, 40916, 1521, 198, 2642, 7626, 811, 927, 323, 927, 1578, 627, 18, 662, 13330, 701, 6548, 323, 1935, 264, 2478, 810, 4520, 311, 37397, 17693, 16853, 39818, 1521, 8136, 7626, 811, 25, 358, 4510, 304, 16691, 13, 358, 1097, 264, 13171, 198, 9164, 13, 358, 649, 656, 433, 13, 358, 649, 3790, 4205, 430, 4131, 856, 1648, 662, 358, 198, 9978, 19704, 304, 24525, 627, 19, 662, 5884, 1712, 499, 1518, 701, 22599, 3432, 1174, 13454, 1521, 8136, 7626, 811, 512, 40, 1097, 520, 9096, 13, 358, 617, 682, 279, 892, 358, 1205, 13, 358, 6530, 449, 2324, 6847, 198, 438, 69704, 16853, 791, 7572, 2209, 468, 78942, 258, 816, 6033, 25, 816, 1057, 6187, 220, 1114, 10139, 287, 198, 53809, 198, 16, 662, 13330, 701, 6548, 323, 34738, 1203, 311, 701, 3347, 13, 3580, 6261, 994, 198, 9514, 1051, 4330, 1667, 2362, 13, 11208, 527, 499, 30, 2468, 2978, 30, 2468, 2162, 5380, 3923, 656, 499, 1093, 311, 656, 30, 2650, 656, 499, 1684, 279, 1917, 30, 5377, 701, 198, 58331, 323, 3350, 1523, 8996, 4131, 311, 4059, 627, 17, 662, 3234, 499, 6227, 904, 315, 279, 38145, 477, 8389, 21463, 430, 499, 198, 32345, 994, 499, 1051, 4330, 1667, 2362, 30, 3234, 499, 6227, 904, 13194, 198, 57676, 826, 30, 468, 436, 635, 1124, 682, 1523, 627, 18, 662, 9479, 311, 682, 279, 21463, 499, 6267, 1523, 304, 15166, 220, 17, 11, 3350, 1523, 279, 198, 8110, 8125, 369, 1521, 21463, 13, 19292, 701, 6699, 1051, 3515, 264, 198, 14176, 1938, 520, 990, 323, 3309, 499, 2555, 430, 5828, 529, 259, 837, 13, 19292, 198, 64, 20587, 4333, 889, 574, 653, 385, 2111, 6773, 311, 1935, 433, 704, 389, 198, 9514, 13, 468, 436, 635, 682, 701, 11555, 304, 701, 8486, 627, 19, 662, 7557, 264, 1160, 315, 1063, 315, 279, 2574, 430, 527, 14718, 499, 8631, 420, 198, 10476, 13, 3234, 904, 315, 1124, 617, 311, 656, 449, 279, 7347, 7422, 315, 22479, 4330, 4771, 482, 820, 25917 ]
0xBreath/holistic-books
emotional stress. Pamela Ptak also regularly sprayed her apartment with roach poison and other pesticides because of infestation by biological pests. One of them may have been the same fungus causing her disability. While she was debating whethe r to under go the eye operation, a friend suggested that Pamela look into the Gerson Therapy as an alternative method of healing. It does work against any degenerative disease, chronic or acute, including those brought about by pathological microor ganisms. Since the young woman was familiar with the treatment’ s conce pt (she had watched two friends who had been diagnosed with cancer save their own lives by its application), she decided to start on Dr. Max Gerso n’s healing program herself. She found it to be no hardship, for a health food supermarket located just down the street furnished their clientele with organically grow n produce at fair market prices, and it comprise d almost all of Pamela’ s diet. Thus, for just one month, from the end of June to July 31, 1995, Pamela Ptak faithfully performed the Gerson Therapy at home, including the taking of two coffee enemas, one before she left for work in the morning and a second immedia tely upon her arriving home in the evening. The juices she made in quantit y and took along with her in thermos bottles for drinking regularly throug hout her workday. She hoped that the Gerson program was working during the weeks that followed, but, although her vision seemed to become much less blocked by the gray spot, she was not sure. On August 1, the patient visited the second retinal surgeon once more to discuss his sugg ested eye operation. When the doctor looked at his patient’ sleft retina, he was truly surprised, but pleased. The spot had shrunk and was so small it was almost invisible. There was no sign of hemorrhaging. The Gerson Therapy had so stimulated the woman’ s immune system that it had spontaneously killed off Histoplasma capsulatum on its own. She needed no antifu ngal, antibiotic medications and no operation. The spot eventually stopped blocking her vision, and today she sees just fine. The therapy took slightly over a month. Pamela Ptak happily reports to us for publication: “Here is one more condition healed by the Gerson Therapy.” THE GE RSON PROT OCOL FOR NONCANCER PATIENTS WITH DIFFERENT DISEASES No single diet/medication protocol for nonmalignant illnesses of different types exists on the Gerson program simply because each disease shows diverse dietary origins and variable treatment needs. Still, the standard protocol that had been offered by Dr. Max Gerson’ s therapy does provide a starting point which this chapter discusses. There are many modifications of diet, juicing, and medications for the dif ferent diseases. Please be assured that the proto col published here does work, although there are variables. Variables prevail simply because of (a) the patient’ s overall condition, (b) the results of the sick person’ s laboratory blood work, (c) his or her symptomatology, (d) the patient’ s age, (e) the medical diagnosis, and (f) numerous other factors. Yet virtually all types of health problems respond to the Gerson Therapy. Beginning below with “addictions,” a few of the more common illnesses which respond well to a modified Gerson Therapy protocol have their variable treatment programs described in this chapter. First, however, we provide you with the genera l therapeutic program for patients with nonmalignant diseases to follow. This general therapeutic program is the basic format to follow when someone is weighed down by any acute or chronic illness. Please assure yourself or loved ones you are helping that any appropriate modifications required of specific diseases are incorporated into the general protocol that follows. Please note: The use of a full, unmodified protocol of the Gerson Therapy for noncancer ous diseases ordinarily remains inadvis able. Whilenot usually as danger ous as inappr opriate application of the therapy to patients with a chemotherapy history, there are still considerable risks to using the intensive pr otocol in the pr esence of some illnesses. Appropriate explanations must be given to anyone using the therapy regarding the reasoning behind application of the reduced protocol. Otherwise, patients will sometimes self-medicate with the more aggressive protocol, at the expense of their safety and long-term recovery outlook. THE STANDARD PROT OCOL FOR NONCANCEROUS ILLNESSES Juices The regimen for treating a noncancerous illness can begin with the daily drinking of ten 8-ounce glasses of the juices, eliminating pure carrot juice. If the patient is in good physical condition, she or he should be able to take the full 8-ounce portions with no difficulty. However, if this person shows any form of debilitation, start with smaller quantities of juice consisting typically of 4 or 6 ounces. As always with the Gerson Therapy, be sure that the patient can tolerate all juices without significant nausea or other side effects befor e an increase in the juice quantity is consider ed. The schedule of juice drinkin g to be maintained by a rather ill but noncancerous individual should be: a. Orange juice b. Green leaf combination juice c. Apple/carrot combination juice Potassium Compound Solution (Liquid) The recommended starting dosage for potassium compound solution suggested is 2 tsp ten times per day, which represents approxima tely 1 gram (1,000 mg) or 25 mEq each of potassium (K) acetate, gluconate, and phosphate (mon obasic). This is a total K combination of 3 grams or 75 mEq/day. Most of the time patients do not require the full 40 tsp of potassium that cancer patients would require.There are contraindications to K compound solution: Patien ts with a history of renal insuf ficiency or generalized kidney dysfunction, gastritis, nausea, or any indication of bleeding problems should be starte d with 1 tsp ten times per day. Dosage may be slowly increased with observation of the compound’ s effects. Anyone with a history of cardiac insuf ficiency, myocardial infarction, or congestive heart failure should not receive potassium until blood laborator y work has been analyzed by a physician who agrees that K ingestion would be beneficial. Lugol (Potassium Iodide KI, Half-Str ength) The KI in Lugol is ingested at the rate of three to six drops per day. There are contraindications to taking Lugol for certain sick but noncancerous patients. If the individual has a history of allergy to iodine, Lugol is not indicated, at least initially; however, it can be cautiously added after three to five days, one drop to start, then increasing as tolerance allows. Other ill patients presenting with hepatic (liver) insuf ficiency, hepatitis, or hepatic cirrhosis should be started on one to two drops of Lugol per day, to avoid bleeding or a decrease in blood platelets. Those patients known to be affected by heavy metal toxicity should additionally receive doses of one to two drops per day initially. Thyr oid Hormone Thyroid hormone is taken in a dose of 1 grain once or twice per day. Typically, patients with nonmalignant diseases do not possess as serious a thyroid deficien cy as cancer patients. In some cases, the Gerson-trained health professio nals have found it beneficial for patients to start on up to 5 grains of thyroid hormone for only three to five days, rather than the fourteen days commonly prescribed for those people with malignancies. Contraindications to thyroid usage are similar to those for Lugol. Watch for signs of hyperthyroidism, including tachycardia, anxiety, insomnia, tremors, and others. Reduce dosage levels if any of these signs and symptoms are present. Also note that transient tachycardia alone is often indicative for a toxic or flare-up reaction. Patients presenting with a historyof cardiac insuf ficiency or other cardiac incidents should be started on a maximum dosage of 2 grains of thyroid daily. Niacin (V itamin B3) This vitamin B3 nutrient has a dosage of 50 mg three times per day. Some contraindications do exist, such as for patients who present with hepatic insuf ficiency, hepatitis, or hepa tic cirrhosis. These liver-impa ired people should receive a maximum of only 100 to 150 mg of niacin daily. Patients with a medical history of bleeding, ulcers, or gastritis, and those who are concurrently receiving prednisone, other steroids, or Coumadin should not receive niacin. Pancr eatin This pancreatic enzyme from the pig allows for a dosage of three 325-mg tablets taken four times a day. According to Dr. Gerson, pancreatin is contraindicated for sarcoma patients. Crude Liver/B12 Injection Taken once daily as an intram uscular injection of 3 cc of crude liver extract, added to the extract in the same syringe is 0.05 cc of vitamin
[ 14604, 8631, 13, 83243, 198, 35956, 587, 1101, 15870, 78721, 1077, 13455, 449, 938, 613, 21109, 323, 1023, 198, 30223, 76195, 1606, 315, 4225, 65078, 220, 555, 24156, 76056, 13, 3861, 315, 1124, 1253, 617, 198, 82850, 279, 1890, 79902, 14718, 1077, 28353, 16853, 8142, 1364, 574, 71513, 421, 19030, 436, 311, 1234, 733, 279, 8071, 5784, 1174, 264, 4333, 198, 82, 54376, 430, 83243, 1427, 1139, 279, 480, 1293, 40143, 439, 459, 10778, 198, 4492, 315, 21730, 13, 1102, 1587, 990, 220, 2403, 904, 5367, 75989, 8624, 11, 21249, 198, 269, 30883, 11, 2737, 1884, 7263, 922, 555, 89961, 8162, 269, 25893, 13978, 627, 12834, 279, 3995, 5333, 574, 11537, 449, 279, 6514, 529, 274, 20245, 11051, 320, 32158, 1047, 198, 14658, 291, 1403, 4885, 889, 1047, 1027, 29704, 449, 9572, 3665, 872, 1866, 198, 75, 1924, 555, 1202, 3851, 705, 1364, 6773, 311, 1212, 389, 2999, 13, 7639, 480, 388, 78, 308, 753, 21730, 198, 15252, 11937, 662, 3005, 1766, 433, 311, 387, 912, 67650, 11, 369, 264, 2890, 3691, 198, 9712, 19859, 7559, 1120, 1523, 279, 8761, 24330, 872, 97272, 449, 198, 8629, 2740, 3139, 308, 8356, 520, 6762, 3157, 7729, 11, 323, 433, 54350, 294, 4661, 682, 198, 1073, 83243, 529, 274, 10173, 627, 45600, 11, 369, 1120, 832, 2305, 11, 505, 279, 842, 315, 5651, 311, 5887, 220, 2148, 11, 220, 2550, 20, 11, 83243, 198, 35956, 587, 94176, 10887, 279, 480, 1293, 40143, 520, 2162, 11, 2737, 279, 4737, 198, 1073, 1403, 11033, 665, 35262, 11, 832, 1603, 1364, 2163, 369, 990, 304, 279, 6693, 323, 264, 198, 5686, 737, 7551, 259, 989, 5304, 1077, 33111, 2162, 304, 279, 11714, 13, 578, 65959, 1364, 198, 28010, 304, 10484, 275, 379, 323, 3952, 3235, 449, 1077, 304, 30945, 437, 27474, 369, 16558, 198, 23108, 398, 270, 583, 70, 305, 412, 1077, 990, 1316, 662, 3005, 26253, 430, 279, 480, 1293, 2068, 574, 198, 21837, 2391, 279, 5672, 430, 8272, 11, 719, 11, 8051, 1077, 11376, 9508, 311, 198, 17106, 638, 1790, 2753, 19857, 555, 279, 18004, 7858, 11, 1364, 574, 539, 2771, 627, 1966, 6287, 220, 16, 11, 279, 8893, 12263, 279, 2132, 2160, 992, 46098, 3131, 810, 311, 198, 17242, 1892, 813, 274, 2661, 1826, 291, 8071, 5784, 13, 3277, 279, 10896, 7111, 520, 813, 8893, 529, 274, 2414, 84827, 11, 568, 574, 9615, 14792, 1174, 719, 18949, 13, 578, 7858, 1047, 14362, 3200, 323, 574, 198, 708, 2678, 433, 574, 4661, 30547, 13, 2684, 574, 912, 1879, 315, 71417, 4210, 13, 578, 198, 38, 1293, 40143, 220, 1047, 779, 81471, 279, 5333, 529, 274, 22852, 1887, 430, 433, 1047, 198, 2203, 546, 20933, 7577, 1022, 67005, 454, 14833, 1764, 19079, 360, 27349, 220, 389, 1202, 1866, 13, 3005, 4460, 198, 2201, 3276, 21519, 7933, 278, 11, 60595, 31010, 323, 912, 5784, 13, 578, 7858, 9778, 198, 90963, 22978, 1077, 11376, 11, 323, 3432, 1364, 16008, 1120, 7060, 627, 791, 15419, 3952, 10284, 927, 264, 2305, 13, 83243, 52170, 587, 37875, 6821, 311, 603, 198, 2000, 17009, 25, 1054, 8586, 374, 832, 810, 3044, 62320, 555, 279, 480, 1293, 198, 1016, 261, 9864, 662, 89874, 17673, 30957, 432, 2770, 220, 91928, 507, 19924, 4716, 220, 21219, 34, 27267, 643, 220, 45470, 10990, 50, 4874, 220, 69649, 643, 1863, 198, 35, 9311, 4157, 50, 198, 2822, 3254, 10173, 14, 2106, 20901, 11766, 369, 2536, 76, 6750, 519, 49909, 315, 2204, 198, 9426, 6866, 389, 279, 480, 1293, 2068, 5042, 1606, 1855, 8624, 5039, 198, 614, 113305, 34625, 33472, 323, 3977, 6514, 3966, 13, 16782, 11, 279, 5410, 198, 17447, 430, 1047, 1027, 9076, 555, 2999, 13, 7639, 480, 1293, 529, 274, 15419, 1587, 3493, 264, 198, 40389, 1486, 902, 420, 12735, 220, 35434, 13, 2684, 527, 1690, 29882, 315, 198, 94942, 11, 10479, 10332, 11, 323, 31010, 369, 279, 1422, 18728, 306, 19338, 627, 5618, 387, 28478, 430, 279, 18940, 1400, 4756, 1618, 1587, 990, 11, 8051, 198, 19041, 527, 7482, 13, 22134, 66828, 5042, 1606, 315, 320, 64, 8, 279, 8893, 529, 274, 198, 75555, 3044, 11, 320, 65, 8, 279, 3135, 315, 279, 14363, 1732, 529, 274, 27692, 6680, 990, 345, 1361, 8, 813, 477, 1077, 49648, 75014, 1174, 320, 67, 8, 279, 8893, 529, 274, 4325, 11, 320, 68, 8, 279, 6593, 198, 8747, 50915, 11, 323, 320, 69, 8, 12387, 1023, 9547, 13, 14968, 21907, 682, 4595, 315, 2890, 198, 96440, 6013, 311, 279, 480, 1293, 40143, 16853, 76390, 3770, 220, 449, 1054, 723, 22155, 2476, 264, 2478, 315, 279, 810, 4279, 220, 49909, 198, 8370, 6013, 1664, 311, 264, 11041, 480, 1293, 40143, 11766, 220, 617, 872, 198, 10014, 6514, 7620, 7633, 304, 420, 12735, 662, 5629, 11, 4869, 1174, 584, 198, 62556, 499, 449, 279, 84535, 326, 37471, 2068, 369, 6978, 449, 198, 6414, 76, 6750, 519, 19338, 311, 1833, 662, 1115, 4689, 37471, 2068, 374, 279, 198, 23144, 3645, 311, 1833, 994, 4423, 374, 47712, 1523, 555, 904, 30883, 477, 198, 7562, 292, 17563, 13, 5321, 36015, 6261, 477, 10456, 6305, 499, 527, 10695, 430, 198, 3852, 8475, 29882, 2631, 315, 3230, 19338, 527, 32762, 198, 18614, 279, 4689, 11766, 430, 11263, 627, 5618, 5296, 25, 578, 1005, 315, 264, 2539, 11, 653, 28261, 11766, 315, 279, 480, 1293, 198, 1016, 261, 9864, 369, 2536, 66, 11967, 220, 788, 19338, 98081, 8625, 304, 329, 2749, 3025, 13, 1254, 23684, 354, 6118, 439, 8137, 220, 788, 439, 304, 391, 652, 1200, 462, 349, 3851, 315, 279, 15419, 311, 198, 81437, 449, 264, 62730, 3925, 1174, 1070, 527, 2103, 24779, 15635, 311, 198, 985, 279, 37295, 550, 14479, 4650, 304, 279, 550, 1560, 768, 315, 1063, 49909, 627, 2213, 25264, 41941, 2011, 387, 2728, 311, 5606, 1701, 279, 15419, 198, 1610, 29510, 279, 33811, 4920, 3851, 315, 279, 11293, 11766, 627, 81556, 11, 6978, 690, 7170, 659, 45872, 8630, 449, 279, 810, 19738, 198, 17447, 11, 520, 279, 20900, 315, 872, 7296, 323, 1317, 9860, 13654, 36721, 627, 17673, 77457, 220, 91928, 507, 19924, 4716, 220, 21219, 34, 27267, 17746, 2078, 220, 358, 4178, 72858, 29095, 198, 63704, 1238, 198, 791, 68128, 369, 27723, 264, 2536, 66, 11967, 788, 17563, 649, 3240, 449, 279, 7446, 198, 3696, 16113, 315, 5899, 220, 23, 12, 9933, 29247, 315, 279, 65959, 11, 40599, 10748, 75294, 23661, 627, 2746, 279, 8893, 374, 304, 1695, 7106, 3044, 11, 1364, 477, 568, 1288, 387, 3025, 311, 1935, 198, 1820, 2539, 220, 23, 12, 9933, 220, 19885, 449, 912, 17250, 662, 4452, 1174, 422, 420, 1732, 5039, 198, 3852, 1376, 315, 4316, 33949, 11, 1212, 449, 9333, 33776, 315, 23661, 31706, 198, 87184, 315, 220, 19, 477, 220, 21, 49138, 627, 2170, 2744, 449, 279, 480, 1293, 40143, 1174, 387, 2771, 430, 279, 8893, 649, 50134, 198, 543, 65959, 2085, 5199, 61880, 477, 1023, 3185, 6372, 387, 2000, 384, 459, 5376, 198, 258, 279, 23661, 12472, 374, 2980, 1608, 627, 791, 9899, 315, 23661, 7172, 258, 342, 311, 387, 18908, 555, 264, 4856, 5986, 719, 198, 6414, 66, 11967, 788, 3927, 1288, 387, 512, 64, 13, 22725, 23661, 198, 65, 13, 7997, 16312, 10824, 23661, 198, 66, 13, 8325, 66759, 4744, 10824, 23661, 198, 45716, 49163, 62672, 12761, 320, 97740, 340, 791, 11349, 6041, 47040, 369, 62275, 24549, 6425, 198, 82, 54376, 374, 220, 17, 39020, 5899, 3115, 824, 1938, 11, 902, 11105, 10049, 7675, 259, 989, 220, 16, 23882, 198, 7, 16, 11, 931, 14060, 8, 477, 220, 914, 296, 28412, 1855, 315, 62275, 320, 42, 8, 65802, 349, 11, 78376, 444, 349, 11, 323, 198, 764, 93473, 320, 1677, 1536, 6099, 570, 1115, 374, 264, 2860, 735, 10824, 315, 220, 18, 34419, 477, 220, 2075, 198, 76, 28412, 45839, 662, 7648, 315, 279, 892, 6978, 656, 539, 1397, 279, 2539, 220, 1272, 39020, 315, 198, 19644, 49163, 430, 9572, 6978, 1053, 1397, 53407, 527, 6155, 467, 30780, 811, 311, 735, 24549, 6425, 25, 7281, 3675, 10814, 449, 264, 198, 19375, 315, 63915, 1672, 1739, 282, 10603, 477, 67217, 39042, 32403, 11, 56780, 20000, 345, 3458, 817, 64, 11, 477, 904, 28137, 315, 35763, 5435, 1288, 387, 1212, 68, 294, 449, 220, 16, 39020, 198, 2002, 3115, 824, 1938, 13, 58020, 425, 1253, 387, 14297, 7319, 449, 22695, 315, 279, 198, 87304, 529, 274, 6372, 13, 33634, 449, 264, 3925, 315, 47345, 1672, 1739, 282, 10603, 13801, 2465, 74378, 532, 4225, 277, 407, 11, 477, 44385, 535, 4851, 8060, 1288, 539, 5371, 198, 19644, 49163, 3156, 6680, 9511, 859, 379, 990, 706, 1027, 30239, 555, 264, 28378, 198, 14965, 34008, 430, 735, 88447, 1053, 387, 24629, 627, 43, 773, 337, 320, 45716, 49163, 358, 347, 579, 735, 40, 11, 26924, 12, 2645, 2995, 339, 340, 791, 735, 40, 304, 93590, 337, 374, 6892, 10185, 520, 279, 4478, 315, 2380, 311, 4848, 21701, 824, 1938, 13, 2684, 198, 548, 6155, 467, 30780, 811, 311, 4737, 93590, 337, 369, 3738, 14363, 719, 2536, 66, 11967, 788, 198, 81437, 13, 1442, 279, 3927, 706, 264, 3925, 315, 60754, 311, 80087, 483, 11, 93590, 337, 374, 539, 198, 485, 10297, 11, 520, 3325, 15453, 26, 4869, 1174, 433, 649, 387, 92485, 3779, 1306, 2380, 311, 198, 53770, 2919, 11, 832, 6068, 311, 1212, 11, 1243, 7859, 439, 25065, 6276, 627, 11663, 5986, 6978, 32644, 449, 80445, 780, 320, 75, 1553, 8, 1672, 1739, 282, 10603, 1174, 73975, 345, 269, 80445, 780, 30570, 41196, 10934, 1288, 387, 3940, 389, 832, 311, 1403, 21701, 315, 93590, 337, 824, 1938, 345, 998, 5766, 35763, 477, 264, 18979, 304, 6680, 12235, 10145, 13, 13266, 6978, 3967, 311, 198, 1395, 11754, 555, 8987, 9501, 58011, 1288, 37938, 5371, 35130, 315, 832, 198, 998, 1403, 21701, 824, 1938, 15453, 16853, 1016, 11160, 49866, 92208, 606, 198, 1016, 88, 1607, 36908, 374, 4529, 304, 264, 19660, 315, 220, 16, 24875, 3131, 477, 11157, 220, 824, 1938, 627, 13129, 2740, 1174, 6978, 449, 2536, 76, 6750, 519, 19338, 656, 539, 15575, 439, 6129, 264, 198, 27520, 1607, 711, 3457, 268, 9693, 439, 9572, 6978, 13, 763, 1063, 5157, 11, 279, 480, 1293, 70024, 198, 12393, 35578, 822, 308, 1147, 617, 1766, 433, 24629, 369, 6978, 311, 1212, 389, 709, 311, 220, 20, 198, 911, 1771, 315, 54060, 36908, 369, 1193, 2380, 311, 4330, 2919, 11, 4856, 1109, 279, 198, 35124, 15247, 2919, 17037, 32031, 369, 1884, 1274, 449, 60327, 32737, 627, 1128, 10613, 30780, 811, 311, 54060, 10648, 527, 4528, 311, 1884, 369, 93590, 337, 13, 10573, 198, 2000, 12195, 315, 17508, 27520, 1607, 2191, 11, 2737, 259, 613, 3418, 569, 689, 11, 18547, 1174, 83511, 345, 83, 1864, 1105, 11, 323, 3885, 13, 53253, 47040, 5990, 422, 904, 315, 1521, 220, 12195, 323, 198, 24738, 52273, 527, 3118, 13, 7429, 5296, 430, 41658, 259, 613, 3418, 569, 689, 7636, 374, 3629, 198, 86184, 1413, 369, 264, 21503, 477, 61363, 5352, 13010, 13, 44430, 32644, 449, 264, 3925, 1073, 47345, 1672, 1739, 282, 10603, 477, 1023, 47345, 24455, 1288, 387, 3940, 389, 264, 198, 40287, 47040, 315, 220, 17, 41936, 315, 54060, 7446, 16853, 45, 18029, 258, 320, 53, 433, 8778, 426, 18, 340, 2028, 28170, 426, 18, 50123, 706, 264, 47040, 315, 220, 1135, 14060, 2380, 3115, 824, 1938, 662, 4427, 198, 8386, 467, 30780, 811, 656, 3073, 11, 1778, 439, 369, 6978, 889, 3118, 449, 80445, 780, 198, 1354, 1739, 282, 10603, 1174, 73975, 11, 477, 568, 6733, 62547, 30570, 41196, 10934, 13, 4314, 26587, 38025, 6733, 220, 2757, 1274, 198, 5562, 5371, 264, 7340, 315, 1193, 220, 1041, 311, 220, 3965, 14060, 315, 13080, 40488, 7446, 662, 44430, 198, 4291, 264, 6593, 3925, 315, 35763, 11, 8725, 17254, 11, 477, 56780, 20000, 11, 323, 1884, 889, 527, 198, 444, 59302, 12588, 4255, 26209, 606, 11, 1023, 58161, 11, 477, 18733, 20920, 258, 1288, 539, 198, 42993, 13080, 40488, 627, 47, 1149, 81, 8343, 258, 198, 2028, 98144, 49242, 505, 279, 24623, 6276, 369, 264, 47040, 315, 2380, 220, 15257, 1474, 70, 198, 2048, 2641, 4529, 3116, 3115, 264, 1938, 13, 10771, 311, 2999, 13, 480, 1293, 11, 62268, 15111, 374, 198, 8386, 467, 67, 10297, 369, 29147, 82945, 6978, 627, 16384, 799, 22617, 16675, 717, 54911, 198, 66769, 3131, 7446, 439, 459, 10805, 309, 603, 22077, 26127, 315, 220, 18, 12810, 315, 35750, 26587, 198, 24396, 11, 3779, 311, 279, 8819, 304, 279, 1890, 6705, 85124, 374, 220, 15, 13, 2304, 12810, 315, 28170 ]
0xBreath/holistic-books
choose to look at a situation, who do I choose to be within it, and what do I choose to do? Life is about not just what happ ens to us, but also who we choo se to be in the space of what happens. Every situation is designed by an intelligent universe specifically for our soul growth, by definition presenting us with the oppo rtunities to play life either from a place of love or from a place of fear—from forgiveness, positivity, and contribution, or from blame, negativity, and victimhood. Every moment we make the choice. We make it either consciously or unconsciously, but every thought represents a decision, and “All thinking produces form at some level”* (T-31). That is how powerful we are, and how responsible we are for our life experience. The life we live is a reflection of thoughts we chose to think before this moment. Our lives begin to change when we choose to think differen tly now. The spiritual journey is a transition from who we used to be and the life we used to live, to who we would rather be and the life we would rather live. No one and nothing can decide for you the thoughts you choose to think. The world would tell us there’ s no road map, nothing but a random universe in which the highest good is to do whatever we feel like doing, or would make us the most money, or would get us whatever it is we think we want. Nothing is a more limited mentality than such a purposeless perspective. Living our lives in service to a higher purpos e is the only road to happiness, because it is the reason we were born. What the ego posits asfreedom is not freedom, but license; it is a prison of our own making. Following Jesus, serving the Will of God, trying our best to be loving means serving the desires of our own true self. OceanofPDF.comThe Pillars of a Well-Lived Life The three principles we hold on to as we walk the spiritual path are these: faith, love, and service. Those are the pillars of righteou sness, or “right use-ness” of the mind. But even more than that, they are our powers. They are the use of the mind in ways that lift us above the normal limitations of the mortal world. Who among us has not seen things come together when harmon y exists among the players in a system, and things fall apart when anger and negativity prevail? Our faith that anything is possible in the presence of love, our faith that forgiveness will always interrupt the ego’s tyranny—these are our powers when we let miracles light the way. The Holy Spirit is the motivation for miracles and conduit for mirac les. He is never not available to show us where they are. “I am not absent to anyone in any situation” (T -116). The world can be a miraculous place, and in many ways it is. We hold our child ren, we fall in love, we build communities. It’s all there. But the fear-based thought system that dominates the world is like a sword of Damocles that hangs above us all. The fate of our world literally hangs on whether or not we can stop attacking each other, attacking the earth, and attacking ourselves. We need faith that it’ s possible for us, and for the world, to change. We need love to dissolve the layers of fear that saturate the world. We need a consciousness of service to make sure we will. As we increase our ability to embody the love that is the truth of who we are, we begin to attract mighty companions into our experience. We meet people with whom there’ s an almost mysterious sense that we were brought together for purposes higher than our own. We’re no longer driven to achie ve what we perceive to be our separate goals, but instead we’redriven by a desire to collaborate with others in creating collective changes to the world in which we live. The idea that we go to work to make money, to gain power, or for any other purpose dictated by a consumer -driven culture begins to take second place to a more meaningful yearning: to create the good, the beautiful, and the holy. And to create those things with others. The intentional nature of the universe applies not only to our individual lives but to our relationships as well. We are drawn to people with whom we can heal and with whom we can create more than we could have created on our own. This is the regenerative energy of Christ that is emerging in the world today. Yes, the ego’s wiles are still a danger to us all. But the sense that God is active, that the spirit of rebirth is upon us, that Jesus walks on the water even now, is palpable as well. He is order in the midst of chaos, he is wisdom in the midst of confusion, he is the love that casts out fear. Jesus is in you and me and all of us, by whatever name we call him. In moments of despair we need but call, and he will hear, and he will answer. The times ahead migh t indeed be challenging, but we will not be alone. Love will prevai l, for God alway s gets the final say. What is completely up to us, to be determined by the exercise of our free will, is how long it will take to get there—and how much suffering must occur before the dawning of the light. In the Talmud it is written that in the midst of the darkest night we should act as if morning has already come. For in a way it already has. Hallelujah. Praise God. Amen. OceanofPDF.comChapter Four He Did Not Die Teach not that I died in vain. Teach rather that I did not die, by demonstrating that I live in you.* (T -209) OceanofPDF.comJerusalem The Chur ch of the Holy Sepulchre in the Old City of Jerusalem contains two of the holiest sites in Christianity: the place where Jesus was crucified, and the tomb where his body was taken and from which he resurrected. It’s rather shocking how much history is recorded there, based on traditions going all the way back to the fourth century. Visitors walk up a narrow flight of stairs to see the actual site of the crucifixion; in a room right below, behind glass, one can see the rock onto which his blood was spilled. To me, one of the most profound parts of the Bible is the story of women gathered around the foot of the cross and refusing to abandon him in the hours of his suf fering. Being in the church is very moving, and I had an interesting experience the first time I went. A friend and fellow student of A Course in Miracles named Daniella happened to be in Israel while I was there, and we had spoken on the phone that morning. She was in Tel Aviv and I was in Jerusalem, both of us busy with various things and not knowing at what point we’d be in the same town. We were going to continue to communicate, making sure we’d have a chance to visit sometime during the week I was there. Visiting the church several hours later, I was overwhelmed by how many hundreds of people were milling around. Tourists and disciples from all over the world visit the church in every hour that it’s open— four million people annually—and the hustl e and bustle of so many people in every corner of every room is simply part of the experience. After I’d gone upstairs and come back down again, I headed for the lower room beneath where Jesus had died. Upstairs is where they say he was crucified; downstairs is where those who bore witness to his suffering were gathered. Looking in, I saw to my surprise that the room was entirely empty. Empty, that is, except for Daniella.I looked at her and she looked at me. No words could have matched the moment. Both of us felt it. I don’t know who was at his feet two thousand years ago, but Daniella and I were at his feet together now. OceanofPDF.comDetroit The modern mind is prone to scoffing at the idea of evil, capable of acknowledging its existence but considering itself too smart to investigate its sourc e. The ego loves that attitude, of course. It enables the ego to operate in secret. The ego is not a dysfunction, it is a malfunction. It is not neutral, it is malevolent. And its goal is not to inconvenience you; its goal is to destroy anything beautiful and precious you have ever known, including you. Jesus died a horrible death, not some quick mortal wound but rather a torture that went on for hours. With every hour his suffering increased. There could be no more potent image of injustice and unmitig ated cruelty than the torture of an innocent man who had helped many and harmed no one. It is not the reality of his death, but the meaning of his death, that is meant to instruct us. Billions of people suffer no less horribly, and no less unfairly, on the earth today. In recognizing the suffering of Jesus, we should remember the suffering of the world. His message wasn’ t “Hey, look at me.” His message is “Hey, look at you.” Many years ago I was the minister
[ 198, 28150, 311, 1427, 520, 264, 6671, 11, 889, 656, 358, 5268, 311, 387, 2949, 433, 11, 323, 1148, 656, 358, 198, 28150, 311, 656, 5380, 26833, 374, 922, 539, 1120, 1148, 2306, 4675, 311, 603, 11, 719, 1101, 889, 584, 2665, 78, 513, 311, 387, 198, 258, 279, 3634, 315, 1148, 8741, 13, 7357, 6671, 374, 6319, 555, 459, 25530, 198, 359, 8194, 11951, 369, 1057, 13836, 6650, 11, 555, 7419, 32644, 603, 449, 198, 1820, 4083, 78, 17091, 6165, 311, 1514, 2324, 3060, 505, 264, 2035, 315, 3021, 477, 505, 264, 2035, 315, 198, 69, 686, 88958, 53150, 11, 98042, 1174, 323, 19035, 11, 477, 505, 19065, 345, 29875, 44515, 1174, 323, 11996, 5812, 627, 11769, 4545, 584, 1304, 279, 5873, 13, 1226, 1304, 433, 3060, 70903, 477, 198, 359, 444, 71888, 1174, 719, 1475, 3463, 11105, 264, 5597, 11, 323, 1054, 2460, 7422, 198, 8723, 1634, 1376, 520, 1063, 2237, 863, 9, 320, 51, 12, 2148, 570, 3011, 374, 1268, 8147, 584, 527, 11, 323, 198, 5269, 8647, 584, 527, 369, 1057, 2324, 3217, 627, 791, 2324, 584, 3974, 374, 264, 22599, 315, 11555, 584, 14896, 311, 1781, 1603, 420, 198, 29699, 13, 5751, 6439, 3240, 311, 2349, 994, 584, 5268, 311, 1781, 220, 1782, 268, 259, 398, 198, 3409, 13, 578, 18330, 11879, 374, 264, 9320, 505, 889, 584, 1511, 311, 387, 323, 279, 198, 14789, 584, 1511, 311, 3974, 11, 311, 889, 584, 1053, 4856, 387, 323, 279, 2324, 584, 1053, 4856, 198, 25859, 13, 2360, 832, 323, 4400, 649, 10491, 369, 499, 279, 11555, 499, 5268, 311, 198, 27963, 627, 791, 1917, 1053, 3371, 603, 1070, 529, 274, 912, 5754, 2472, 11, 4400, 719, 264, 4288, 198, 359, 8194, 304, 902, 279, 8592, 1695, 374, 311, 656, 8996, 584, 2733, 1093, 3815, 11, 477, 198, 41450, 1304, 603, 279, 1455, 3300, 1174, 477, 1053, 636, 603, 8996, 433, 374, 584, 1781, 584, 198, 53757, 13, 12334, 374, 264, 810, 7347, 49395, 1109, 1778, 264, 7580, 1752, 198, 32390, 9262, 627, 45605, 1057, 6439, 304, 2532, 311, 264, 5190, 220, 84896, 384, 374, 279, 1193, 5754, 311, 198, 71, 67391, 11, 1606, 433, 374, 279, 2944, 584, 1051, 9405, 13, 3639, 279, 37374, 1153, 1220, 439, 25746, 8944, 374, 539, 11542, 11, 719, 5842, 26, 433, 374, 264, 9527, 315, 1057, 1866, 3339, 627, 28055, 10811, 11, 13788, 279, 4946, 315, 4359, 11, 4560, 1057, 1888, 311, 387, 21955, 198, 47321, 13788, 279, 32097, 315, 1057, 1866, 837, 659, 627, 97283, 1073, 24317, 662, 884, 791, 35236, 1590, 315, 264, 8489, 8288, 2270, 9601, 198, 791, 2380, 16565, 584, 3412, 389, 311, 439, 584, 4321, 279, 18330, 1853, 527, 1521, 512, 75710, 11, 3021, 11, 323, 2532, 627, 23025, 527, 279, 64982, 315, 1314, 68, 283, 274, 2136, 11, 477, 1054, 1315, 1005, 12, 2136, 863, 315, 279, 4059, 627, 4071, 1524, 220, 810, 1109, 430, 11, 814, 527, 1057, 13736, 13, 2435, 527, 279, 1005, 315, 279, 4059, 198, 258, 5627, 430, 12157, 603, 3485, 279, 4725, 9669, 315, 279, 49972, 1917, 627, 15546, 4315, 603, 706, 539, 3970, 2574, 2586, 3871, 994, 18249, 379, 6866, 198, 77405, 279, 4311, 304, 264, 1887, 11, 323, 2574, 4498, 10980, 994, 19788, 323, 198, 29875, 44515, 66828, 5380, 8140, 10082, 430, 4205, 374, 3284, 304, 279, 9546, 315, 3021, 11, 1057, 10082, 430, 198, 97944, 13071, 690, 2744, 12956, 279, 37374, 753, 78001, 2345, 45010, 527, 1057, 13736, 198, 9493, 584, 1095, 71912, 3177, 279, 1648, 13, 578, 19229, 17326, 374, 279, 25835, 369, 198, 20531, 18709, 323, 77635, 369, 66066, 3625, 13, 1283, 374, 2646, 539, 2561, 311, 1501, 603, 198, 2940, 814, 527, 13, 1054, 40, 1097, 539, 28310, 311, 5606, 304, 904, 6671, 863, 320, 51, 482, 8027, 4390, 791, 1917, 649, 387, 264, 91813, 2035, 11, 323, 304, 1690, 5627, 433, 374, 13, 1226, 3412, 198, 414, 1716, 5790, 11, 584, 4498, 304, 3021, 11, 584, 1977, 10977, 13, 1102, 753, 682, 1070, 13, 2030, 279, 198, 69, 686, 6108, 3463, 1887, 430, 83978, 279, 1917, 374, 1093, 264, 20827, 315, 198, 49057, 511, 645, 430, 59441, 3485, 603, 682, 13, 578, 25382, 315, 1057, 1917, 16280, 59441, 389, 198, 49864, 477, 539, 584, 649, 3009, 23664, 1855, 1023, 1174, 23664, 279, 9578, 11, 323, 198, 1617, 9162, 13520, 627, 1687, 1205, 10082, 430, 433, 529, 274, 3284, 369, 603, 11, 323, 369, 279, 1917, 11, 311, 2349, 627, 1687, 1205, 3021, 311, 73739, 279, 13931, 315, 8850, 430, 94577, 349, 279, 1917, 627, 1687, 1205, 264, 25917, 315, 2532, 311, 1304, 2771, 584, 690, 627, 2170, 584, 5376, 1057, 5845, 311, 81658, 279, 3021, 430, 374, 279, 8206, 315, 889, 198, 906, 527, 11, 584, 3240, 311, 9504, 42727, 41957, 1139, 1057, 3217, 13, 1226, 198, 64510, 1274, 449, 8884, 1070, 529, 274, 459, 4661, 26454, 5647, 430, 584, 1051, 198, 65, 6478, 3871, 369, 10096, 5190, 1109, 1057, 1866, 13, 1226, 3207, 912, 5129, 16625, 198, 998, 6215, 5320, 1148, 220, 584, 45493, 311, 387, 1057, 8821, 9021, 11, 719, 4619, 584, 529, 1171, 81, 2116, 555, 264, 12876, 311, 51696, 449, 3885, 304, 6968, 22498, 4442, 198, 998, 279, 1917, 304, 902, 584, 3974, 627, 791, 4623, 430, 584, 733, 311, 990, 311, 1304, 3300, 1174, 311, 8895, 2410, 1174, 477, 369, 904, 198, 1605, 7580, 81498, 555, 264, 11761, 482, 3696, 2116, 7829, 12302, 311, 1935, 2132, 198, 2050, 311, 264, 810, 23222, 1060, 1251, 25, 311, 1893, 279, 1695, 11, 279, 6366, 11, 323, 198, 1820, 27823, 662, 1628, 311, 1893, 1884, 2574, 449, 3885, 627, 791, 47964, 7138, 315, 279, 15861, 17208, 539, 1193, 311, 1057, 3927, 198, 75, 1924, 719, 311, 1057, 12135, 439, 1664, 13, 1226, 527, 15107, 311, 1274, 449, 8884, 198, 906, 649, 27661, 323, 449, 8884, 584, 649, 1893, 810, 1109, 584, 1436, 617, 3549, 198, 263, 1057, 1866, 13, 1115, 374, 279, 1239, 75989, 4907, 315, 3771, 430, 374, 24084, 304, 279, 198, 14957, 3432, 13, 7566, 11, 279, 37374, 753, 289, 3742, 527, 2103, 264, 8137, 311, 603, 682, 13, 2030, 279, 5647, 198, 9210, 4359, 374, 4642, 11, 430, 279, 9090, 315, 12646, 4914, 374, 5304, 603, 11, 430, 10811, 23291, 389, 198, 1820, 3090, 1524, 1457, 1174, 374, 75649, 481, 439, 1664, 627, 1548, 374, 2015, 304, 279, 35446, 315, 28013, 11, 568, 374, 24278, 304, 279, 35446, 315, 198, 6263, 7713, 11, 568, 374, 279, 3021, 430, 57133, 704, 8850, 13, 10811, 374, 304, 499, 323, 757, 323, 682, 315, 198, 355, 11, 555, 8996, 836, 584, 1650, 1461, 13, 763, 14269, 315, 46996, 584, 1205, 719, 1650, 345, 438, 568, 690, 6865, 11, 323, 568, 690, 4320, 662, 578, 3115, 8469, 296, 1108, 259, 13118, 387, 198, 331, 34869, 287, 11, 719, 584, 690, 539, 387, 7636, 627, 29351, 690, 8031, 2192, 326, 11, 369, 4359, 453, 3195, 274, 5334, 279, 1620, 2019, 13, 3639, 374, 6724, 198, 455, 311, 603, 11, 311, 387, 11075, 555, 279, 10368, 315, 1057, 1949, 690, 11, 374, 1268, 1317, 433, 198, 14724, 1935, 311, 636, 1070, 17223, 1268, 1790, 16066, 2011, 12446, 1603, 279, 198, 67, 51946, 315, 279, 3177, 13, 763, 279, 350, 7828, 664, 433, 374, 5439, 430, 304, 279, 35446, 315, 279, 198, 35223, 40423, 3814, 584, 1288, 1180, 439, 422, 6693, 706, 2736, 2586, 13, 1789, 304, 264, 1648, 433, 198, 46584, 706, 627, 39, 8116, 9832, 1494, 13, 393, 19223, 4359, 13, 62496, 627, 97283, 1073, 24317, 662, 884, 26072, 13625, 198, 1548, 14910, 2876, 8574, 198, 6777, 613, 539, 430, 358, 8636, 304, 46604, 13, 70377, 4856, 430, 358, 1550, 539, 2815, 11, 555, 45296, 430, 358, 3974, 304, 198, 9514, 5013, 320, 51, 482, 12652, 340, 97283, 1073, 24317, 662, 884, 45057, 25245, 198, 791, 921, 324, 523, 315, 279, 19229, 17907, 360, 331, 265, 304, 279, 10846, 4409, 315, 26523, 220, 5727, 198, 20375, 315, 279, 24429, 13744, 6732, 304, 32186, 25, 279, 2035, 1405, 10811, 574, 15131, 1908, 345, 438, 279, 44180, 1405, 813, 2547, 574, 4529, 323, 505, 902, 568, 66819, 291, 627, 2181, 753, 4856, 34734, 1268, 1790, 3925, 374, 12715, 1070, 11, 3196, 389, 198, 48126, 6055, 2133, 682, 279, 1648, 1203, 311, 279, 11999, 9478, 662, 69940, 4321, 709, 264, 198, 77, 6172, 11213, 315, 32249, 311, 1518, 279, 5150, 2816, 315, 279, 15131, 97422, 290, 26, 304, 264, 3130, 198, 1315, 3770, 11, 4920, 9168, 11, 832, 649, 1518, 279, 7091, 8800, 902, 813, 6680, 574, 198, 2203, 4473, 13, 2057, 757, 11, 832, 315, 279, 1455, 28254, 5596, 315, 279, 17377, 374, 279, 3446, 315, 198, 65762, 20802, 2212, 279, 4579, 315, 279, 5425, 323, 39089, 311, 15673, 1461, 198, 258, 279, 4207, 315, 813, 56868, 282, 4776, 627, 34242, 304, 279, 8993, 374, 1633, 7366, 11, 323, 358, 1047, 459, 7185, 3217, 198, 1820, 1176, 892, 358, 4024, 13, 362, 4333, 323, 12637, 5575, 315, 362, 17026, 304, 14603, 18709, 198, 31345, 30639, 6985, 7077, 311, 387, 304, 6921, 1418, 358, 574, 1070, 11, 323, 584, 1047, 198, 52858, 389, 279, 4641, 430, 6693, 13, 3005, 574, 304, 23683, 66947, 323, 358, 574, 304, 198, 45057, 25245, 11, 2225, 315, 603, 13326, 449, 5370, 2574, 323, 539, 14392, 520, 1148, 198, 2837, 584, 7070, 387, 304, 279, 1890, 6424, 13, 1226, 1051, 2133, 311, 3136, 311, 198, 26660, 349, 11, 3339, 2771, 584, 7070, 617, 264, 6140, 311, 4034, 36113, 2391, 279, 198, 10476, 358, 574, 1070, 627, 3198, 5977, 279, 8993, 3892, 4207, 3010, 11, 358, 574, 43206, 555, 1268, 198, 35676, 11758, 315, 1274, 1051, 46472, 2212, 13, 14986, 1705, 323, 49260, 505, 198, 543, 927, 279, 1917, 4034, 279, 8993, 304, 1475, 6596, 430, 433, 753, 1825, 2345, 3116, 3610, 198, 16455, 30171, 17223, 279, 59750, 75, 384, 323, 21444, 273, 315, 779, 1690, 1274, 304, 1475, 198, 74525, 315, 1475, 3130, 374, 5042, 961, 315, 279, 3217, 627, 6153, 358, 7070, 8208, 50007, 323, 2586, 1203, 1523, 1578, 11, 358, 19946, 369, 279, 198, 15115, 3130, 24923, 1405, 10811, 1047, 8636, 13, 3216, 31234, 374, 1405, 814, 2019, 568, 198, 16514, 15131, 1908, 26, 63891, 374, 1405, 1884, 889, 39786, 11550, 311, 813, 16066, 198, 52898, 20802, 13, 21815, 304, 11, 358, 5602, 311, 856, 13051, 430, 279, 3130, 574, 11622, 198, 3274, 662, 23020, 1174, 430, 374, 11, 3734, 369, 30639, 6985, 2506, 7111, 520, 1077, 323, 1364, 7111, 520, 757, 13, 2360, 4339, 1436, 617, 18545, 279, 198, 29699, 13, 11995, 315, 603, 6612, 433, 13, 358, 1541, 1431, 1440, 889, 574, 520, 813, 7693, 1403, 16579, 198, 42820, 4227, 11, 719, 30639, 6985, 323, 358, 1051, 520, 813, 7693, 3871, 1457, 16853, 97283, 1073, 24317, 662, 884, 98393, 198, 791, 6617, 4059, 374, 38097, 311, 90656, 287, 520, 279, 4623, 315, 14289, 11, 13171, 315, 198, 474, 51122, 3252, 1202, 14209, 719, 13126, 5196, 2288, 7941, 311, 19874, 198, 1220, 20897, 66, 384, 13, 578, 37374, 16180, 430, 19451, 11, 315, 3388, 13, 1102, 20682, 220, 279, 37374, 311, 198, 86299, 304, 6367, 627, 791, 37374, 374, 539, 264, 32403, 11, 433, 374, 264, 72287, 13, 1102, 374, 539, 21277, 11, 433, 374, 198, 37576, 72137, 13, 1628, 1202, 5915, 374, 539, 311, 61109, 499, 26, 1202, 5915, 374, 311, 7066, 198, 73254, 6366, 323, 27498, 499, 617, 3596, 3967, 11, 2737, 499, 627, 55065, 8636, 264, 28201, 4648, 11, 539, 1063, 4062, 49972, 27653, 719, 4856, 264, 198, 83, 371, 554, 430, 4024, 389, 369, 4207, 13, 220, 3161, 1475, 6596, 813, 16066, 7319, 627, 3947, 1436, 387, 912, 810, 36875, 2217, 315, 51215, 323, 653, 1800, 343, 520, 291, 54680, 198, 54895, 279, 30667, 315, 459, 25226, 893, 889, 1047, 9087, 1690, 323, 69525, 912, 198, 606, 627, 2181, 374, 539, 279, 8903, 315, 813, 4648, 1174, 719, 279, 7438, 315, 813, 4648, 11, 430, 374, 198, 2727, 519, 311, 21745, 603, 13, 8766, 919, 315, 1274, 7831, 912, 2753, 77104, 1174, 323, 912, 2753, 198, 359, 42000, 398, 1174, 389, 279, 9578, 3432, 662, 763, 49183, 279, 16066, 315, 10811, 11, 584, 1288, 198, 30380, 279, 16066, 315, 279, 1917, 13, 5414, 1984, 5828, 529, 259, 1054, 19182, 1174, 1427, 520, 198, 2727, 2029, 5414, 1984, 374, 1054, 19182, 1174, 1427, 520, 499, 49216, 8607, 1667, 4227, 358, 574, 279, 13015 ]
0xBreath/holistic-books
2007; 55:263-70. 39. Mohr SB, Garland CF, Gorham ED, Grant WB, Garland FC. Could ultraviolet B irradi-ance and vitamin D be associated with lower incidence rates of lung cancer? J Epidemiol Community Health 2008; 62:69-74. 40. Porojnicu AC, Lagunova Z, Robsahm TE, Berg JP, Dahlback A, Moan J. Changes in risk of death from breast cancer with season and latitude: Sun exposure and breast cancer survival in Norway. Breast Cancer Res T reat 2007; 102:323-8. 41. Mohr SB, Garland CF, Gorham ED, Grant WB, Garland FC. Is ultraviolet B irradiance inversely associated with incidence rates of endometrial cancer: an ecological study of 107 countries. Prev Med 2007; 45:327-31. 42. Garland CF, Mohr SB, Gorham ED, Grant WB, Garland FC. Role of ultraviolet B irradi-ance and vitamin D in prevention of ovarian cancer. Am J Prev Med 2006; 31:512-4. 43. Grant WB. An ecological study of cancer mortality rates including indices for dietary iron and zinc. Anticancer Res 2008; 28:1955-63. 44. Mohr SB, Gorham ED, Garland CF, Grant WB, Garland FC. Are low ultraviolet B and high animal protein intake associated with risk of renal cancer? Int J Cancer 2006; 119:2705-9. 45. Porojnicu AC, Robsahm TE, Ree AH, Moan J. Season of diagnosis is a prognostic factor in Hodgkin’s lymphoma: A possible role of sun-induced vitamin D. Br J Cancer 2005; 93:571-4. 46. Smedby KE, Hjalgrim H, Melbye M, T orrang A, Rostgaard K, Munksgaard L, et al. Ultraviolet radiation exposure and risk of malignant lymphomas. J Natl Cancer Inst 2005; 97:199-209. 47. Hu S, Ma F, Collado-Mesa F, Kirsner RS. Ultraviolet radiation and incidence of non-Hodgkin’s lymphoma among Hispanics in the United States. Cancer Epidemiol Biomarkers Prev 2004; 13:59-64. 48. Sasco AJ, Secretan MB, Straif K. T obacco smoking and cancer: A brief review of recent epidemiological evidence. Lung Cancer 2004; 45:3-9. 49. Armstrong B, Doll R. Environmental factors and cancer incidence and mortality in different countries, with special reference to dietary practices. Int J Cancer 1975; 15:617-31. 50. Grant WB. A multicountry ecologic study of risk and risk reduction factors for prostate cancer mortality. Eur Urol 2004; 45:271-9. 51. Brot C, Jorgensen NR, Sorensen OH. The influence of smoking on vitamin D status and calcium metabolism. Eur J Clin Nutr 1999; 53:920-6.risk of developing many types of cancer and increases survival once cancer reaches the detectable stage. Unfortunately, health policy often lags scientific discoveries by years to decades. An example from the mid-19 th century was the discovery by Ignaz Semmelweis that doctors carried germs from autopsies to women giving birth and infected them, resulting in puerperal sepsis. 125 A more recent example is the announcement by Barry Marshall and Robin Warren that Helicobacter pylori caused stomach ulcers. Although Marshall infected himself with H. pylori in 1981 and developed an ulcer, 126 he concluded by 1995 that Koch’s postulates were not well satisfied.127 However, in 2005, Marshall and Warren were awarded the Nobel Prize in Medicine. It is hoped that the acceptance of the beneficial role of vitamin D in reducing the risk of cancer and many other diseases will not have to wait much longer. It is encouraging that the National Academy of Sciences’ Institute of Medicine (http://www.iom.edu) is embarking on a two year study of vitamin D dietary requirements and is expected to issue a report in October 2010. Acknowledgements W.B.G receives funding from the UV Foundation (McLean, VA), the Vitamin D Society (Canada), and the European Sunlight Association (Brussels). References 1. Garland CF, Garland FC. Do sunlight and vitamin D reduce the likelihood of colon cancer? Int J Epidemiol 1980; 9:227-31. 2. Garland C, Shekelle RB, Barrett-Connor E, Criqui MH, Rossof AH, Paul O. Dietary vitamin D and calcium and risk of colorectal cancer: A 19-year prospective study in men. Lancet 1985; 1:307-9. 3. Garland CF, Comstock GW, Garland FC, Helsing KJ, Shaw EK, Gorham ED. Serum 25-hydroxyvitamin D and colon cancer: Eight-year prospective study. Lancet 1989; 2:1176-8. 4. Garland FC, Garland CF, Gorham ED, Young JF. Geographic variation in breast cancer mortality in the United States: A hypothesis involving exposure to solar radiation. Prev Med 1990; 19:614-22. 5. Lefkowitz ES, Garland CF. Sunlight, vitamin D and ovarian cancer mortality rates in US women. Int J Epidemiol 1994; 23:1133-6. 6. Schwartz GG, Hulka BS. Is vitamin D deficiency a risk factor for prostate cancer? (Hypothesis). Anticancer Res 1990; 10:1307-11. 7. Devesa SS, Grauman DJ, Blot WJ, Pennello GA, Hoover RN, Fraumeni JFJ. Atlas of Cancer Mortality in the United States, 1950–94. NIH Publication No 99-4564: National Institute of Health 1999. 8. Leffell DJ, Brash DE. Sunlight and skin cancer. Sci Am 1996; 275:52-3. 9. Grant WB. An ecologic study of dietary and solar ultraviolet-B links to breast carcinoma mortality rates. Cancer 2002; 94:272-81. 10. Grant WB, Garland CF. The association of solar ultraviolet B (UVB) with reducing risk of cancer: multifactorial ecologic analysis of geographic variation in age-adjusted cancer mortality rates. Anticancer Res 2006; 26:2687-99. 11. Hypponen E, Power C. Hypovitaminosis D in British adults at age 45 y: Nationwide cohort study of dietary and lifestyle predictors. Am J Clin Nutr 2007; 85:860-8. 12. Lappe JM, T ravers-Gustafson D, Davies KM, Recker RR, Heaney RP. Vitamin D and cal-cium supplementation reduces cancer risk: Results of a randomized trial. Am J Clin Nutr 2007; 85:1586-91. 13. Porojnicu AC, Dahlback A, Moan J. Sun exposure and cancer survival in Norway: changes in the risk of death with season of diagnosis and latitude. Adv Exp Med Biol 2008; 624:43-54. 14. Koch R. Classics in infectious diseases. The etiology of tuberculosis: Robert Koch. Berlin, Germany 1882. Rev Infect Dis 1982; 4:1270-4. 15. Hill AB. The environment and disease: Association or causation? Proc R Soc Med 1965; 58:295-300. 16. Potischman N, Weed DL. Causal criteria in nutritional epidemiology. Am J Clin Nutr 1999; 69:1309-14. 17. Weed DL. Epidemiologic evidence and causal inference. Hematol Oncol Clin North Am 2000; 14:797-807. 18. Grant WB, Garland CF. A critical review of studies on vitamin D in relation to colorectal cancer. Nutr Cancer 2004; 48:115-23. 19. Jackson RD, LaCroix AZ, Gass M, Wallace RB, Robbins J, Lewis CE, Bassford T, et al. Calcium plus vitamin D supplementation and the risk of fractures. N Engl J Med 2006; 354:669-83. 20. Wactawski-Wende J, Kotchen JM, Anderson GL, Assaf AR, Brunner RL, O’Sullivan MJ, et al. Calcium plus vitamin D supplementation and the risk of colorectal cancer. N Engl J Med 2006; 354:684-96. www.landesbioscience.com Dermato-Endocrinology 23Vitamin D and cancer: Causality? 82. Langford IH, Bentham G, McDonald AL. Mortality from non-Hodgkin lymphoma and UV exposure in the European Community. Health Place 1998; 4:355-64. 83. Zhou W, Heist RS, Liu G, Asomaning K, Neuberg DS, Hollis BW, et al. Circulating 25-hydroxyvitamin D levels predict survival in early-stage non-small-cell lung cancer patients. J Clin Oncol
[ 220, 1049, 22, 26, 220, 2131, 25, 15666, 12, 2031, 627, 220, 2137, 13, 20409, 81, 26313, 11, 80074, 21459, 1174, 47247, 5721, 16421, 11, 24668, 53603, 11, 80074, 16396, 13, 16910, 37232, 85311, 426, 76327, 12, 685, 323, 28170, 423, 387, 5938, 449, 4827, 39775, 7969, 315, 21271, 9572, 30, 622, 88953, 337, 12332, 6401, 220, 1049, 23, 26, 220, 5538, 25, 3076, 12, 5728, 627, 220, 1272, 13, 393, 18812, 73, 11851, 84, 10807, 11, 33471, 359, 12949, 1901, 11, 4997, 102712, 76, 18793, 11, 31782, 49880, 1174, 87967, 1445, 362, 11, 6178, 276, 622, 13, 29240, 304, 5326, 315, 4648, 505, 17659, 9572, 449, 3280, 323, 21518, 25, 8219, 14675, 323, 17659, 9572, 20237, 304, 32603, 13, 57598, 26211, 1838, 350, 312, 266, 220, 1049, 22, 26, 220, 4278, 25, 15726, 12, 23, 627, 220, 3174, 13, 20409, 81, 26313, 11, 80074, 21459, 1174, 47247, 5721, 16421, 11, 24668, 53603, 11, 80074, 16396, 13, 2209, 37232, 85311, 426, 76327, 685, 65683, 989, 5938, 449, 39775, 7969, 315, 842, 4512, 6757, 9572, 25, 459, 50953, 4007, 315, 220, 7699, 5961, 13, 60101, 3344, 220, 1049, 22, 26, 220, 1774, 25, 13817, 12, 2148, 627, 220, 2983, 13, 80074, 21459, 1174, 20409, 81, 26313, 11, 47247, 5721, 16421, 11, 24668, 53603, 11, 80074, 16396, 13, 15766, 315, 37232, 85311, 426, 76327, 12, 685, 323, 28170, 423, 304, 27344, 315, 85542, 9572, 13, 3383, 622, 60101, 3344, 220, 1049, 21, 26, 220, 2148, 25, 8358, 12, 19, 627, 220, 3391, 13, 24668, 53603, 13, 1556, 50953, 4007, 315, 9572, 29528, 7969, 2737, 15285, 369, 34625, 11245, 323, 49601, 13, 6898, 292, 11967, 1838, 220, 1049, 23, 26, 220, 1591, 25, 6280, 20, 12, 5495, 627, 220, 2096, 13, 20409, 81, 26313, 11, 47247, 5721, 16421, 11, 80074, 21459, 1174, 24668, 53603, 11, 80074, 16396, 13, 8886, 3428, 37232, 85311, 426, 323, 1579, 10065, 13128, 23730, 5938, 449, 5326, 315, 63915, 9572, 30, 1357, 622, 26211, 220, 1049, 21, 26, 220, 9079, 25, 10914, 20, 12, 24, 627, 220, 1774, 13, 393, 18812, 73, 11851, 84, 10807, 11, 4997, 102712, 76, 18793, 11, 57921, 48388, 11, 6178, 276, 622, 13, 14598, 315, 23842, 374, 264, 63903, 537, 292, 8331, 304, 83984, 8148, 753, 43745, 7942, 25, 362, 3284, 3560, 315, 7160, 38973, 28170, 423, 13, 3320, 622, 26211, 220, 1049, 20, 26, 220, 6365, 25, 22005, 12, 19, 627, 220, 2790, 13, 328, 2106, 1729, 11337, 11, 473, 48792, 87197, 473, 11, 11220, 29474, 386, 11, 350, 477, 93683, 362, 11, 432, 537, 95589, 735, 11, 386, 3200, 2034, 64, 569, 445, 11, 1880, 453, 13, 67957, 85311, 25407, 14675, 323, 5326, 315, 94329, 43745, 23063, 13, 622, 24772, 75, 26211, 6112, 220, 1049, 20, 26, 720, 3534, 25, 2550, 12, 12652, 627, 220, 2618, 13, 22546, 328, 11, 11583, 435, 1174, 13201, 2172, 5364, 23174, 435, 1174, 735, 17260, 1215, 24107, 13, 67957, 85311, 25407, 323, 39775, 315, 2536, 11529, 347, 70, 8148, 753, 43745, 7942, 4315, 84932, 304, 279, 3723, 4273, 13, 26211, 88953, 337, 91608, 91141, 60101, 220, 1049, 19, 26, 220, 1032, 25, 2946, 12, 1227, 627, 220, 2166, 13, 62189, 1030, 34050, 11, 8769, 276, 13642, 11, 27745, 333, 735, 13, 350, 1536, 20067, 20149, 323, 9572, 25, 362, 10015, 3477, 315, 3293, 62057, 5848, 6029, 13, 78336, 26211, 220, 1049, 19, 26, 220, 1774, 25, 18, 12, 24, 627, 220, 2491, 13, 45966, 426, 11, 39857, 432, 13, 25027, 9547, 323, 9572, 39775, 323, 29528, 304, 2204, 5961, 11, 449, 3361, 5905, 311, 34625, 12659, 13, 1357, 622, 26211, 220, 4468, 20, 26, 220, 868, 25, 21717, 12, 2148, 627, 220, 1135, 13, 24668, 53603, 13, 362, 92520, 5083, 12208, 39227, 4007, 315, 5326, 323, 5326, 14278, 9547, 369, 47447, 9572, 29528, 13, 85477, 549, 1098, 220, 1049, 19, 26, 220, 1774, 25, 15828, 12, 24, 627, 220, 3971, 13, 426, 4744, 356, 11, 622, 1813, 35117, 40395, 11, 328, 461, 4511, 268, 29822, 13, 578, 10383, 315, 20149, 389, 28170, 423, 2704, 323, 35719, 39097, 13, 85477, 622, 18905, 18878, 81, 220, 2550, 24, 26, 220, 4331, 25, 18485, 12, 21, 1783, 3267, 315, 11469, 1690, 4595, 315, 9572, 323, 12992, 20237, 3131, 720, 66, 11967, 25501, 279, 11388, 481, 6566, 13, 19173, 11, 2890, 4947, 3629, 326, 2076, 12624, 54098, 555, 1667, 311, 11026, 13, 1556, 3187, 505, 279, 5209, 12, 777, 198, 339, 9478, 574, 279, 18841, 555, 34881, 1394, 14582, 28226, 74969, 720, 9210, 16410, 11953, 17684, 1026, 505, 3154, 3806, 552, 311, 3278, 7231, 7342, 323, 29374, 1124, 11, 13239, 304, 281, 8977, 716, 278, 513, 1725, 285, 627, 6549, 362, 810, 3293, 720, 8858, 374, 279, 17480, 555, 31858, 30508, 323, 17582, 26713, 430, 16183, 292, 677, 2540, 35385, 13915, 9057, 23152, 8725, 17254, 13, 10541, 30508, 720, 13885, 1599, 5678, 449, 473, 13, 35385, 13915, 304, 220, 3753, 16, 323, 8040, 459, 96971, 345, 9390, 568, 720, 444, 10391, 555, 220, 2550, 20, 430, 40593, 753, 1772, 24031, 1051, 539, 1664, 20097, 13, 6804, 720, 11458, 11, 304, 220, 1049, 20, 11, 30508, 323, 26713, 1051, 22034, 279, 48078, 32293, 304, 19152, 13, 1102, 374, 26253, 430, 279, 26586, 315, 279, 24629, 3560, 315, 28170, 423, 304, 18189, 279, 5326, 315, 9572, 323, 1690, 1023, 19338, 690, 539, 617, 311, 3868, 1790, 5129, 13, 1102, 374, 26921, 430, 279, 5165, 16192, 315, 23199, 529, 10181, 315, 19152, 320, 1277, 1129, 2185, 8777, 316, 12871, 8, 374, 8126, 34552, 389, 264, 1403, 1060, 4007, 315, 28170, 423, 34625, 8670, 323, 374, 3685, 311, 4360, 264, 1934, 304, 6664, 220, 679, 15, 627, 91336, 84127, 198, 54, 662, 33, 1246, 21879, 11006, 505, 279, 30136, 5114, 320, 26353, 49862, 11, 720, 13114, 705, 279, 45774, 423, 13581, 320, 37031, 705, 323, 279, 7665, 8219, 4238, 10229, 320, 6971, 32964, 4390, 32812, 198, 220, 16, 13, 80074, 21459, 1174, 80074, 16396, 13, 3234, 40120, 323, 28170, 423, 8108, 279, 29736, 315, 15235, 9572, 30, 720, 1090, 622, 88953, 337, 220, 3753, 15, 26, 220, 24, 25, 14206, 12, 2148, 627, 220, 17, 13, 80074, 356, 11, 3005, 74, 6853, 29074, 11, 56859, 12, 57987, 469, 11, 92240, 47391, 46660, 11, 16870, 708, 69, 48388, 11, 7043, 507, 13, 83808, 28170, 423, 323, 35719, 323, 5326, 315, 79887, 95081, 9572, 25, 362, 220, 777, 4771, 33547, 4007, 304, 3026, 13, 39634, 295, 220, 3753, 20, 26, 220, 16, 25, 14777, 12, 24, 627, 220, 18, 13, 80074, 21459, 1174, 1219, 13787, 42353, 1174, 80074, 16396, 11, 473, 97688, 735, 41, 11, 36285, 123560, 11, 47247, 5721, 16421, 13, 94591, 220, 914, 2902, 68107, 4223, 55911, 8778, 423, 323, 15235, 9572, 25, 36944, 4771, 33547, 4007, 13, 39634, 295, 220, 3753, 24, 26, 220, 17, 25, 8546, 21, 12, 23, 627, 220, 19, 13, 80074, 16396, 11, 80074, 21459, 1174, 47247, 5721, 16421, 11, 13566, 622, 37, 662, 66542, 23851, 304, 17659, 9572, 29528, 304, 279, 3723, 4273, 25, 362, 31178, 16239, 14675, 311, 13238, 25407, 13, 60101, 3344, 220, 2550, 15, 26, 220, 777, 25, 22638, 12, 1313, 627, 220, 20, 13, 445, 830, 74, 53431, 19844, 11, 80074, 21459, 662, 8219, 4238, 11, 28170, 423, 323, 85542, 9572, 29528, 7969, 304, 2326, 3278, 13, 1357, 622, 88953, 337, 220, 2550, 19, 26, 220, 1419, 25, 8190, 18, 12, 21, 627, 220, 21, 13, 65885, 57798, 11, 473, 360, 4657, 28718, 13, 2209, 28170, 423, 48294, 264, 5326, 8331, 369, 47447, 9572, 30, 320, 39, 60400, 13491, 570, 6898, 292, 11967, 1838, 220, 2550, 15, 26, 220, 605, 25, 5894, 22, 12, 806, 627, 220, 22, 13, 1611, 2396, 64, 18679, 11, 40113, 7282, 22102, 11, 2563, 354, 468, 41, 11, 13813, 4896, 27438, 11, 73409, 46916, 11, 23534, 28999, 72, 622, 37, 41, 13, 43443, 315, 26211, 22806, 2786, 304, 279, 3723, 4273, 11, 220, 6280, 15, 4235, 6281, 13, 84370, 57994, 2360, 220, 1484, 12, 10961, 19, 25, 5165, 10181, 315, 6401, 220, 2550, 24, 627, 220, 23, 13, 2009, 544, 616, 22102, 11, 3320, 1003, 3467, 13, 8219, 4238, 323, 6930, 9572, 13, 41472, 3383, 220, 2550, 21, 26, 220, 14417, 25, 4103, 12, 18, 627, 220, 24, 13, 24668, 53603, 13, 1556, 12208, 39227, 4007, 315, 34625, 323, 13238, 37232, 85311, 7826, 7902, 311, 17659, 89468, 29528, 7969, 13, 26211, 220, 1049, 17, 26, 220, 6281, 25, 15741, 12, 5932, 627, 220, 605, 13, 24668, 53603, 11, 80074, 21459, 662, 578, 15360, 315, 13238, 37232, 85311, 426, 320, 23042, 33, 8, 449, 18189, 5326, 315, 9572, 25, 62387, 5739, 532, 12208, 39227, 6492, 315, 46139, 23851, 304, 4325, 60684, 291, 9572, 29528, 7969, 13, 6898, 292, 11967, 1838, 220, 1049, 21, 26, 220, 1627, 25, 16332, 22, 12, 1484, 627, 220, 806, 13, 10320, 604, 43028, 469, 11, 7572, 356, 13, 39515, 869, 76652, 10934, 423, 304, 8013, 12884, 520, 4325, 220, 1774, 379, 25, 90754, 41944, 4007, 315, 34625, 323, 19433, 95222, 13, 3383, 622, 18905, 18878, 81, 220, 1049, 22, 26, 220, 5313, 25, 18670, 12, 23, 627, 220, 717, 13, 445, 34531, 83152, 11, 350, 436, 22292, 12279, 592, 2642, 942, 423, 11, 56872, 56876, 11, 1050, 15512, 44498, 11, 1283, 82286, 42561, 662, 45774, 423, 323, 1652, 1824, 2411, 73796, 26338, 9572, 5326, 25, 18591, 315, 264, 47341, 9269, 13, 3383, 622, 18905, 18878, 81, 220, 1049, 22, 26, 220, 5313, 25, 11286, 21, 12, 5925, 627, 220, 1032, 13, 393, 18812, 73, 11851, 84, 10807, 11, 87967, 1445, 362, 11, 6178, 276, 622, 13, 8219, 14675, 323, 9572, 20237, 304, 32603, 25, 4442, 304, 279, 5326, 315, 4648, 449, 3280, 315, 23842, 323, 21518, 13, 12605, 7943, 3344, 81894, 220, 1049, 23, 26, 220, 23000, 25, 3391, 12, 4370, 627, 220, 975, 13, 40593, 432, 13, 73415, 304, 50600, 19338, 13, 578, 1880, 31226, 315, 88234, 25, 8563, 40593, 13, 20437, 11, 10057, 220, 9367, 17, 13, 10315, 88911, 4185, 220, 3753, 17, 26, 220, 19, 25, 6804, 15, 12, 19, 627, 220, 868, 13, 8270, 14469, 13, 578, 4676, 323, 8624, 25, 10229, 477, 25540, 367, 30, 42187, 432, 27670, 3344, 220, 5162, 20, 26, 220, 2970, 25, 16780, 12, 3101, 627, 220, 845, 13, 14020, 16438, 1543, 452, 11, 94409, 34075, 13, 356, 80174, 13186, 304, 43226, 62057, 2508, 13, 3383, 622, 18905, 18878, 81, 220, 2550, 24, 26, 220, 3076, 25, 5894, 24, 12, 975, 627, 220, 1114, 13, 94409, 34075, 13, 88953, 39227, 6029, 323, 59557, 45478, 13, 33924, 266, 337, 77854, 337, 18905, 4892, 3383, 220, 1049, 15, 26, 220, 975, 25, 25314, 12, 23178, 627, 220, 972, 13, 24668, 53603, 11, 80074, 21459, 662, 362, 9200, 3477, 315, 7978, 389, 28170, 423, 304, 12976, 311, 79887, 95081, 9572, 13, 18878, 81, 26211, 220, 1049, 19, 26, 220, 2166, 25, 7322, 12, 1419, 627, 220, 777, 13, 720, 62382, 39092, 11, 720, 8921, 96141, 953, 31976, 11, 480, 395, 386, 11, 39956, 29074, 11, 88315, 622, 11, 21256, 27809, 11, 37053, 8350, 350, 1174, 1880, 453, 13, 720, 48268, 2411, 5636, 28170, 423, 73796, 323, 279, 5326, 315, 78332, 13, 452, 99730, 622, 3344, 220, 1049, 21, 26, 720, 18384, 25, 25289, 12, 6069, 627, 220, 508, 13, 468, 533, 675, 33639, 13299, 11178, 622, 11, 62763, 7674, 83152, 11, 21293, 5705, 11, 2755, 2642, 6395, 11, 35561, 1215, 48596, 11, 507, 40702, 37141, 62045, 11, 720, 295, 453, 13, 96104, 5636, 28170, 423, 73796, 323, 279, 5326, 315, 79887, 95081, 9572, 13, 452, 99730, 622, 3344, 220, 1049, 21, 26, 220, 18384, 25, 24313, 12, 4161, 627, 2185, 929, 62452, 70728, 66, 1873, 916, 76508, 4428, 12, 3812, 91153, 2508, 220, 1419, 53, 76652, 423, 323, 9572, 25, 356, 12119, 2786, 5380, 220, 6086, 13, 23272, 8350, 46411, 11, 41614, 5721, 480, 11, 32014, 8927, 13, 22806, 2786, 505, 2536, 11529, 347, 70, 8148, 43745, 7942, 323, 720, 23042, 14675, 304, 279, 7665, 12332, 13, 6401, 11004, 220, 2550, 23, 26, 220, 19, 25, 17306, 12, 1227, 627, 220, 6069, 13, 67927, 468, 1174, 1283, 380, 24107, 11, 38805, 480, 11, 1666, 7053, 287, 735, 11, 4275, 392, 2431, 21223, 11, 25518, 285, 52220, 1174, 1880, 453, 13, 16741, 15853, 220, 914, 2902, 68107, 4223, 55911, 8778, 423, 5990, 7168, 20237, 304, 4216, 51256, 2536, 34859, 33001, 21271, 9572, 6978, 13, 622, 18905, 77854, 337, 220 ]
0xBreath/holistic-books
or a vitamin C deficiency, which begins to affect all of the vital organs and muscles. Many times there is soreness in the muscles, but it is generally travelling. It's in a joint for a day or two and then another joint and oftentimes for a day in th e big toe, indicating that it's gout, which it isn't really, it's just very annoying, and not a very serious problem unless this has continued for a long period of time. The long-er this condition exists the more apt it is to cause irregular menstrual cycles, and many times extremely heavy flows, or times in which the cycle lasts much longer. A hysterectomy will not solve the nervous problem and tiredness, but the deficiency can be corrected by correct-ing the diet. The reason for the mineral deficiency, the body is not assimilating enough variety of calciums because there is not the resistance between the acids and the alkalines. The body chemistry is out of ratio of one element to another. All foods that we eat are cationi c, with the exception of lemon. This is one reason why we recommend fresh lemon juice water or lemonade: it is nature's form of natural dilute hydrochloric acid, and the liver can take lemon juice when it is taken systematically, and in not too large amounts, and convert it into enzymes with less chemical change than any other natural substance known to man. Then the body begins to take on more calciums and corrects these conditions. The next best substance to use woul d be a man-made substance: hydro- chloric acid tablets. 129 If the mineral deficiency condition has existed a long time, a per- son will need both the lemonade and the tablets. Some people are allergic to lemon juice. Those allergic cannot urinate, it stops the kidneys from letting the water pass out into the urinary tract. Also, if one has ulcers it bums the stomach so badly the person cannot stand the burning, then they must be taken off of the lemon and given freshly squeezed cabbage juice three or four times a day (this must be used within 20 mi nutes from the time it is squeezed), the amounts regulated by the tester, and this will heal any ulcer. I have never seen anyone allergic to cabbage juice that had ulcers. After the ulcers are under control, six weeks to three months, then the person can start on the lemonade and it will rebuild the liver and almost make them look like they have had a bath in the fountain of youth. The D range is a more serious range than the B range because the body is extremely too acid, causing extreme nervousness, abnormal fear, and except for the grace of God, almost a maniac. One would have the same problems as in the other ranges but more exaggerated than in the A and B range. An example in the D range could read: ͨ.ͱ ͭ.Ͱͨ ͭ.ͪͨ ͯ ͭ This condition is one that extremely upsets the nerves. The num- bers indicate a potassium deficiency. The message is not going through from the brain to the vital organs, and it's almost impossible to work. Such a person has an idea that everyone is against them-there's a chip on their shoulder, and they are sick, and yet they don't look sick. They can also be anemic, and if this were a woman, from puberty to age 60, could be very deep in menopause with this number combination. The suffering is extreme because the nerves exaggerate the condition. THE LOWER THE CALCIUMS, THE GREATER THE FEAR. The numbers show: 130 • advanced delta cells in the vagina, uterus, ovary area, and in both breasts • a high emphysema in both lungs • a cystitic condition • the kidneys are not functioning normally because the liver is not manufacturing enough enzymes to maintain the energy needed to re-store the energy used each day. • have to drive themselves to do everything that they do. It would be unsafe for this person to drive a car because the blood sugar is so low, and this can cause as many accidents as people who are intoxicated by alcohol while driving. It slows down their emotions. They may temporarily black out, and don't know it until it's too late. ONE OF THE REQUIREMENTS IN OUR DRIVER'S LICENSE TESTS SHOULD INCLUDE WHETHER OR NOT THE PERSON HAS LOW BLOOD SUGAR. Urinary tests are more accurate th an the blood test on low blood sugar because the urinary carbohydrate reading equals the blood chemistry readings over any 24-hour period. These RBTI test numbers are not easily interpreted. This book is written to educate the public to the place that they will go to someone who has trained at the seminars in the Reams Biological Theory of Ionization. Some of the testers are so steeped in fads until it takes two or three years to de-fad them, but don't hold that against them. I would rather trust my life to the poorest tester in th e field than to trust my life to the use of chemotherapy cobalt or radiation. 131 CHAPTER 18 RBTI AND PASTORAL COUNSELING Many calls have come from pastors begging, "Please do some- thing to help me. I do not know enough about the health message to teach my people how to be healthy. I ha ve just lost with a heart attack one of the finest members of the church, and a very heavy financial supporter, in his thirties. He is a great loss to the church and to God's work." A Baptist pastor in Florida said, "Please, do something to help us. I have just lost one of the fine supporters of our church, only 45 years old with cancer. He had cancer for two years and the cobalt seemed to hasten his death. It breaks my heart to see that. When he was told he had cancer he asked me as his pastor what I thought about it, and I agreed that he should do what the doctors said. Now since we have been enlightened on the dangers of chemotherapy, radiation and cobalt and know it has hastened his death, his wife has left the church. She pointed her finger at my nose and said, 'If you would have counselled us correctly, my husband would be living today.' Reams, you've got to help us." We are establishing in the very near future seminars to teach pastors how to counsel their congregations on health. We are not go-ing to tell them not to have cobalt, radiation or chemotherapy, but we are going to teach them God's way to being healthy. The use of drugs is something for the doctor to convince the people, and not the pastor. Ministers need to be taught in the seminaries the Bible health mes-sage. Pastors are demanding us to feed them the health message in the Bible. We are not going to give them the same teaching we teach the doctors, chiropractors and other testers and counselors. We will teach them to counsel their people, of all ages, in regard to their health, as given in the Word of God. Many ministers today are deeply concerned because of the many divorces among the young, and even senior citizens. Many times di-vorces are brought about because the calciums are too low in the sys-132 tem and the individuals are a nervous wreck. Husbands and wives are at each other's throat from morning to night. They love each other and each one is fighting for his or her life, but they have no one to tell them what to do to correct these calciums deficiencies. Ministers are not to tell the people which calciums to use but they will be informed on doctors trained in this field to which they can send their parishion-ers for help. And this will prevent many, many divorces. In 1972 at 11 o'clock one Sunday night my doorbell rang. It was the pastor of our church in a small c ity in Florida. "My wife is having a heart attack and is almost unconscious. Please help me quickly," he begged. I got my bathrobe and bedroom slippers on and went with him to the car. His wife was a rather large woman. There was no way at this time that any tests could be made, but I quickly examined her hands and feet and found that they were cold, and by this I determined that it was not a heart attack, however, she was having some severe chest pains, the heart had lost its rhythm, and had dropped down into the lower 40's. The nearest hospital was 15 miles away and I was afraid that she would not last to get to the hospital, so I made up an ordinary drink for the purpose of relieving gas on the stomach and told her to sip it slow-ly for 30 minutes. Within 10 minutes the gas began to burp out of her system. In a half hour she had perfect relief, the heart rhythm was back to normal, her feet and hands warmed up, and she felt as if she had never been sick. I asked them to come to the lab and I tested her to see what caused the attack of acute indigestion. Her calciums were very, very low, which is one of the causes of acute indigestion. I said to the husband, "You need a test also because there may be a problem here that involves both of you." She was in her mid-thirties, and in menopause, and he was 38. His test indicated very low calci-ums also. The reason I thought he would have low calciums was that the wife did the cooking and if she was low
[ 720, 269, 264, 28170, 356, 48294, 11, 902, 12302, 311, 7958, 682, 315, 279, 16595, 36853, 323, 24569, 13, 9176, 3115, 1070, 374, 36366, 2136, 304, 279, 24569, 11, 719, 433, 374, 8965, 31829, 13, 1102, 596, 304, 264, 10496, 369, 264, 1938, 477, 1403, 323, 1243, 2500, 10496, 323, 43146, 92455, 369, 264, 1938, 304, 270, 384, 2466, 31316, 11, 19392, 430, 433, 596, 342, 412, 11, 720, 8370, 433, 4536, 956, 2216, 11, 433, 596, 1120, 1633, 30931, 11, 323, 539, 264, 1633, 6129, 3575, 7389, 420, 706, 8738, 369, 264, 1317, 4261, 315, 892, 13, 578, 1317, 12, 261, 420, 3044, 6866, 279, 810, 20697, 433, 374, 311, 5353, 42408, 78727, 25492, 11, 323, 1690, 3115, 9193, 8987, 28555, 11, 477, 3115, 304, 902, 279, 11008, 40758, 1790, 5129, 13, 362, 54119, 72783, 690, 539, 11886, 279, 23418, 3575, 323, 19781, 2136, 11, 719, 279, 48294, 649, 387, 37065, 555, 4495, 85005, 279, 10173, 13, 720, 791, 2944, 369, 279, 25107, 48294, 11, 279, 2547, 374, 539, 40054, 321, 1113, 720, 268, 1409, 8205, 315, 35719, 82, 1606, 1070, 374, 539, 279, 13957, 1990, 279, 33969, 323, 279, 66787, 1572, 13, 578, 2547, 30903, 374, 704, 315, 11595, 315, 832, 2449, 311, 2500, 13, 720, 2460, 15657, 430, 584, 8343, 527, 272, 367, 72, 272, 11, 449, 279, 4788, 315, 30564, 13, 720, 2028, 374, 832, 2944, 3249, 584, 7079, 7878, 30564, 23661, 3090, 477, 30564, 1037, 25, 433, 374, 7138, 596, 1376, 315, 5933, 19371, 1088, 17055, 72967, 292, 13935, 11, 323, 279, 26587, 649, 1935, 30564, 23661, 994, 433, 374, 4529, 60826, 11, 323, 304, 539, 2288, 3544, 15055, 11, 323, 5625, 433, 1139, 56067, 449, 2753, 11742, 2349, 1109, 904, 1023, 5933, 20278, 3967, 311, 893, 13, 5112, 279, 2547, 12302, 311, 1935, 389, 810, 35719, 82, 323, 4495, 82, 1521, 4787, 13, 578, 1828, 1888, 20278, 311, 1005, 289, 11206, 294, 387, 264, 893, 27975, 20278, 25, 17055, 7058, 72967, 292, 13935, 29679, 13, 220, 9748, 1442, 279, 25107, 48294, 3044, 706, 25281, 264, 1317, 892, 11, 264, 824, 7058, 942, 690, 1205, 2225, 279, 30564, 1037, 323, 279, 29679, 13, 720, 8538, 1274, 527, 57596, 311, 30564, 23661, 13, 13266, 57596, 4250, 720, 324, 3357, 11, 433, 18417, 279, 81960, 505, 20806, 279, 3090, 1522, 704, 1139, 279, 72735, 42929, 13, 7429, 11, 422, 832, 706, 8725, 17254, 433, 293, 6370, 279, 23152, 779, 25587, 279, 1732, 4250, 2559, 279, 20252, 11, 1243, 814, 2011, 387, 4529, 1022, 315, 279, 30564, 323, 2728, 50999, 65262, 74873, 23661, 2380, 477, 3116, 3115, 264, 1938, 320, 576, 2011, 387, 1511, 2949, 220, 508, 9686, 308, 2142, 505, 279, 892, 433, 374, 65262, 705, 720, 1820, 15055, 35319, 555, 279, 38211, 11, 323, 420, 690, 27661, 904, 96971, 13, 358, 617, 2646, 3970, 5606, 57596, 311, 74873, 23661, 430, 1047, 8725, 17254, 13, 4740, 279, 8725, 17254, 527, 1234, 2585, 11, 4848, 5672, 311, 2380, 4038, 11, 1243, 279, 1732, 649, 1212, 389, 279, 30564, 1037, 323, 433, 690, 32593, 279, 26587, 323, 4661, 1304, 1124, 1427, 1093, 814, 617, 1047, 264, 9061, 304, 279, 57713, 315, 12822, 13, 720, 791, 423, 2134, 374, 264, 810, 6129, 2134, 1109, 279, 426, 2134, 1606, 279, 720, 2664, 374, 9193, 2288, 13935, 11, 14718, 14560, 23418, 2136, 11, 35663, 8850, 11, 323, 3734, 369, 279, 21507, 315, 4359, 11, 4661, 264, 893, 18029, 13, 3861, 1053, 617, 279, 1890, 5435, 439, 304, 279, 1023, 21986, 719, 810, 62258, 1109, 304, 279, 362, 323, 426, 2134, 13, 720, 2127, 3187, 304, 279, 423, 2134, 1436, 1373, 25, 2355, 137, 101, 13, 137, 109, 465, 197, 137, 255, 13, 137, 108, 137, 101, 198, 137, 255, 13, 137, 103, 137, 101, 198, 137, 107, 198, 137, 255, 33006, 2028, 3044, 374, 832, 430, 9193, 709, 5022, 279, 50581, 13, 578, 1661, 7058, 1941, 13519, 264, 62275, 48294, 13, 578, 1984, 374, 539, 2133, 720, 20322, 505, 279, 8271, 311, 279, 16595, 36853, 11, 323, 433, 596, 4661, 12266, 311, 990, 13, 15483, 264, 1732, 706, 459, 4623, 430, 5127, 374, 2403, 1124, 7716, 486, 596, 264, 16797, 389, 872, 17308, 11, 323, 814, 527, 14363, 11, 323, 3686, 814, 1541, 956, 1427, 14363, 13, 2435, 649, 1101, 387, 459, 8274, 11, 323, 422, 420, 1051, 264, 5333, 11, 505, 87398, 311, 4325, 220, 1399, 11, 1436, 387, 1633, 5655, 304, 3026, 84110, 449, 420, 1396, 10824, 13, 578, 16066, 374, 14560, 1606, 279, 50581, 39030, 349, 279, 3044, 13, 3247, 86557, 3247, 34007, 11487, 2864, 50, 11, 3247, 62996, 19706, 3247, 435, 21176, 13, 720, 791, 5219, 1501, 25, 220, 5894, 7436, 11084, 9665, 7917, 304, 279, 39888, 11, 85656, 11, 25568, 661, 3158, 11, 323, 304, 2225, 720, 21152, 12019, 720, 6806, 264, 1579, 991, 12989, 325, 1764, 304, 2225, 45274, 7436, 264, 63581, 49086, 3044, 7436, 279, 81960, 527, 539, 31301, 14614, 1606, 279, 26587, 374, 539, 720, 98550, 1711, 3403, 56067, 311, 10519, 279, 4907, 4460, 311, 312, 34352, 279, 4907, 1511, 1855, 1938, 13, 720, 6806, 617, 311, 6678, 5694, 311, 656, 4395, 430, 814, 656, 13, 1102, 1053, 387, 20451, 369, 420, 1732, 311, 6678, 264, 1841, 1606, 279, 6680, 720, 82, 8734, 374, 779, 3428, 11, 323, 420, 649, 5353, 439, 1690, 33788, 439, 1274, 889, 527, 87523, 555, 13200, 1418, 10043, 13, 1102, 70270, 1523, 872, 21958, 13, 2435, 1253, 28191, 3776, 704, 11, 323, 1541, 956, 1440, 433, 3156, 433, 596, 2288, 3389, 13, 720, 5338, 3083, 3247, 29072, 29863, 2006, 46013, 49829, 13575, 12367, 720, 10238, 50, 61975, 51493, 18114, 2794, 4276, 3247, 57477, 36848, 41605, 426, 90731, 328, 3014, 946, 13, 720, 55615, 3367, 7177, 527, 810, 13687, 270, 459, 279, 6680, 1296, 389, 3428, 6680, 720, 82, 8734, 1606, 279, 72735, 67732, 5403, 17239, 279, 6680, 30903, 40174, 927, 904, 220, 1187, 21925, 4261, 13, 720, 9673, 432, 18066, 40, 1296, 5219, 527, 539, 6847, 33398, 13, 1115, 2363, 374, 720, 26650, 311, 39170, 279, 586, 311, 279, 2035, 430, 814, 690, 733, 311, 4423, 889, 706, 16572, 520, 279, 68569, 304, 279, 1050, 4214, 63711, 31535, 315, 45905, 2065, 13, 720, 8538, 315, 279, 90819, 527, 779, 32366, 291, 304, 282, 7819, 3156, 433, 5097, 1403, 477, 2380, 720, 42820, 311, 409, 2269, 329, 1124, 11, 719, 1541, 956, 3412, 430, 2403, 1124, 13, 358, 1053, 4856, 7095, 856, 2324, 311, 279, 68751, 38211, 304, 270, 384, 2115, 1109, 311, 7095, 856, 2324, 311, 279, 720, 817, 315, 62730, 34928, 3223, 477, 25407, 13, 256, 220, 9263, 96424, 220, 972, 720, 49, 18066, 40, 3651, 393, 6483, 878, 984, 356, 5152, 30465, 1753, 33006, 8607, 6880, 617, 2586, 505, 92420, 60206, 11, 330, 5618, 656, 1063, 7058, 1626, 311, 1520, 757, 13, 358, 656, 539, 1440, 3403, 922, 279, 2890, 1984, 311, 4639, 856, 1274, 1268, 311, 387, 9498, 13, 358, 6520, 5320, 1120, 5675, 449, 264, 4851, 3440, 720, 606, 315, 279, 28807, 3697, 315, 279, 8993, 11, 323, 264, 1633, 8987, 6020, 37563, 11, 304, 813, 270, 2154, 552, 13, 1283, 374, 264, 2294, 4814, 311, 279, 8993, 323, 311, 4359, 596, 990, 1210, 720, 32, 43748, 44044, 304, 9784, 1071, 11, 330, 5618, 11, 656, 2555, 311, 1520, 603, 13, 720, 40, 617, 1120, 5675, 832, 315, 279, 7060, 15879, 315, 1057, 8993, 11, 1193, 220, 1774, 1667, 2362, 449, 9572, 13, 1283, 1047, 9572, 369, 1403, 1667, 323, 279, 34928, 3223, 9508, 311, 34143, 268, 813, 4648, 13, 1102, 18808, 856, 4851, 311, 1518, 430, 13, 3277, 568, 574, 3309, 568, 1047, 9572, 568, 4691, 757, 439, 813, 44044, 1148, 358, 3463, 922, 433, 11, 323, 358, 7378, 430, 568, 1288, 656, 1148, 279, 16410, 1071, 13, 4800, 2533, 584, 617, 1027, 82315, 389, 279, 37064, 315, 62730, 11, 25407, 323, 34928, 3223, 323, 1440, 433, 706, 34143, 6901, 813, 4648, 11, 813, 7555, 706, 2163, 279, 8993, 13, 3005, 14618, 1077, 14654, 520, 856, 19689, 323, 1071, 11, 364, 2746, 499, 1053, 617, 16467, 839, 720, 355, 12722, 11, 856, 10177, 1053, 387, 5496, 3432, 3238, 1050, 4214, 11, 499, 3077, 2751, 311, 1520, 603, 1210, 1226, 527, 31692, 304, 279, 1633, 3221, 3938, 68569, 311, 4639, 92420, 1268, 311, 16467, 872, 77415, 811, 389, 2890, 13, 1226, 527, 539, 733, 85005, 311, 3371, 1124, 539, 311, 617, 34928, 3223, 11, 25407, 477, 62730, 11, 719, 584, 527, 2133, 311, 4639, 1124, 4359, 596, 1648, 311, 1694, 9498, 13, 578, 1005, 315, 11217, 374, 2555, 369, 279, 10896, 311, 28008, 279, 1274, 11, 323, 539, 279, 44044, 13, 79073, 1205, 311, 387, 15972, 304, 279, 5347, 258, 5548, 279, 17377, 2890, 11083, 1355, 425, 13, 720, 51213, 1105, 527, 26192, 603, 311, 5510, 1124, 279, 2890, 1984, 304, 279, 720, 33, 1260, 13, 1226, 527, 539, 2133, 311, 3041, 1124, 279, 1890, 12917, 584, 4639, 279, 16410, 11, 77301, 21846, 323, 1023, 90819, 323, 86347, 13, 1226, 690, 4639, 1124, 311, 16467, 872, 1274, 11, 315, 682, 17051, 11, 304, 5363, 311, 872, 2890, 11, 439, 720, 43068, 304, 279, 9506, 315, 4359, 13, 720, 8607, 35050, 3432, 527, 17693, 11920, 1606, 315, 279, 1690, 720, 614, 269, 1634, 4315, 279, 3995, 11, 323, 1524, 10195, 10495, 13, 9176, 3115, 1891, 8437, 269, 1634, 527, 7263, 922, 1606, 279, 35719, 82, 527, 2288, 3428, 304, 279, 5826, 12, 9413, 1592, 323, 279, 7931, 527, 264, 23418, 36850, 13, 473, 25337, 2914, 323, 39720, 527, 720, 266, 1855, 1023, 596, 28691, 505, 6693, 311, 3814, 13, 2435, 3021, 1855, 1023, 323, 720, 9739, 832, 374, 11039, 369, 813, 477, 1077, 2324, 11, 719, 814, 617, 912, 832, 311, 3371, 1124, 1148, 311, 656, 311, 4495, 1521, 35719, 82, 72946, 13, 79073, 527, 539, 311, 3371, 279, 1274, 902, 35719, 82, 311, 1005, 719, 814, 690, 387, 16369, 389, 16410, 16572, 304, 420, 2115, 311, 902, 814, 649, 3708, 872, 52297, 290, 12, 388, 369, 1520, 13, 1628, 420, 690, 5471, 1690, 11, 1690, 41079, 1634, 13, 720, 644, 220, 4468, 17, 520, 220, 806, 297, 63510, 832, 7418, 3814, 856, 6134, 17696, 43200, 13, 1102, 574, 720, 1820, 44044, 315, 1057, 8993, 304, 264, 2678, 272, 433, 88, 304, 9784, 13, 330, 5159, 7555, 374, 3515, 720, 64, 4851, 3440, 323, 374, 4661, 40711, 13, 5321, 1520, 757, 6288, 1359, 568, 80392, 13, 358, 2751, 856, 9061, 33936, 323, 14150, 1776, 32997, 389, 323, 4024, 449, 1461, 311, 279, 1841, 13, 720, 16366, 7555, 574, 264, 4856, 3544, 5333, 13, 2684, 574, 912, 1648, 520, 420, 892, 720, 9210, 904, 7177, 1436, 387, 1903, 11, 719, 358, 6288, 25078, 1077, 6206, 323, 7693, 323, 1766, 430, 814, 1051, 9439, 11, 323, 555, 420, 358, 11075, 430, 433, 574, 539, 264, 4851, 3440, 11, 4869, 11, 1364, 574, 3515, 1063, 15748, 15489, 51266, 11, 279, 4851, 1047, 5675, 1202, 37390, 11, 323, 1047, 12504, 1523, 1139, 279, 4827, 220, 1272, 596, 13, 578, 24379, 8952, 574, 220, 868, 8931, 3201, 323, 358, 574, 16984, 430, 1364, 1053, 539, 1566, 311, 636, 311, 279, 8952, 11, 779, 358, 1903, 709, 459, 19664, 7172, 369, 279, 7580, 315, 59644, 4504, 6962, 389, 279, 23152, 323, 3309, 1077, 311, 47715, 433, 6435, 12, 398, 369, 220, 966, 4520, 13, 25218, 220, 605, 4520, 279, 6962, 6137, 311, 7951, 79, 704, 315, 1077, 1887, 13, 763, 264, 4376, 6596, 1364, 1047, 4832, 16337, 11, 279, 4851, 37390, 574, 1203, 311, 4725, 11, 1077, 7693, 323, 6206, 82830, 709, 11, 323, 1364, 6612, 439, 422, 1364, 720, 32345, 2646, 1027, 14363, 13, 358, 4691, 1124, 311, 2586, 311, 279, 10278, 323, 358, 12793, 1077, 311, 1518, 1148, 9057, 279, 3440, 315, 30883, 1280, 15505, 290, 13, 6385, 35719, 82, 1051, 1633, 11, 1633, 3428, 11, 902, 374, 832, 315, 279, 11384, 315, 30883, 1280, 15505, 290, 13, 720, 40, 1071, 311, 279, 10177, 11, 330, 2675, 1205, 264, 1296, 1101, 1606, 1070, 1253, 387, 264, 720, 35686, 1618, 430, 18065, 2225, 315, 499, 1210, 3005, 574, 304, 1077, 5209, 7716, 2154, 552, 11, 720, 438, 304, 3026, 84110, 11, 323, 568, 574, 220, 1987, 13, 5414, 1296, 16717, 1633, 3428, 1652, 5979, 12, 6370, 1101, 13, 578, 2944, 358, 3463, 568, 1053, 617, 3428, 35719, 82, 574, 430, 279, 7555, 1550, 279, 17677, 323, 422, 1364, 574, 3428 ]
0xBreath/holistic-books
rowing up. He’ s alw ays in the now. W e ca n learn much from God’ s crea tures about enjoying the present moment rather than using it up consumed with guilt over the past or worry about the future. Practice living in the moment, and refuse to allow any thoughts based on your past to define you. Stop and take notice of all that’ s in your immediate space—th e people, creatures, vegeta tion, cloud formations, building designs, every thing. Stay in the present by meditating and getting closer to the ultimate now … God. God Is Only Here Now Think ab out this. God will not be doing anything dif ferent one hour from now than God i s doing now. An d God is not doing anything dif ferent now from what God was doing a tho usand years ago. The truth is that you can only com e to know God if you’re willing to be at peace in the present moment.In th e Fourth S ecret, I discussed how meditation is a way o f making conscious conta ct with God. He re, I would like to let you in on a sublime secret that I learned from one of my most influential teachers: Y ou will only come to truly know God when you give up the past and the fu tur e in your mind and mer ge totally into the now, because God is always her e now. V ery few people understand and live this principle, lar gely because of their conditioning and unwilling ness to train their minds in present-moment living. That’ s one of the reasons why I sometimes say that “it’ s never crowded along the extra mile.” On the extra mile, choosing inner peace and attracting success into your life while living in the present moment becomes a wa y of being. Y ou can begin by releasing your personal histor y from your repertoire of available excuses for why you’re not living in peace. No Longer Relying on Y our Personal History Make an ef fort to remove all labels that you’ve placed on yourself. Labels serve to negate you. Y ou must ultimately live up to the label rather than being the limitless spirit that is your true essence. Y ou’re not an American, an Italian, or an African. Y ou’re a member of one race, the human race. Y ou’re not a ma le or a female, a Democrat or a Republican. Y ou are one with the true oneness, God. Y ou are not athletic or magical, math ematical or literary, or any o ther label. T ranscending labels, particularly tho se that have been placed on you by others in your past, opens you to the opportunity of soaring in the now in any way that you desire. Y ou can be all things at any present moment in your life. I recommend that you find a way to transform your personal history and remind yourself as you do that you’re transforming any and all beliefs that you’ve u sed as labels or indicators of your limitations. Replace all that with a kn owing that y ou’re not what you’ve done, what you’ve been, how others have tau ght you, or what has been done to you. Y ou’re a part of the beloved, connec ted always to your source, and therefore connected to the unlimited power of the beloved. Y our past history and all of your hurts are no longer here in your physical reality. D on’ t al low them to be here in your mind, muddying your presentmoments. Y our life is like a pla y with several acts. Some of the characters who ent er have short roles to p lay, others, much lar ger. Some are villains and others are good guys. But all of them are necessary, otherwise they wouldn’ t be in the play. Embrace them all, and move on to the next act.T h e S i x t h S e c r e t Any path is only a path, and ther e is no affr ont to oneself or to other, in dr opping it if that is what your heart tells you. — Carlos Castaneda Any man can make mistakes, but only an idiot persists in his err or. — Cicero Y o u C a n ’ t S o l v e a P r o b l e m w i t h t h e S a m e M i n d T h a t C r e a t e d I t6 T h e S i x t h S e c r e t Y ou Can’t Solve a Pr oblem with the Same Mind That Cr eated It Any problem can be resolved with a spiritual solution. One of the most intriguing passages in A Course in Miracles s ug gests that yo u don’ t have a problem; you only think you do. The opening lines of the T orah, as well as Genesis in the Bible, state, “God created Heaven and Earth, ” and later, “And all that God created was good.” If you interpret those words literally, it’ s quite clear that problems are impossible. If God created everything and all that God created was good, bad does not exist. “But,” you sa y, “disease, disharmony, des pair, and so on all appear to exist and run rampant in our world.” When w e feel separated from our sacred center, it’ s easy to b elieve so strongly in the s eparation that we explain any unpleasantness as a problem. In the world of Spirit, or God, p roblems simply don’ t exist and aren’ t real. When your spiritual connection is weak, you move away from the world of Spirit, and problems come from your belief in separation. Y our mind creates the illusion of separateness, and your body, influenced by your ego thoughts, takes on diseases. Our societies are the creation of our collective thoughts. They take on the sam e separation-sickness, and the n we have what we call social pr oblems. All of the so-called problem s, however, represent a spiritual deficit that can be remedied with spiritual solutions. Think of it this way: If you change your mind, you will solve your problem. (I’ve written an entire book on this subject called Ther e Is a Spiritual Solution to Every Pr oblem [Harper Collins, 2001].)How to Go about Changing Y our Mind Can you accept the idea that it’ s your belief in your separation from God that crea tes the attitude that you label a problem? Can you explo re this idea that what you’re calling proble ms are all simply illusions, or mistakes of your int ellect? If God is every where, there is no place that God is not; therefore, you have God with you at all times. Y ou may believe otherwise. It is this belief s ystem that creates your so-called problems. If yo u can bring truth to the presence of these illu sions, they will dissolve—just as you know that three plus th ree equals six i s true, and that three plus three equals ten is untrue. B y bring ing truth to the presence of this arithmetic erro r, it simply dissolves. So t oo will all of your belief s that create “problems” in y our mind dissolve when you bring the hig her ener gy of truth to them. St. Francis of Assisi, in his f amous prayer, beseeches us to change our mind to this thought: “Where there is hatred let me sow love.” Light always dissolves darkness. Love always nullifies hate. Spirit always cancels problems. Problems exist as beliefs of your ego mind, which is unable to conceptualize an awareness of your spiritual mind, just as dark has no concept of light. By a ctually rewriting your agre ement with reality, you can ch ange your mind and send away any perceived problem. Change your attitude toward yourself, and resolve to believe in your connectedness to the higher ener gy of God, even in the direst of circumstances. T urn anything that seems problematic ove r to your higher self, trusting that the “problem” is not what it seems to be. Rewrite your agreement about who you are and what you’re capable of achieving. Y our New Agreement with Reality Y our thoughts are the source of virtually everything in your life. Every relationship that you’re in is something that you carry around with you. If your rela tionship is lousy, it’ s because you think of it that way. The person you’re in a relat ionship with isn’ t with you in this moment, or w hen you’reat w ork, or wh en you’re in th e bathroom, but your thoughts about that person are always with you. The only way you can experie nce another person is in your thoughts. Y ou can’ t get b ehind their eyeballs and be them. Y ou can only process them wi th your thoughts. If you look for what’ s wrong about them and store that negative image in your mind, then that’ s where your relationship exists. If you change yo ur thoughts to w hat you love rather than to what you label as w
[ 2872, 287, 709, 627, 1548, 529, 274, 453, 86, 264, 1065, 304, 279, 1457, 662, 468, 384, 2211, 308, 4048, 1790, 505, 4359, 529, 274, 81870, 259, 1439, 922, 198, 268, 4215, 287, 279, 3118, 4545, 4856, 1109, 1701, 433, 709, 27073, 449, 34951, 198, 2017, 279, 220, 3347, 477, 11196, 922, 279, 220, 3938, 13, 28082, 5496, 304, 279, 4545, 11, 323, 198, 1116, 817, 311, 2187, 904, 11555, 3196, 389, 701, 3347, 311, 7124, 499, 627, 10903, 323, 220, 1935, 5406, 315, 682, 430, 529, 274, 304, 701, 14247, 3634, 2345, 339, 384, 1274, 345, 846, 2859, 11, 13294, 64, 73352, 11, 9624, 62264, 11, 4857, 14769, 11, 1475, 3245, 13, 29837, 198, 258, 279, 3118, 555, 1812, 50644, 323, 3794, 12401, 311, 279, 17139, 1457, 4696, 4359, 627, 28622, 2209, 8442, 5810, 4800, 198, 39787, 671, 704, 420, 662, 4359, 690, 539, 387, 3815, 4205, 1422, 18728, 306, 832, 6596, 505, 198, 3409, 1109, 4359, 602, 274, 3815, 1457, 662, 1556, 294, 4359, 374, 539, 3815, 4205, 1422, 18728, 306, 1457, 198, 1527, 1148, 4359, 574, 3815, 264, 40425, 603, 438, 1667, 4227, 13, 578, 8206, 374, 430, 499, 649, 198, 3323, 470, 384, 311, 1440, 4359, 422, 499, 3207, 10032, 311, 387, 520, 9096, 304, 279, 3118, 198, 29699, 5450, 270, 384, 36174, 328, 384, 4523, 11, 358, 14407, 1268, 33862, 374, 264, 1648, 297, 282, 3339, 198, 64589, 45866, 20864, 449, 4359, 13, 1283, 312, 11, 358, 1053, 1093, 311, 1095, 499, 304, 389, 264, 71246, 198, 21107, 430, 358, 9687, 505, 832, 315, 856, 1455, 32549, 13639, 25, 816, 6033, 690, 1193, 198, 2063, 311, 220, 9615, 1440, 4359, 994, 499, 3041, 709, 279, 3347, 323, 279, 18922, 13535, 384, 304, 701, 198, 38824, 323, 4809, 3980, 12756, 1139, 279, 1457, 1174, 1606, 4359, 374, 2744, 1077, 384, 1457, 16853, 53, 89357, 2478, 220, 1274, 3619, 323, 3974, 420, 17966, 11, 45555, 342, 989, 1606, 315, 198, 50828, 35121, 323, 46243, 86496, 311, 5542, 872, 20663, 304, 3118, 1474, 13209, 198, 64275, 13, 3011, 529, 274, 832, 315, 279, 8125, 3249, 358, 7170, 2019, 430, 1054, 275, 529, 274, 2646, 198, 52905, 9988, 3235, 279, 5066, 14929, 2029, 1952, 279, 5066, 14929, 11, 19301, 9358, 9096, 323, 198, 266, 2193, 287, 2450, 1139, 701, 2324, 1418, 5496, 304, 279, 3118, 4545, 9221, 198, 64, 10667, 379, 315, 220, 1694, 13, 816, 6033, 649, 3240, 555, 28965, 701, 4443, 7135, 379, 505, 701, 198, 10200, 62704, 315, 2561, 55586, 369, 3249, 499, 3207, 539, 5496, 304, 9096, 627, 2822, 94426, 432, 989, 287, 389, 816, 1057, 19758, 11346, 198, 8238, 459, 31469, 12108, 311, 4148, 682, 9382, 430, 499, 4070, 9277, 389, 6261, 13, 62096, 198, 13570, 311, 220, 72319, 499, 13, 816, 6033, 2011, 13967, 3974, 709, 311, 279, 2440, 4856, 1109, 198, 35214, 279, 92659, 9090, 430, 374, 701, 837, 28591, 13, 816, 6033, 3207, 539, 459, 3778, 345, 276, 15155, 11, 477, 459, 11904, 13, 816, 6033, 3207, 264, 4562, 315, 832, 7102, 11, 279, 3823, 7102, 627, 56, 6033, 3207, 539, 264, 7643, 514, 477, 264, 8954, 11, 220, 264, 24846, 477, 264, 9540, 13, 816, 6033, 527, 832, 198, 4291, 279, 220, 837, 389, 24639, 11, 4359, 13, 816, 6033, 527, 539, 29703, 477, 24632, 11, 7033, 991, 62172, 477, 198, 69191, 661, 1174, 477, 904, 297, 9139, 2440, 13, 350, 436, 598, 66, 2518, 9382, 11, 8104, 40425, 513, 430, 617, 198, 82850, 9277, 389, 499, 555, 3885, 304, 701, 3347, 11, 16264, 499, 311, 279, 6776, 315, 198, 708, 3329, 304, 279, 1457, 304, 904, 1648, 430, 499, 12876, 13, 816, 6033, 649, 387, 682, 2574, 520, 904, 198, 29844, 4545, 304, 701, 2324, 627, 40, 7079, 430, 499, 1505, 264, 1648, 311, 5276, 701, 4443, 3925, 323, 198, 1864, 485, 6261, 439, 499, 656, 430, 499, 3207, 46890, 904, 323, 682, 21463, 430, 198, 9514, 4070, 577, 11163, 439, 9382, 477, 34824, 315, 701, 9669, 13, 30658, 682, 430, 449, 198, 64, 1168, 56612, 430, 379, 6033, 3207, 539, 1148, 499, 4070, 2884, 11, 1148, 499, 4070, 1027, 11, 1268, 3885, 198, 19553, 32923, 342, 427, 499, 11, 477, 1148, 706, 1027, 2884, 311, 499, 13, 816, 6033, 3207, 264, 961, 315, 279, 198, 9978, 5047, 11, 4635, 762, 42323, 2744, 311, 701, 2592, 11, 323, 9093, 8599, 311, 279, 198, 359, 18736, 2410, 315, 279, 28530, 627, 56, 1057, 3347, 3925, 323, 682, 315, 701, 44164, 527, 912, 5129, 1618, 304, 701, 7106, 198, 265, 2786, 662, 423, 389, 529, 259, 453, 3428, 1124, 311, 387, 1618, 304, 701, 4059, 11, 296, 8512, 7169, 701, 3118, 61874, 812, 13, 816, 1057, 2324, 374, 1093, 264, 40852, 379, 449, 3892, 14385, 13, 4427, 315, 279, 5885, 198, 14965, 1218, 2781, 617, 2875, 13073, 311, 281, 11203, 1174, 3885, 11, 1790, 45555, 17684, 662, 4427, 527, 61810, 198, 438, 3885, 527, 1695, 7752, 13, 2030, 682, 315, 1124, 527, 5995, 1174, 6062, 814, 198, 41450, 77, 529, 259, 387, 304, 279, 1514, 662, 5867, 32337, 1124, 682, 11, 323, 3351, 389, 311, 279, 1828, 1180, 844, 305, 384, 220, 328, 602, 865, 259, 305, 220, 328, 384, 272, 436, 384, 259, 198, 8780, 1853, 374, 1193, 264, 1853, 11, 323, 9139, 384, 374, 912, 198, 2715, 81, 14848, 311, 57669, 477, 311, 1023, 1174, 304, 1377, 4083, 287, 198, 275, 422, 430, 374, 1148, 701, 4851, 10975, 499, 627, 2345, 30397, 11514, 276, 14151, 198, 8780, 893, 649, 1304, 198, 80024, 2094, 11, 719, 1193, 459, 198, 307, 11345, 67145, 304, 813, 1886, 477, 16853, 2345, 75051, 2382, 198, 56, 297, 577, 220, 356, 264, 308, 18217, 259, 198, 50, 297, 326, 348, 384, 220, 264, 198, 47, 436, 297, 293, 326, 384, 296, 220, 289, 602, 259, 305, 198, 83, 305, 384, 220, 328, 264, 296, 384, 198, 44, 602, 308, 294, 220, 350, 305, 264, 259, 198, 34, 436, 384, 264, 259, 384, 294, 220, 358, 259, 21, 198, 51, 305, 384, 220, 328, 602, 865, 259, 305, 220, 328, 384, 272, 436, 384, 259, 198, 56, 6033, 3053, 1431, 64384, 264, 198, 3617, 297, 10329, 449, 279, 198, 19749, 23754, 3011, 198, 16384, 384, 660, 1102, 198, 8780, 3575, 649, 387, 20250, 449, 264, 18330, 6425, 13, 3861, 315, 279, 1455, 198, 59888, 343, 7623, 47869, 304, 362, 17026, 304, 14603, 18709, 220, 274, 68756, 13033, 82, 430, 30596, 577, 1541, 529, 259, 617, 264, 198, 35686, 26, 499, 1193, 1781, 220, 499, 656, 13, 578, 8736, 5238, 315, 279, 350, 477, 1494, 11, 439, 1664, 439, 198, 85752, 304, 279, 17377, 11, 1614, 11, 1054, 28622, 3549, 32450, 323, 9420, 11, 19524, 323, 3010, 13801, 68932, 682, 430, 4359, 3549, 574, 1695, 2029, 1442, 499, 14532, 1884, 4339, 16280, 13801, 275, 529, 274, 5115, 220, 2867, 430, 5435, 527, 12266, 13, 1442, 4359, 3549, 4395, 323, 198, 543, 430, 4359, 3549, 574, 1695, 11, 3958, 1587, 539, 3073, 13, 1054, 4071, 2476, 499, 829, 379, 1174, 1054, 67, 56407, 345, 73933, 277, 65527, 1174, 951, 6857, 1174, 323, 779, 389, 682, 5101, 311, 3073, 323, 1629, 63677, 304, 1057, 198, 14957, 49216, 4599, 289, 384, 2733, 19180, 505, 1057, 32442, 4219, 1174, 433, 529, 274, 4228, 311, 293, 658, 19704, 779, 198, 4620, 398, 304, 279, 274, 384, 36235, 430, 584, 10552, 904, 47989, 2136, 439, 220, 264, 3575, 627, 644, 279, 1917, 315, 17326, 11, 477, 4359, 11, 281, 938, 22442, 5042, 1541, 529, 259, 3073, 323, 7784, 529, 259, 1972, 627, 4599, 701, 18330, 3717, 374, 7621, 11, 499, 3351, 3201, 505, 279, 1917, 315, 198, 87475, 11, 323, 5435, 2586, 505, 701, 16801, 304, 25768, 13, 816, 1057, 4059, 11705, 198, 1820, 41919, 315, 4941, 13827, 434, 11, 323, 701, 2547, 1174, 28160, 555, 701, 37374, 198, 61665, 82, 11, 5097, 389, 19338, 13, 5751, 220, 34775, 527, 279, 9886, 315, 1057, 22498, 198, 61665, 82, 13, 2435, 1935, 389, 279, 10167, 384, 25768, 1355, 26989, 11, 323, 279, 308, 584, 617, 198, 12840, 584, 1650, 3674, 550, 297, 22442, 13, 220, 2052, 220, 315, 279, 779, 19434, 3575, 274, 11, 4869, 13801, 36369, 264, 18330, 29287, 430, 649, 387, 34630, 1142, 449, 18330, 10105, 627, 39787, 315, 433, 420, 1648, 25, 1442, 499, 2349, 701, 4059, 1174, 499, 220, 690, 11886, 701, 3575, 627, 9149, 4070, 5439, 459, 4553, 2363, 389, 420, 3917, 2663, 23258, 384, 2209, 264, 63849, 198, 37942, 311, 7357, 2394, 297, 10329, 220, 510, 27588, 716, 29770, 11, 220, 1049, 16, 948, 8, 4438, 311, 6122, 922, 51269, 816, 1057, 23754, 198, 6854, 499, 4287, 279, 4623, 430, 433, 529, 274, 220, 701, 16801, 304, 701, 25768, 505, 4359, 198, 9210, 81870, 51309, 279, 19451, 430, 499, 2440, 264, 3575, 30, 3053, 499, 7684, 312, 420, 4623, 198, 9210, 1148, 499, 3207, 8260, 2560, 10030, 527, 682, 5042, 88128, 11, 477, 21294, 315, 198, 22479, 528, 658, 772, 30, 1442, 4359, 374, 1475, 1405, 11, 1070, 374, 912, 2035, 430, 4359, 374, 539, 280, 19041, 1348, 11, 499, 617, 4359, 449, 499, 520, 682, 3115, 13, 816, 6033, 1253, 4510, 6062, 627, 2181, 374, 420, 16801, 274, 379, 65188, 430, 11705, 701, 779, 19434, 5435, 13, 1442, 30596, 577, 649, 4546, 198, 59677, 311, 279, 9546, 315, 1521, 5986, 84, 274, 919, 11, 814, 690, 73739, 2345, 4345, 439, 499, 1440, 198, 9210, 2380, 5636, 270, 312, 68, 17239, 4848, 602, 274, 837, 11, 323, 430, 2380, 5636, 2380, 17239, 5899, 374, 198, 359, 1904, 13, 426, 379, 4546, 6892, 8206, 311, 279, 220, 9546, 315, 420, 35884, 37410, 436, 1174, 433, 5042, 198, 67, 1056, 18685, 627, 4516, 259, 57009, 690, 682, 220, 315, 701, 16801, 274, 430, 1893, 1054, 96440, 863, 304, 379, 1057, 4059, 198, 67, 1056, 4035, 994, 499, 4546, 279, 305, 343, 1077, 38556, 29720, 315, 8206, 311, 1124, 13, 800, 13, 26184, 315, 198, 5733, 13532, 11, 304, 813, 282, 1097, 788, 23788, 1174, 9234, 2176, 8696, 603, 311, 2349, 1057, 4059, 311, 420, 198, 61665, 25, 1054, 9241, 1070, 374, 35242, 1095, 757, 58565, 3021, 2029, 8828, 2744, 14091, 18685, 198, 23449, 2136, 13, 10919, 2744, 854, 9803, 12491, 13, 17326, 2744, 63409, 2053, 5435, 627, 1360, 22442, 3073, 220, 439, 21463, 315, 220, 701, 37374, 4059, 11, 902, 374, 12153, 311, 198, 69587, 940, 553, 459, 17985, 315, 220, 701, 18330, 4059, 11, 1120, 439, 6453, 706, 912, 198, 69587, 315, 3177, 627, 1383, 264, 20864, 1870, 95545, 701, 4392, 991, 306, 449, 8903, 1174, 499, 649, 523, 33275, 701, 198, 38824, 323, 3708, 3201, 904, 26617, 3575, 13, 10604, 701, 19451, 9017, 198, 22479, 726, 11, 323, 9006, 311, 4510, 304, 701, 8599, 2136, 311, 279, 5190, 38556, 29720, 198, 1073, 4359, 11, 1524, 304, 279, 13510, 267, 315, 13463, 13, 350, 66967, 4205, 430, 5084, 198, 35686, 780, 297, 588, 436, 311, 701, 5190, 659, 11, 69344, 430, 279, 1054, 35686, 863, 220, 374, 539, 1148, 198, 275, 5084, 311, 387, 13, 94313, 701, 9306, 922, 889, 499, 527, 323, 1148, 499, 3207, 198, 11600, 481, 315, 32145, 627, 56, 1057, 1561, 23314, 449, 44874, 198, 56, 1057, 11555, 527, 279, 2592, 315, 21907, 4395, 304, 701, 2324, 13, 7357, 198, 37195, 430, 499, 3207, 304, 374, 2555, 430, 499, 6920, 2212, 449, 499, 13, 1442, 198, 22479, 1375, 64, 259, 919, 2200, 374, 326, 94623, 1174, 433, 529, 274, 1606, 499, 1781, 315, 433, 430, 1648, 662, 578, 1732, 198, 9514, 3207, 304, 264, 91903, 65125, 2200, 449, 4536, 529, 259, 449, 499, 304, 420, 4545, 11, 477, 289, 48916, 499, 529, 1244, 289, 477, 74, 11, 477, 421, 665, 499, 3207, 304, 270, 384, 15197, 11, 719, 701, 11555, 922, 430, 198, 9164, 527, 2744, 449, 499, 13, 578, 1193, 1648, 499, 649, 2183, 648, 308, 346, 2500, 198, 9164, 374, 304, 701, 11555, 627, 56, 6033, 649, 529, 259, 636, 293, 36346, 485, 872, 37061, 5700, 323, 387, 220, 1124, 13, 816, 6033, 649, 1193, 1920, 198, 49818, 24129, 270, 701, 11555, 13, 1442, 499, 1427, 369, 1148, 529, 274, 5076, 922, 1124, 323, 3637, 198, 9210, 8389, 2217, 304, 701, 4059, 1174, 1243, 430, 529, 274, 1405, 701, 5133, 6866, 627, 2746, 499, 2349, 30596, 4433, 11555, 311, 289, 9072, 499, 3021, 4856, 1109, 311, 1148, 499, 2440, 198, 300, 289 ]
0xBreath/holistic-books
fifteen-year study of housewives in Oregon. Women who stayed home all day had a 54 percent higher death rate from cancer than women who worked away from home. The study concluded that the higher rate likely was a consequence of exposure to the chemicals in household products. Dadd’s book, along with many others, contains formulas for making your own environmentally safe household products. A Prescription for Toxic Overload Often, toxic exposure comes from medical and dental offices, from the very professions that you expect would keep you healthy. Whether it is antibiotics in your food, the drug in your inhaler, steroids on your skin, mercury in your mouth, medicines in your stomach or fluoride in your water, the medical and dental industries are significant sources of toxins. In fact, medical journals acknowledge that prescription drugs are the third leading cause of death in America (after heart disease and cancer). As you recall, prescription and over-the-counter drugs “work” by interfering with normal chemical processes in cells. They are designed to suppress symptoms, but do not cure disease. In fact, by interfering with normal cell function, prescription drugs can cause cellular malfunction, which is the same as causing disease. Decisions about which procedures and medicines to choose should be based on knowledge of the toxicity involved. Every molecule you put into your body is going to have an effect, for better or worse. Almost always, prescription and over-the-counter drugs are for the worse. Furthermore, physicians label many of today’s chronic diseases as being of “unknown etiology,” a fancy way of saying “we are clueless about the cause.” Actually, many new disease conditions can be traced back (either directly or indirectly) to environmental toxins that bioaccumulate in tissues, contribute to toxic overload, disrupt cell chemistry and cause disease. The Toxic Truths Inside Your Body Although we are accustomed to thinking about toxins in the outside world, often we forget about the powerful toxins produced within our bodies. The body must eliminate internal toxins to stay healthy. Under normal, healthy conditions, the body is designed to control those toxins and protect us against harm. Under other circumstances, however, the toxins producedinternally can be a serious problem, worse than anything from the outside world. When these internal toxins are produced excessively or cannot be properly detoxified, they build up in the body and cause disease. In almost any chronically ill person, internally generated toxins play a major role. When toxins are generated in the digestive system (intestinal toxemia), they enter our bloodstream, and if these toxins are present in excess of the liver’s ability to detoxify them, they damage cells all over the body. Intestinal toxemia has been associated with AIDS, allergies, asthma, cancer, cardiac arrhythmias, arthritis, eye problems, high blood pressure, mental problems, headaches, various gastrointestinal conditions, senility, skin problems and other diseases. In my own disease process, the internal toxins I was producing were, indeed, a major contributor to my own physical and mental debilitation. Intestinal toxemia was the “mysterious” ailment plaguing Michael, who had just completed his junior year at Harvard and had gone off to Europe for the summer with friends. As he was traveling around, he began to feel ill, dizzy and fatigued. He went to see a physician in London who prescribed a drug that did not help. Michael saw other physicians in Germany and Switzerland, but he finally returned home— too sick to remain abroad. A strapping twenty-one-year-old college student should be at the peak of health. Instead, Michael was suffering from debilitating fatigue, he was lightheaded and dizzy, and he had visual disturbances, not to mention various aches and pains. After many thousands of dollars worth of testing (including a brain scan to check for a brain tumor), Michael’s physicians were at a loss to explain his condition and referred him to a psychiatrist. Desperately concerned for her son’s future and furious with a medical system that was obviously not working, Michael’s mother looked for other options; at that point, she called me. As with any sick person, I knew exactly what was wrong with Michael: his cells were malfunctioning because of a combination of deficiency and toxicity. The question, as always: How to restore his cells to healthy function? I used the six pathways as a guide and eventually discovered that digestive toxins—a critical aspect of the toxin pathway—were the source of Michael’s problems. Digestive toxins are produced in a couple of ways, notably by an abnormal growth of bacteria or yeast in the intestines and by improperly digested food, which putrefies in the digestive system. Intestinal toxemia creates highly poisonous toxins as well as nutritional deficiency. When bad bacteria and yeasts overgrow, they displace the friendly bacteria necessary for producing nutrients such as the B- complex vitamins, vitamin B 12 and vitamin K. Friendly bacteria also help to obtain the nutrients we need from the food we eat. Intestinal toxemia causes deficiency and toxicity in most of us, to some degree, because of damage from antibiotics. Michael had acne as a teenager. His dermatologist had prescribed an antibiotic(tetracycline), and Michael had taken this drug every day for years. Antibiotics were developed to kill bacteria. The problem is that helpful bacteria in your intestines (normal intestinal flora) are needed for good health. Years of taking antibiotics destroyed these helpful bacteria in Michael’s digestive system. (Even one course of antibiotics can have this effect.) This situation allowed the overgrowth of abnormal intestinal flora and a yeast called Candida albicans. A yeast infection can produce toxic chemicals that absorb into the bloodstream; also, yeast can physically invade and damage the intestinal tissue in a way that allows other inappropriate materials (undigested food particles, toxic wastes and yeast byproducts) to pass directly into the bloodstream. This condition floods the body with dangerous toxins and allergens, causing food allergies and disrupting the immune system. Some of these toxins are neurotoxic (causing damage to the brain and the nervous system) and may produce symptoms such as fatigue, headaches, apathy, depression, anxiety, mood swings and memory lapses. Intestinal yeast infections also impair the absorption of nutrients, which is a separate but equally serious problem. Disrupting the normal ecology of the gut also invites infection by parasites, which further disrupt gut tissue. In Michael’s case, I suspected problems with internally generated digestive toxins, but to know for certain one must measure. I suggested to Michael that he ask his physician to be tested for candida. (Convincing the physician to do the candida test was not easy. Physicians do not generally look for such infections, and his mother had to put considerable pressure on the doctor.) The test did show that Michael had a candida infection, which he was able to get rid of through natural methods such as taking high-quality probiotics and grapefruit seed extract and by reducing dietary sugar (which was “feeding” the yeast problem). Michael, who had been completely disabled by his disease throughout the summer, was able to go back to Harvard in the fall, complete his senior year and graduate. Problems such as Michael’s are common in America because of the excessive antibiotics that our physicians prescribe. While the use of antibiotics is prudent and necessary in very select cases, for the most part antibiotics unnecessarily damage the digestive system and contribute to intestinal toxemia. This toxemia often subjects us to far more toxicity than the original “germ” that the antibiotic was supposed to kill. Unfortunately, almost everybody in America has taken antibiotics at some point; these drugs are a major cause of health problems, including fatigue and allergies. Intestinal toxemia can be provoked in other ways, by medical drugs such as non- steroidal anti-inflammatory drugs (NSAIDs, including aspirin, ibuprofen, naproxen, ketoprofin, etc.) and oral steroids (cortisone pills, birth control pills, etc.). Maldigestion of food (exacerbated by medical drugs or not) produces toxins inside your body. A mostly cooked and processed food diet lacking critical enzymes is a common contributor, as is poor chewing of food. Low-fiber diets are alsoproblematic. Whatever the cause, undigested food can rot and poison you while still inside you. Carbohydrates ferment, fats turn rancid and proteins putrefy. The most common symptoms are bloating, constipation, gas, halitosis, heartburn, eye problems, neurological problems and headaches. Keep protein consumption moderate; diets high in protein, especially cooked meat and pasteurized dairy, overload our digestive systems. We need only 35 to 40 grams of protein per day (more for athletes or those with large body frames), but Americans eat an average of 90 grams of gut-putrefying protein per day. A one- pound slab of roast beef contains more than 100 grams of protein. Large quantities of cooked and denatured proteins, which are harder to digest, can cause an overgrowth of a type of putrefactive bacteria that thrive when food is rotting in the gut. These bacteria produce toxic chemicals such as indole, skatole, phenol and hydrogen sulfide. In addition, these putrefactive bacteria displace friendly bacteria, which are essential to good digestion and health, and the result is intestinal toxemia. To prevent or eliminate the problems associated with intestinal toxemia: • Avoid the use of antibiotics
[ 37755, 4771, 4007, 315, 3838, 59488, 304, 19313, 13, 720, 36190, 889, 20186, 2162, 682, 1938, 198, 32345, 264, 220, 4370, 3346, 5190, 4648, 4478, 505, 9572, 1109, 3278, 889, 6575, 3201, 505, 198, 5227, 13, 720, 791, 4007, 20536, 430, 279, 5190, 4478, 4461, 574, 264, 29774, 315, 14675, 198, 998, 279, 26333, 304, 14048, 3956, 13, 423, 723, 753, 2363, 11, 3235, 449, 1690, 3885, 345, 13676, 55179, 369, 3339, 701, 1866, 57340, 6220, 14048, 3956, 627, 32, 77175, 369, 67502, 6193, 1096, 198, 78013, 11, 21503, 14675, 4131, 505, 6593, 323, 29106, 19672, 11, 505, 279, 1633, 198, 22579, 8719, 430, 499, 1755, 1053, 2567, 499, 9498, 13, 13440, 433, 374, 46850, 304, 701, 198, 14239, 11, 279, 5623, 304, 701, 77773, 261, 11, 58161, 389, 701, 6930, 11, 51852, 304, 701, 11013, 345, 2106, 292, 1572, 304, 701, 23152, 477, 89230, 304, 701, 3090, 11, 279, 6593, 323, 29106, 198, 485, 592, 4108, 527, 5199, 8336, 315, 62186, 13, 763, 2144, 11, 720, 69216, 42780, 25670, 198, 9210, 22866, 11217, 527, 279, 4948, 6522, 5353, 315, 4648, 304, 5270, 320, 10924, 4851, 198, 67, 56407, 323, 9572, 4390, 2170, 499, 19635, 11, 22866, 323, 927, 10826, 64289, 11217, 1054, 1816, 863, 555, 75387, 449, 198, 8416, 11742, 11618, 304, 7917, 13, 2435, 527, 6319, 311, 28321, 13803, 11, 719, 656, 198, 1962, 27208, 8624, 13, 763, 2144, 11, 555, 75387, 449, 4725, 2849, 734, 11, 22866, 11217, 198, 4919, 5353, 35693, 72287, 11, 902, 374, 279, 1890, 439, 14718, 8624, 13, 3799, 6948, 198, 9274, 902, 16346, 323, 39653, 311, 5268, 1288, 387, 3196, 389, 6677, 315, 198, 1820, 58011, 6532, 13, 7357, 43030, 499, 2231, 1139, 701, 2547, 374, 2133, 311, 617, 459, 198, 27153, 11, 369, 2731, 477, 11201, 13, 35403, 2744, 11, 22866, 323, 927, 10826, 64289, 11217, 198, 548, 369, 279, 11201, 627, 57417, 11, 35944, 2440, 1690, 315, 3432, 753, 21249, 19338, 439, 1694, 315, 198, 2118, 16476, 1880, 31226, 2476, 264, 27555, 1648, 315, 5605, 1054, 906, 527, 31089, 1752, 922, 279, 5353, 49216, 53692, 11, 1690, 502, 8624, 4787, 649, 387, 51400, 1203, 320, 50998, 6089, 477, 198, 485, 1248, 398, 8, 311, 12434, 62186, 430, 17332, 99487, 304, 39881, 11, 17210, 311, 21503, 198, 2017, 1096, 11, 24927, 2849, 30903, 323, 5353, 8624, 627, 791, 67502, 30198, 82, 28468, 4718, 14285, 198, 16179, 584, 527, 53184, 311, 7422, 922, 62186, 304, 279, 4994, 1917, 11, 3629, 198, 906, 10894, 922, 279, 8147, 62186, 9124, 2949, 1057, 13162, 13, 578, 2547, 2011, 198, 40895, 3357, 5419, 62186, 311, 4822, 9498, 627, 16648, 4725, 11, 9498, 4787, 11, 279, 2547, 374, 6319, 311, 2585, 1884, 62186, 323, 198, 47079, 603, 2403, 11682, 13, 9636, 1023, 13463, 11, 4869, 11, 279, 62186, 9124, 56544, 750, 649, 387, 264, 6129, 3575, 11, 11201, 1109, 4205, 505, 279, 4994, 1917, 627, 4599, 1521, 5419, 62186, 527, 9124, 87146, 477, 4250, 387, 10489, 198, 19842, 5241, 1908, 11, 814, 1977, 709, 304, 279, 2547, 323, 5353, 8624, 13, 763, 4661, 904, 27076, 2740, 5986, 198, 9164, 11, 34167, 8066, 62186, 1514, 264, 3682, 3560, 627, 4599, 62186, 527, 8066, 304, 279, 60071, 1887, 320, 71558, 41569, 22689, 705, 814, 3810, 198, 414, 100216, 11, 323, 422, 1521, 62186, 527, 3118, 304, 13937, 315, 279, 26587, 753, 5845, 311, 198, 19842, 5241, 1463, 1124, 11, 814, 5674, 7917, 682, 927, 279, 2547, 13, 1357, 65050, 41569, 22689, 706, 1027, 198, 50187, 449, 46060, 11, 58742, 11, 51643, 11, 9572, 11, 47345, 2961, 61254, 3557, 11, 55652, 11, 8071, 198, 96440, 11, 1579, 6680, 7410, 11, 10723, 5435, 11, 55403, 11, 5370, 80311, 198, 16902, 11, 6252, 1429, 11, 6930, 5435, 323, 1023, 19338, 13, 763, 856, 1866, 8624, 1920, 345, 1820, 5419, 62186, 358, 574, 17843, 1051, 11, 13118, 11, 264, 3682, 26373, 311, 856, 1866, 198, 47692, 323, 10723, 4316, 33949, 627, 1090, 65050, 41569, 22689, 574, 279, 1054, 76, 97499, 863, 60243, 479, 39137, 7623, 8096, 11, 889, 1047, 1120, 198, 35835, 813, 27144, 1060, 520, 25996, 323, 1047, 8208, 1022, 311, 4606, 369, 279, 7474, 198, 4291, 4885, 13, 1666, 568, 574, 21646, 2212, 11, 568, 6137, 311, 2733, 5986, 11, 85184, 323, 8834, 343, 3340, 13, 1283, 198, 42700, 311, 1518, 264, 28378, 304, 7295, 889, 32031, 264, 5623, 430, 1550, 539, 1520, 13, 8096, 198, 82, 675, 1023, 35944, 304, 10057, 323, 30221, 11, 719, 568, 5616, 6052, 2162, 2345, 198, 37227, 14363, 311, 7293, 22917, 627, 32, 610, 3713, 17510, 19101, 4771, 6418, 7926, 5575, 1288, 387, 520, 279, 16557, 315, 2890, 627, 31887, 11, 8096, 574, 16066, 505, 92890, 36709, 11, 568, 574, 326, 1108, 11671, 291, 323, 198, 67, 91591, 11, 323, 568, 1047, 9302, 85160, 11, 539, 311, 6420, 5370, 264, 8696, 323, 51266, 13, 4740, 198, 35676, 9214, 315, 11441, 5922, 315, 7649, 320, 16564, 264, 8271, 8737, 311, 1817, 369, 264, 198, 54160, 36254, 705, 8096, 753, 35944, 1051, 520, 264, 4814, 311, 10552, 813, 3044, 323, 198, 265, 5671, 1461, 311, 264, 73969, 13, 3959, 716, 2718, 11920, 369, 1077, 4538, 753, 3938, 323, 53170, 198, 4291, 264, 6593, 1887, 430, 574, 14224, 539, 3318, 11, 8096, 753, 6691, 7111, 369, 198, 1605, 2671, 26, 520, 430, 1486, 11, 1364, 2663, 757, 627, 2170, 449, 904, 14363, 1732, 11, 358, 7020, 7041, 1148, 574, 5076, 449, 8096, 25, 813, 7917, 198, 52898, 72287, 287, 1606, 315, 264, 10824, 315, 48294, 323, 58011, 13, 578, 198, 7998, 11, 439, 2744, 25, 2650, 311, 15301, 813, 7917, 311, 9498, 734, 30, 358, 1511, 279, 4848, 198, 2398, 2336, 439, 264, 8641, 323, 9778, 11352, 430, 60071, 62186, 29096, 9200, 198, 58158, 315, 279, 98534, 38970, 2345, 52898, 279, 2592, 315, 8096, 753, 5435, 627, 46317, 535, 62186, 527, 9124, 304, 264, 5743, 315, 5627, 11, 35146, 555, 459, 35663, 6650, 198, 1073, 24032, 477, 41580, 304, 279, 39408, 1572, 323, 555, 75298, 4170, 10185, 3691, 11, 902, 198, 631, 1116, 552, 304, 279, 60071, 1887, 13, 1357, 65050, 41569, 22689, 11705, 7701, 74508, 62186, 198, 300, 1664, 439, 43226, 48294, 13, 3277, 3958, 24032, 323, 20043, 12019, 927, 67318, 11, 814, 198, 4338, 2050, 279, 11919, 24032, 5995, 369, 17843, 37493, 1778, 439, 279, 426, 7058, 24126, 46192, 11, 28170, 426, 198, 717, 720, 438, 28170, 735, 13, 49517, 24032, 1101, 1520, 311, 6994, 198, 1820, 37493, 584, 1205, 505, 279, 3691, 584, 8343, 13, 1357, 65050, 41569, 22689, 11384, 48294, 323, 198, 998, 14668, 488, 304, 1455, 315, 603, 11, 311, 1063, 8547, 11, 1606, 315, 5674, 505, 46850, 627, 26597, 1047, 46905, 439, 264, 32639, 13, 5414, 61485, 16549, 1047, 32031, 459, 60595, 1175, 17820, 2826, 89034, 705, 323, 8096, 1047, 4529, 420, 5623, 1475, 1938, 369, 1667, 13, 95951, 83300, 1051, 198, 16219, 291, 311, 5622, 24032, 13, 578, 3575, 374, 430, 11190, 24032, 304, 701, 39408, 1572, 198, 53180, 63900, 82088, 8, 527, 4460, 369, 1695, 2890, 13, 23116, 315, 4737, 46850, 198, 15886, 291, 1521, 11190, 24032, 304, 8096, 753, 60071, 1887, 13, 320, 13461, 832, 3388, 315, 198, 519, 581, 83300, 649, 617, 420, 2515, 6266, 1115, 6671, 5535, 279, 927, 74189, 315, 35663, 198, 71558, 82088, 323, 264, 41580, 2663, 720, 34, 4654, 64, 82698, 38473, 627, 32, 41580, 19405, 649, 8356, 21503, 26333, 430, 35406, 1139, 279, 100216, 280, 19171, 11, 41580, 649, 22655, 75272, 323, 5674, 279, 63900, 20438, 304, 264, 1648, 430, 198, 56967, 1023, 33781, 7384, 320, 1263, 343, 10185, 3691, 19252, 11, 21503, 82320, 323, 198, 9188, 561, 555, 10354, 8, 311, 1522, 6089, 1139, 279, 100216, 13, 1115, 3044, 61272, 279, 198, 2664, 449, 11660, 62186, 323, 25405, 729, 11, 14718, 3691, 58742, 323, 87843, 279, 198, 70155, 1887, 13, 4427, 315, 1521, 62186, 527, 18247, 998, 14668, 320, 936, 985, 5674, 311, 279, 8271, 198, 438, 279, 23418, 1887, 8, 323, 1253, 8356, 13803, 1778, 439, 36709, 11, 55403, 345, 391, 19682, 11, 18710, 11, 18547, 11, 20247, 57890, 323, 5044, 51055, 288, 13, 1357, 65050, 41580, 198, 258, 25384, 1101, 38974, 279, 44225, 315, 37493, 11, 902, 374, 264, 8821, 719, 18813, 198, 94427, 3575, 13, 4185, 6722, 287, 279, 4725, 72546, 315, 279, 18340, 1101, 45510, 19405, 555, 198, 1768, 300, 3695, 11, 902, 4726, 24927, 18340, 20438, 627, 644, 8096, 753, 1162, 11, 358, 24740, 5435, 449, 34167, 8066, 60071, 198, 998, 87, 1354, 11, 719, 311, 1440, 369, 3738, 832, 2011, 6767, 13, 358, 12090, 311, 8096, 430, 568, 2610, 198, 26301, 28378, 311, 387, 12793, 369, 5803, 64, 13, 320, 1128, 35233, 287, 279, 28378, 311, 656, 279, 5803, 64, 198, 1985, 574, 539, 4228, 13, 88599, 656, 539, 8965, 1427, 369, 1778, 30020, 11, 323, 813, 198, 27510, 1047, 311, 2231, 24779, 7410, 389, 279, 10896, 6266, 578, 1296, 1550, 1501, 430, 198, 26597, 1047, 264, 5803, 64, 19405, 11, 902, 568, 574, 3025, 311, 636, 9463, 315, 1555, 5933, 198, 36842, 1778, 439, 4737, 1579, 22867, 3650, 83300, 323, 52252, 36698, 10533, 8819, 323, 555, 198, 265, 1072, 6253, 34625, 13465, 320, 8370, 574, 1054, 46519, 863, 279, 41580, 3575, 570, 8096, 11, 889, 1047, 198, 82850, 6724, 8552, 555, 813, 8624, 6957, 279, 7474, 11, 574, 3025, 311, 733, 1203, 198, 998, 25996, 304, 279, 4498, 11, 4686, 813, 10195, 1060, 323, 19560, 627, 1360, 22442, 1778, 439, 8096, 753, 527, 4279, 304, 5270, 1606, 315, 279, 27639, 198, 519, 581, 83300, 430, 1057, 35944, 72333, 13, 6104, 279, 1005, 315, 46850, 374, 74978, 323, 198, 95317, 304, 1633, 3373, 5157, 11, 369, 279, 1455, 961, 46850, 83474, 5674, 279, 198, 37439, 535, 1887, 323, 17210, 311, 63900, 41569, 22689, 13, 1115, 41569, 22689, 3629, 15223, 603, 198, 998, 3117, 810, 58011, 1109, 279, 4113, 1054, 1414, 76, 863, 430, 279, 60595, 574, 10171, 311, 5622, 627, 31140, 11, 4661, 16470, 304, 5270, 706, 4529, 46850, 520, 1063, 1486, 280, 45010, 11217, 527, 264, 3682, 5353, 315, 2890, 5435, 11, 2737, 36709, 323, 58742, 627, 1090, 65050, 41569, 22689, 649, 387, 76566, 304, 1023, 5627, 11, 555, 6593, 11217, 1778, 439, 2536, 7058, 3751, 71916, 7294, 67595, 11217, 320, 2507, 32, 31566, 11, 2737, 25689, 258, 11, 19185, 97201, 31453, 11, 26944, 55889, 268, 345, 26554, 47026, 5589, 11, 5099, 6266, 323, 21308, 58161, 320, 66, 371, 285, 606, 26153, 11, 7342, 2585, 26153, 11, 5099, 13, 4390, 44, 4852, 15505, 290, 315, 3691, 320, 327, 51919, 660, 555, 6593, 11217, 477, 539, 8, 19159, 62186, 198, 42450, 701, 2547, 13, 362, 10213, 30205, 323, 15590, 3691, 10173, 32161, 9200, 56067, 198, 285, 264, 4279, 26373, 11, 439, 374, 8009, 75477, 315, 3691, 13, 12310, 2269, 8799, 41943, 527, 10942, 47026, 10329, 780, 13, 33739, 279, 5353, 11, 2073, 343, 10185, 3691, 649, 5868, 323, 21109, 499, 1418, 2103, 198, 42450, 499, 13, 3341, 34658, 988, 68736, 11, 50127, 2543, 436, 1149, 307, 323, 28896, 2231, 1116, 88, 13, 578, 1455, 198, 5581, 13803, 527, 14545, 1113, 11, 738, 49686, 11, 6962, 11, 15104, 275, 10934, 11, 4851, 22464, 11, 8071, 198, 96440, 11, 64908, 5435, 323, 55403, 627, 19999, 13128, 15652, 24070, 26, 41943, 1579, 304, 13128, 11, 5423, 30205, 13339, 198, 438, 3347, 12844, 1534, 34479, 11, 43284, 1057, 60071, 6067, 13, 1226, 1205, 1193, 220, 1758, 311, 220, 1272, 34419, 198, 1073, 13128, 824, 1938, 320, 6518, 369, 23579, 477, 1884, 449, 3544, 2547, 14418, 705, 719, 198, 92786, 8343, 459, 5578, 315, 220, 1954, 34419, 315, 18340, 12, 631, 1116, 7169, 13128, 824, 1938, 13, 362, 832, 7058, 79, 801, 55791, 315, 58785, 25309, 5727, 810, 1109, 220, 1041, 34419, 315, 13128, 13, 20902, 33776, 198, 1073, 30205, 323, 3453, 1598, 67, 28896, 11, 902, 527, 16127, 311, 21552, 11, 649, 5353, 459, 198, 2017, 74189, 315, 264, 955, 315, 2231, 1116, 3104, 24032, 430, 41972, 994, 3691, 374, 5868, 1303, 304, 279, 198, 70, 332, 13, 4314, 24032, 8356, 21503, 26333, 1778, 439, 1280, 1286, 11, 1940, 266, 1286, 11, 14345, 337, 323, 198, 67229, 4469, 40769, 579, 13, 763, 5369, 11, 1521, 2231, 1116, 3104, 24032, 834, 2050, 11919, 24032, 345, 8370, 527, 7718, 311, 1695, 74502, 323, 2890, 11, 323, 279, 1121, 374, 63900, 41569, 22689, 627, 1271, 5471, 477, 22472, 279, 5435, 5938, 449, 63900, 41569, 22689, 512, 6806, 35106, 279, 1005, 315, 46850 ]
0xBreath/holistic-books
atal and post-natal care as well. A sign by the door of Mysore-based Mohammed Khasim’ s practice. The son of Abdul Gafar, a renowned bone specialist who treated the Maharajah of Mysore’ s family, his skills have been handed down from father to son.Even though there are thousands of Unani doctors, more than 100 medical colleges and a dozen major pharma ceutical companies in India, the roadside pharmacy overflowi ng with dusty medic ine bottles, dried roots, powders and oils is a common sight. Here, a father and son (both unqualified) prepare prescriptions in their small shop. The boy’ s grandfather taught them all they know.Many nattu vaidya learned their skills from their families. This physician is no exception. Although not formally qualified, he has practiced Ayurveda in Trivandrum for over 50 years and has many regular patients. He makes most of his prescriptions himself, to recipes that were handed down to him from his father. The bonesetter : The traditional bonesetter or orthopedic healer is another example. In the countrysi de, such a pers on may look after the needs of the population of 20 villages or so, walking from one destination to the next to treat sp rains, fractures, joint problems or muscle pain. A group in volved in strengthening traditional systems of medi cine called th e Lok Swasthya Param para Samvardhan Samithi (LSP SS) in Coimbatore estimates that there are over 60,000 bone-setters serving rural populations and, in cities, established practitio ners may see up to 30 or 40 patients a day. It is estimated that ove r 50 percent of people with broken bones are treated by bonesetters in any given year. The poison healer :Snakebite is a common occurr ence in rural India and traditional visha vaidya have sp ecialist knowledge. Th ey can dif ferentiate between dif ferent snakebites, and they know which antidote works for which type of snake. Their remedies are almost always herbal and pr escriptions include p ur gation, antidotes and top ical application of specific plants. The visha vaidya is often called on in the case of rabid dog bites and scorpion bites too. Less cle ar cut, but nonetheless important, are people like oil producers, small-scale herbal m edicine manufacturers, wandering monks with herbal knowledge, community elders who have specialist knowledge of herbal home remedies and nutrition, martial art masseuses, and kannu vaidyas or eye physicians who treat eye complaints even to the extent o f giving cataract operations. There are also more general herbal medicine practitioners who specialize in su ch conditions as jaundice a nd paralysis, children’ s diseases and dentistry. Such people may have very particular knowledge in marmanam (treatment of the vital points), agni and kshara karma (cauterization), sodhana karma (purification techniques) and rasayana (rejuvenation th erapy) as well. According to the Foundation for the Revitalisation of Local Health T radit ions (FRLHT ) wh ose mission is to revitalize these health practices in four states in south India, there cou ld be a million such practitio ners catering to India’ s 4,600-odd ethnic communities. T raditionally, many of these care-givers have a relationship with their “patients” and don’ t practice specifically for monetary gain. Rather, t hey pla ce value on a code of ethics that includes service to others, the transference of skill s, prayers for guidance and holistic health ca re for all. In some cases, practitioners accept a kanikkae (a kind of of fering or a gratuity). Theirs is not a vocation; in fact, it is more than likely that they have another job, such as farmer or shopkeeper, as well. Even though most of these people do not have legal status (or only semi-legal status) as medical practitioners, they are considered legitimate heale rs in their own right. Indeed, such or ganizations as the LSSPS are keen to tap into their specialist knowledge — some of which is invaria bly being lost w ith the passing of time. For a s tart, none of it is written down: Most barefoot doctors receive their healing knowled ge orally via p erson-to-person transmission eitherin the form of the guru- shishya tradition (maste r/ disciple), or commonly from father to son or mother to daughter. Secondly, with rapid ind ustrialization and loss of rural land, vital herbs, plants and trees are being cut down in the name of “development”. Thirdly, as India develops, a worrying trend has been recently noticed: such people are quite often over 40 years of age, and are often not handing down their skills to the next generation as they did in the past. Dr S B Nithyanandam stands in the grounds of his local Shiva temple. A Siddha doctor, he learnt his trade from his father, but also trained at a Siddha medical college.An example of the type of colorful billboards found all over India. This one is for a type of hair oil that contains amla or Indian gooseberry.healing plants India’ s creativ e healing systems are predominantly pla nt- based (althoug h minerals have a role) and it is estimated that most ho useholds rely upon locally available plant mate rial for their pharmacopeia. Ac cording to the W orld Health Or ganisation ( who ), between 35,000 and 70,000 plants have been us ed for medicinal purposes globally at one time or another — and in India tod ay at least 20,000 species are found, 2,000 of which are ef ficacious in A yurvedic formulations. O f these, about 600 are commonly used in oils (tailam ), powders (choornam ), internal medications, teas and tonics. W e list some of the most important plants from the A yurvedic pharmacopeia. Lawsonia inermis Henna Henna (mehndi) is commonly used as a dye and an anti-fungal. The leaves p roduce a red-orange dye molecule that has an af finity for bonding with protein, so has bee n used to dye skin, hair, fingernails, leather, silk and wool since the Bronze Ages. In India it is commonly used as a dye on hands, feet and hair, while henna essential oil is used as a scalp stimulator. Centella asiatica Asiatic pennywort Brahmi is a small herbaceous annual plant, the leaves of which are reported to be u seful in abdominal disorders; a tea is made to help with dysentery in children. Scientific reports have documented itsability to aid wound healing, being particularly helpful with reduction of scarring, and it is also used in the treatment of leprosy, epilepsy, cardiac debility and more. Eclipta alba False daisy Bhringaraja is an annual herb that is com monly used in the treatment of skin diseases and as an anti-inflammatory. It is also reported to be ef fective in blackening and strengthening the hair and is co oling on the head. It may also be taken as a tonic to help with liver and spleen enlar gements. Ocimum tenuiflorum Holy basil Known as holy basil, tulsi is an important symbol in many Hindu religious traditi ons. It is men tioned in the Rigveda and the Charaka Samhita, an d has been recognized by the rishis for thousands of years as a prime herb in A yurvedic treatment. Tulsi extracts are used for common colds, headaches, stomach disorders, inflammation, heart disease, poisoning and malaria. Tulsi can be taken as an herbal tea, in dried powder form, fresh or mixed with ghee. Adhatoda vasica Malabar nut Also known as the Malabar nut tree, the vasaka shrub has leaves (see left) that are rich in vitamin C and carotene. Fresh or driedleaves are used to make a te a that is good for bronchial and asthmatic troubles. Powdered leaves are used on skin infections, and a preparation made from vasaka flowers is used to treat tuberculosis. Chrysopogon zizanoides V etiver Native to India, vetiver is a T amil name and old T amil literature lists medicinal uses for the plant. Si milar to other fragrant grasses such as lemo ngrass and citronella, Chrysopogon zizanoides is a perennial grass. The root has co oling and calming properties, so is ef fective in the treatment of bu r
[ 4306, 323, 1772, 5392, 4306, 2512, 439, 198, 9336, 627, 32, 1879, 555, 279, 6134, 315, 386, 1065, 461, 6108, 46392, 735, 4752, 318, 529, 274, 6725, 13, 578, 4538, 315, 198, 5953, 67, 360, 480, 2642, 277, 11, 264, 37048, 17685, 24687, 889, 12020, 279, 53690, 1662, 1494, 315, 386, 1065, 461, 529, 274, 198, 19521, 1174, 813, 7512, 617, 1027, 23415, 1523, 505, 7126, 311, 4538, 5253, 1055, 3582, 1070, 527, 9214, 315, 1252, 5676, 16410, 11, 810, 1109, 220, 1041, 6593, 198, 2119, 1978, 288, 323, 264, 21030, 3682, 1343, 20306, 3846, 332, 950, 5220, 304, 6890, 11, 279, 80743, 198, 764, 76342, 16891, 72, 7933, 449, 77973, 8249, 19661, 27474, 11, 32720, 20282, 11, 7019, 12601, 323, 32462, 374, 198, 64, 4279, 14254, 13, 5810, 11, 264, 7126, 323, 4538, 320, 21704, 653, 37435, 8, 10772, 65835, 304, 198, 50828, 2678, 8221, 13, 578, 8334, 529, 274, 38950, 15972, 1124, 682, 814, 1440, 662, 8607, 220, 308, 1617, 84, 348, 3864, 7911, 220, 9687, 872, 7512, 505, 872, 8689, 662, 1115, 28378, 374, 912, 198, 7959, 13, 10541, 539, 37402, 15337, 11, 568, 706, 44664, 24852, 80627, 64, 304, 198, 1305, 344, 438, 10952, 369, 927, 220, 1135, 1667, 323, 706, 1690, 5912, 6978, 13, 1283, 3727, 1455, 315, 198, 26301, 65835, 5678, 11, 311, 19141, 430, 1051, 23415, 1523, 311, 1461, 505, 813, 7126, 16853, 791, 25896, 22120, 6394, 791, 8776, 25896, 22120, 477, 30299, 16771, 292, 98211, 374, 2500, 3187, 627, 644, 279, 2346, 40707, 72, 409, 11, 1778, 264, 7565, 389, 1253, 1427, 1306, 279, 3966, 315, 279, 198, 45541, 315, 220, 508, 33889, 477, 779, 11, 11689, 505, 832, 9284, 311, 279, 198, 3684, 311, 4322, 993, 62555, 11, 78332, 11, 220, 10496, 5435, 477, 16124, 6784, 13, 362, 198, 4166, 304, 4499, 2111, 304, 48513, 8776, 6067, 315, 25098, 80852, 198, 44982, 270, 384, 58501, 4593, 561, 87323, 7136, 3429, 8388, 22329, 10118, 8388, 411, 72, 320, 43, 4695, 18679, 340, 258, 3623, 318, 14034, 461, 17989, 430, 1070, 527, 927, 220, 1399, 11, 931, 17685, 25063, 5153, 198, 82, 20073, 19624, 22673, 323, 11, 304, 9919, 11, 9749, 3856, 275, 822, 308, 388, 198, 18864, 1518, 709, 311, 220, 966, 477, 220, 1272, 6978, 220, 264, 1938, 662, 1102, 374, 13240, 430, 297, 588, 436, 220, 1135, 198, 25426, 315, 1274, 449, 11102, 25896, 527, 12020, 555, 25896, 295, 5153, 304, 198, 3852, 2728, 1060, 16853, 791, 21109, 98211, 551, 84520, 91035, 374, 264, 4279, 3056, 8186, 665, 346, 304, 19624, 6890, 323, 8776, 198, 85, 36040, 348, 3864, 7911, 220, 617, 993, 12208, 532, 380, 6677, 13, 666, 3999, 649, 1422, 18728, 306, 6629, 198, 42967, 1422, 18728, 306, 26332, 65, 3695, 11, 323, 814, 1440, 902, 90687, 1295, 4375, 198, 2000, 902, 955, 315, 26332, 13, 11205, 51236, 527, 4661, 2744, 51487, 198, 438, 550, 1560, 25712, 2997, 281, 4433, 342, 367, 11, 90687, 6429, 323, 1948, 220, 950, 198, 5242, 315, 3230, 11012, 13, 578, 220, 348, 36040, 348, 3864, 7911, 220, 374, 3629, 2663, 389, 198, 258, 279, 1162, 315, 31674, 307, 5679, 49433, 323, 1156, 73575, 49433, 2288, 627, 28551, 11551, 802, 4018, 11, 719, 38913, 3062, 11, 527, 1274, 1093, 5707, 198, 782, 34475, 11, 2678, 13230, 51487, 296, 1608, 55103, 17032, 11, 55063, 198, 1677, 2857, 449, 51487, 6677, 11, 4029, 61776, 889, 617, 198, 15495, 380, 6677, 315, 51487, 2162, 51236, 323, 26677, 11, 37959, 198, 472, 58617, 4881, 11, 323, 220, 16095, 84, 348, 3864, 82553, 220, 477, 8071, 35944, 889, 4322, 8071, 198, 884, 32397, 82, 1524, 311, 279, 13112, 297, 282, 7231, 272, 6526, 533, 7677, 13, 2684, 198, 548, 1101, 810, 4689, 51487, 16088, 43195, 889, 48444, 198, 258, 924, 523, 4787, 439, 12203, 1263, 560, 264, 15953, 86139, 11, 2911, 529, 274, 19338, 323, 198, 55923, 5050, 16853, 21365, 1274, 1253, 617, 1633, 4040, 6677, 304, 198, 5730, 1543, 309, 220, 320, 83, 35320, 315, 279, 16595, 3585, 705, 220, 945, 7907, 220, 323, 220, 597, 939, 5169, 198, 74, 20306, 220, 320, 936, 29051, 2065, 705, 220, 24905, 84203, 71542, 220, 320, 26047, 2461, 12823, 340, 438, 220, 51010, 352, 3444, 220, 320, 265, 63231, 367, 270, 2781, 9864, 8, 439, 1664, 13, 10771, 311, 279, 198, 19137, 369, 220, 279, 10315, 2223, 8082, 315, 8949, 6401, 350, 9038, 275, 65125, 198, 7988, 4833, 2607, 883, 421, 297, 325, 9131, 374, 311, 5891, 35413, 1521, 2890, 12659, 304, 3116, 198, 33169, 304, 10007, 6890, 11, 1070, 4020, 27221, 387, 264, 3610, 1778, 3856, 275, 822, 308, 388, 198, 66, 977, 287, 311, 6890, 529, 274, 220, 19, 11, 5067, 12, 14898, 22277, 10977, 627, 51, 9038, 17868, 1174, 1690, 315, 1521, 2512, 2427, 1986, 617, 264, 5133, 449, 198, 50828, 1054, 81437, 863, 323, 1541, 529, 259, 6725, 11951, 369, 33384, 8895, 627, 65002, 1174, 259, 35309, 40852, 3846, 907, 389, 264, 2082, 315, 32008, 430, 5764, 2532, 311, 198, 59961, 11, 279, 1380, 2251, 315, 10151, 274, 11, 34296, 369, 19351, 323, 61876, 198, 12393, 2211, 312, 369, 682, 13, 763, 1063, 5157, 11, 43195, 4287, 264, 220, 13728, 1609, 4657, 68, 220, 320, 64, 198, 15674, 315, 315, 282, 4776, 220, 477, 264, 8902, 35594, 570, 11205, 82, 374, 539, 264, 348, 2328, 26, 304, 2144, 11, 433, 374, 198, 6518, 1109, 4461, 430, 814, 617, 2500, 2683, 11, 1778, 439, 37500, 477, 198, 8845, 19393, 1174, 439, 1664, 627, 13461, 3582, 1455, 315, 1521, 1274, 656, 539, 617, 5897, 2704, 320, 269, 198, 3323, 18768, 12, 6564, 2704, 8, 439, 6593, 43195, 11, 814, 527, 6646, 198, 1978, 71850, 568, 1604, 10242, 304, 872, 1866, 1314, 13, 23150, 11, 1778, 477, 25893, 8200, 439, 198, 1820, 220, 445, 1242, 5119, 220, 527, 27989, 220, 311, 15596, 1139, 872, 24687, 6677, 2001, 1063, 315, 198, 8370, 374, 220, 304, 959, 689, 293, 398, 1694, 5675, 289, 78942, 279, 12579, 315, 892, 13, 1789, 264, 274, 45915, 345, 6836, 315, 433, 374, 5439, 1523, 25, 7648, 12743, 5447, 16410, 5371, 872, 198, 383, 6260, 1440, 839, 3980, 98122, 4669, 281, 220, 1293, 4791, 29145, 18874, 3060, 258, 279, 1376, 315, 279, 60526, 12, 220, 559, 819, 7911, 220, 14135, 320, 76, 5642, 436, 14, 84795, 705, 477, 198, 5581, 398, 505, 220, 7126, 311, 4538, 477, 6691, 311, 10003, 662, 72131, 1174, 449, 198, 86812, 1280, 88689, 6757, 2065, 323, 4814, 315, 19624, 4363, 11, 16595, 42393, 11, 11012, 323, 198, 91512, 527, 220, 1694, 4018, 1523, 304, 279, 836, 315, 1054, 30671, 11453, 21530, 398, 1174, 439, 198, 34648, 39671, 11, 264, 40876, 9327, 706, 1027, 6051, 14000, 25, 1778, 198, 16455, 527, 5115, 3629, 927, 220, 1272, 1667, 315, 4325, 11, 323, 527, 3629, 539, 198, 10888, 287, 1523, 872, 7512, 311, 279, 1828, 9659, 439, 814, 1550, 304, 279, 198, 53520, 627, 9023, 328, 426, 452, 411, 8503, 438, 309, 13656, 304, 279, 21319, 315, 813, 2254, 1443, 10126, 27850, 13, 362, 85813, 4317, 198, 38083, 1174, 568, 50350, 813, 6696, 505, 813, 7126, 1174, 719, 1101, 16572, 520, 264, 85813, 4317, 6593, 198, 68534, 8794, 3187, 315, 279, 955, 315, 34966, 4121, 19826, 1766, 682, 927, 6890, 13, 1115, 832, 374, 369, 264, 198, 1337, 315, 7013, 5707, 430, 5727, 220, 264, 1029, 64, 220, 477, 7904, 63237, 15717, 662, 383, 6260, 11012, 198, 34648, 529, 274, 6184, 344, 384, 21730, 6067, 527, 47904, 40852, 32512, 7058, 31039, 320, 1902, 49404, 305, 34072, 617, 264, 3560, 8, 323, 433, 374, 13240, 430, 198, 3646, 11640, 1005, 54219, 17631, 5304, 24392, 2561, 6136, 30276, 436, 532, 198, 2000, 872, 36449, 2862, 689, 13, 6515, 272, 2745, 311, 279, 468, 477, 509, 6401, 198, 2244, 25893, 8082, 320, 889, 7026, 1990, 220, 1758, 11, 931, 323, 220, 2031, 11, 931, 11012, 617, 198, 82850, 603, 1608, 369, 58041, 10096, 31550, 520, 832, 892, 477, 198, 43063, 2001, 323, 304, 6890, 11791, 19432, 520, 3325, 220, 508, 11, 931, 9606, 527, 198, 15456, 11, 220, 17, 11, 931, 315, 902, 527, 31469, 42355, 19995, 304, 362, 379, 80627, 292, 198, 630, 7607, 13, 507, 282, 1521, 11, 922, 220, 5067, 527, 17037, 1511, 304, 32462, 198, 1175, 607, 309, 7026, 7019, 12601, 320, 971, 1540, 309, 7026, 5419, 31010, 11, 30668, 198, 438, 8941, 1233, 13, 468, 384, 1160, 1063, 315, 279, 1455, 3062, 11012, 505, 198, 1820, 362, 379, 80627, 292, 36449, 2862, 689, 627, 39166, 942, 689, 304, 4289, 285, 220, 473, 15299, 198, 39, 15299, 220, 320, 76, 2701, 303, 72, 8, 220, 374, 17037, 1511, 439, 264, 54631, 323, 459, 7294, 2269, 58267, 13, 578, 198, 273, 4798, 281, 938, 13677, 264, 2579, 85483, 54631, 43030, 430, 706, 459, 8136, 1913, 488, 369, 198, 65339, 287, 449, 13128, 11, 779, 706, 38328, 308, 1511, 311, 54631, 6930, 11, 7013, 1174, 39827, 944, 6341, 345, 273, 1894, 1174, 41044, 323, 39640, 2533, 279, 45967, 50093, 13, 763, 6890, 433, 374, 198, 5581, 398, 1511, 220, 439, 264, 54631, 389, 6206, 11, 7693, 323, 7013, 1174, 1418, 305, 15299, 198, 49582, 5707, 374, 1511, 439, 264, 65426, 12936, 10733, 16853, 23026, 6985, 47731, 54397, 220, 88810, 780, 50169, 32251, 198, 33, 33607, 8318, 220, 374, 264, 2678, 39999, 77140, 9974, 6136, 11, 279, 11141, 315, 902, 527, 198, 76833, 311, 387, 577, 513, 1285, 304, 57056, 24673, 26, 264, 15600, 374, 1903, 311, 1520, 198, 4291, 22709, 306, 727, 304, 2911, 13, 38130, 6821, 617, 27470, 1202, 2968, 311, 12576, 27653, 21730, 11, 1694, 8104, 11190, 449, 198, 265, 23985, 315, 1156, 20450, 11, 323, 433, 374, 1101, 1511, 304, 279, 6514, 315, 514, 782, 23707, 13801, 752, 458, 46246, 1174, 47345, 4316, 1429, 323, 810, 627, 36, 566, 11696, 64, 453, 4749, 220, 3641, 294, 50156, 198, 33, 4171, 287, 277, 19580, 220, 374, 459, 9974, 39999, 430, 374, 470, 1647, 398, 1511, 304, 279, 198, 83, 35320, 315, 6930, 19338, 323, 439, 459, 7294, 67595, 662, 1102, 374, 1101, 198, 76833, 311, 387, 31469, 282, 96978, 304, 3776, 6147, 323, 48513, 279, 7013, 323, 198, 285, 1080, 297, 2785, 389, 279, 220, 2010, 13, 1102, 1253, 1101, 387, 4529, 439, 264, 99305, 311, 1520, 449, 198, 75, 1553, 323, 87450, 268, 665, 14115, 342, 3808, 627, 46, 66, 3375, 259, 1509, 333, 9761, 372, 220, 19229, 68186, 198, 49306, 439, 27823, 68186, 11, 220, 62036, 6455, 220, 374, 459, 3062, 7891, 304, 1690, 36142, 198, 97250, 4790, 12583, 49549, 13, 1102, 374, 3026, 73352, 291, 304, 279, 220, 52632, 2111, 64, 220, 323, 279, 198, 4873, 13637, 8388, 71, 6388, 1174, 459, 294, 706, 1027, 220, 15324, 555, 279, 220, 436, 819, 285, 220, 369, 198, 339, 40137, 315, 1667, 439, 264, 10461, 39999, 304, 362, 379, 80627, 292, 6514, 13, 220, 43316, 6455, 198, 24396, 82, 527, 1511, 369, 4279, 9439, 82, 11, 55403, 11, 23152, 24673, 345, 258, 45864, 367, 11, 4851, 8624, 11, 52236, 323, 69263, 13, 220, 43316, 6455, 220, 649, 387, 198, 83261, 439, 459, 51487, 15600, 11, 304, 32720, 17138, 1376, 11, 7878, 477, 9709, 449, 198, 70, 50153, 627, 2654, 9379, 14320, 44496, 3074, 220, 8560, 95660, 10184, 198, 13699, 3967, 439, 279, 8560, 95660, 10184, 5021, 11, 279, 220, 44496, 13637, 220, 14362, 392, 706, 11141, 198, 7, 4151, 2163, 8, 430, 527, 9257, 304, 28170, 356, 323, 1841, 354, 1994, 13, 30260, 477, 32720, 273, 4798, 527, 1511, 311, 1304, 264, 1028, 264, 430, 374, 1695, 369, 31071, 331, 532, 323, 198, 561, 35401, 780, 35665, 13, 44756, 291, 11141, 527, 1511, 389, 6930, 30020, 345, 438, 264, 18459, 1903, 505, 220, 44496, 13637, 220, 19837, 374, 1511, 311, 4322, 198, 83, 392, 74554, 627, 1163, 42426, 454, 540, 263, 1167, 450, 276, 590, 288, 220, 650, 1880, 1553, 198, 21464, 311, 6890, 11, 24195, 1553, 374, 264, 350, 1097, 321, 836, 323, 2362, 350, 1097, 321, 17649, 11725, 198, 2106, 292, 992, 5829, 369, 279, 6136, 13, 12095, 296, 3653, 311, 1023, 8508, 35534, 16763, 288, 1778, 198, 300, 514, 6489, 308, 54454, 323, 6681, 2298, 6985, 11, 220, 921, 42426, 454, 540, 263, 1167, 450, 276, 590, 288, 220, 374, 264, 198, 716, 32331, 16763, 13, 578, 3789, 706, 1080, 297, 2785, 323, 78729, 6012, 11, 779, 374, 198, 830, 282, 96978, 304, 279, 6514, 315, 1048, 436 ]
0xBreath/holistic-books
opposite the navel (between lumbar 2 and 3), and the Yuang Chuan (K-1 point), the kidney point, on the soles of your feet. To locate the Ming -Men, place a string around the waist like a belt. Make it perfectly horizont al and place it across the navel. The Ming- Men lies w here the string meets the spine. When you bend over backw ard from the waist, the point feels like a hole in the spine. (Fig. 5.30) - 124 -Chapter V Ming-Men Navel The Ming-Men is located o pposite the navel between the sec ond and thir d lumbar vertebrae. Fig. 5.30 Ming- Men Point Excess energ y dow n to the Ming -Men. This dra ws the Chi and blood there. The hand can help to induce the Chi now. The right hand, like a pitcher sends out energ y; the left hand, like a catcher receives the energ y. In this way the energy can be broug ht down more easil y. - 125 -Cultivating Ovarian Power Yung-Chuan Fig. 5.31 Yuang Chuan (K-1) Point The Y uang Chuan Point: The Yuang Chuan point is the Yin- energy entry point. The Taoists regar d the soles of the feet as the roots of the body, and the root is important as the foundati on for the work of the spirit bod y. Once y ou have found the points on both feet, tape onto them spin y little balls such as prickl y chestnuts or plain tree seed pods. Place both soles on the ground and press firmly on the spin y ball w hile concentrati ng on the kidne y-1 point (also know n as the bubbling spring”). You can help guide the ener gy down to the soles by placing your left palm on the sacru m, and the right palm on the top of the head guide the energ y from the crown to the Ming -Men, down to the sacru m, do wn to the backs of the knees, and finall y to the soles through the backs of the legs. After a short time of practice you will feel the power flow to the Ming- Men. Direct it dow n through the spine and backs of the legs to the Yuang Chuan. Press do wn on the balls of the feet so that you feel the soles very distinctly. In severe cases it may take a mo nth or two to get the power into the Ming -Men and bring it down to the Yuang Chuan. If blood flows too strongly to the head during or after compression, vent the po wer by practicing the Ming- Men and Yuang Chuan exercises right after com pression. Imbalanced force will flow down the body through these two points. After practicing the exercises, many students open the Microcosmic Orbit so that their energy - 126 -Chapter V flows in a continuous circuit, and there will be no need to bring the energy down throu gh the back to the soles. Y ou can also bring it down the front of the body throug h the heart and navel, dow n to the perineum, and down to the backs of the knees to the soles. This alone has often ended high blood pressur e. Ma ny benefits of Ovarian Breathing are magnified when performed in conjunction with the Ovarian Com pression exercise. If the ovaries are too cold, there will be a reductio n in desire for sex. Ovarian Com pression, by warming the ovaries, will warm your heart as well. It helps you calm down when sexually over- excited by teaching you to consciously direct energ y into and out of the pelvic region. It builds your sexual pow er dynamicall y by using the vital Chi taken from the air and packing its charg e into your Ching Chi. Refer to Chapter 6 for more safet y tips in performing the exercises in this chapter. Fig. 5.32 Healing Love Connection - 127 -Orgasmic Upward Draw Chapter 6 Orgasmic Upward Draw A. Sexual Energy and Women In ancient times the Taoists saw men and women as worthy partners and adversa ries. Their sexual union reflected the union of Yin and Yang on the cosm ic level. Their differen t appro aches to life and problem-solving broug ht harmony to the earth. Taoists regar d man as fire and woman as w ater: Fire, when started, burns very fast and does not last long. As we mentioned earlier it takes time for water to reach its boiling point, just as it takes time to bring a woman to her boiling point. Once she reaches that point, she will maintain it for a long time. Taoists have describe d women as sexuall y superior to me n, yet we see today that many women are sexuall y unhap py. Because the response times of me n and women are different, the sexual embrace occurs, many times, w ithout the full arous al of the w oman. The vaginal spasm s which occur at this arousal level are mistaken as the total orgasm. How ever since the w oman has reached only half of her potential for orgas m, she repo rts feeling let dow n, frustrate d, alienate d, angr y, restless, and isolated. To experience the multilevel of a com plete orgasm, a w oman must be a ware that there are many steps she must cli mb, wi th each step energizing certain parts of the body. The com plete orgasm is desirable because it ener gizes and brings pleasure to the entire body. Conversel y the repeate d interru ption of orgasm at lower levels creates energy imbalances, since only some of the organs and glands are stim ulated and not the entire body. If a man can prolong his erection, he can help bring the w oman to higher levels w ith simple movements, and the couple will be able to reach the highest harmony they can attain in lovemaking. The Orgasmic Upw ard Draw (more simply referre d to in this chapter as the Orgas mic Dra w) exercise taught here is a way to increase the sexual potential of a woma n by warming up her sexual region ahea d of time to avoid this depr essing chain of events. In all of the basic sexual studies conducted, many parallels have - 128 -Chapter VI been made betw een a man’s orgasm and a woman’s orgasm, especially in what is called rhythmic pulsations, which have been measured at eight- tenths of a second. Research has also found’ that when a woman’s sexual organs are considere d as one functioning unit, the amount of erectile tissue is about the sam e as for a ma n. Therefor e, there is no reason to believe that wome n’s orgasms are any less strong or powerful than men’s. The Taoist sages noted that throug h internal alche my, women, using the same m ethod used by men of turning their aroused sexual energy inward and upw ard, can transfo rm this energ y into a pow er which fills certain reservoirs in their bodies, eventu ally enabling them to reach the ultimate spiritual acco mplish ment. The Orgas mic Draw is a prepar ation for the spiritual practices of Kan and Li, which
[ 220, 14329, 220, 279, 308, 3963, 220, 320, 42967, 41263, 2308, 198, 17, 323, 220, 220, 18, 705, 323, 279, 28372, 526, 921, 10602, 220, 320, 42, 12, 16, 1486, 705, 220, 279, 39042, 220, 1486, 11, 220, 389, 279, 198, 41500, 315, 220, 701, 7693, 627, 262, 2057, 25539, 220, 279, 56983, 482, 29819, 11, 2035, 220, 264, 925, 220, 2212, 220, 279, 29142, 1093, 264, 198, 76948, 13, 7557, 220, 433, 14268, 220, 4917, 6317, 453, 323, 2035, 220, 433, 4028, 220, 279, 308, 3963, 13, 220, 578, 198, 44, 287, 12, 11258, 15812, 289, 1618, 279, 925, 220, 20628, 279, 35776, 13, 220, 3277, 499, 37920, 198, 2017, 1203, 86, 85009, 505, 279, 29142, 11, 279, 1486, 220, 11321, 1093, 264, 14512, 220, 304, 279, 198, 2203, 483, 13, 220, 320, 30035, 13, 220, 220, 20, 13, 966, 340, 12, 220, 8874, 220, 482, 26072, 220, 650, 198, 44, 287, 50559, 198, 45, 3963, 198, 220, 578, 56983, 50559, 374, 7559, 297, 281, 13921, 279, 308, 3963, 198, 42967, 279, 5819, 389, 67, 323, 270, 404, 294, 41263, 2308, 5309, 51313, 68, 627, 30035, 13, 220, 20, 13, 966, 220, 56983, 12, 11258, 5236, 198, 256, 1398, 1140, 4602, 379, 57587, 308, 311, 279, 220, 56983, 482, 29819, 13, 1115, 45196, 18090, 279, 34382, 323, 198, 51105, 220, 1070, 13, 220, 578, 1450, 220, 649, 1520, 220, 311, 49853, 220, 279, 34382, 1457, 662, 578, 1314, 198, 10888, 11, 220, 1093, 264, 42070, 220, 22014, 220, 704, 4602, 379, 26, 279, 2163, 1450, 11, 220, 1093, 264, 220, 68898, 198, 54487, 1924, 220, 279, 4602, 379, 13, 763, 420, 220, 1648, 279, 4907, 220, 649, 387, 220, 293, 583, 70, 35423, 1523, 198, 6518, 2593, 321, 379, 627, 12, 220, 6549, 220, 482, 34, 495, 65243, 220, 507, 959, 1122, 7572, 198, 56, 2234, 30653, 10602, 198, 30035, 13, 220, 20, 13, 2148, 220, 28372, 526, 921, 10602, 320, 42, 12, 16, 8, 5236, 198, 262, 578, 816, 577, 526, 921, 10602, 220, 5236, 25, 578, 28372, 526, 921, 10602, 220, 1486, 220, 374, 279, 220, 83958, 7058, 17947, 220, 4441, 220, 1486, 13, 220, 578, 60608, 1705, 1239, 277, 294, 279, 779, 645, 220, 315, 279, 220, 7693, 439, 279, 198, 38265, 220, 315, 279, 220, 2547, 11, 323, 279, 3789, 220, 374, 3062, 220, 439, 279, 220, 1766, 9491, 389, 369, 279, 198, 1816, 315, 279, 9090, 30111, 379, 13, 9843, 379, 6033, 617, 220, 1766, 220, 279, 3585, 220, 389, 2225, 198, 1897, 295, 11, 17401, 220, 8800, 220, 1124, 220, 12903, 379, 2697, 20953, 220, 1778, 220, 439, 89800, 75, 379, 15489, 64866, 220, 477, 198, 21435, 220, 5021, 10533, 220, 55687, 13, 220, 11004, 2225, 779, 645, 389, 220, 279, 5015, 220, 323, 3577, 198, 8978, 398, 389, 279, 220, 12903, 379, 5041, 289, 305, 458, 17576, 9491, 7933, 389, 279, 220, 10585, 818, 379, 12, 16, 1486, 198, 18109, 708, 220, 1440, 308, 439, 279, 220, 78869, 9894, 220, 10683, 65312, 220, 1472, 649, 1520, 220, 8641, 220, 279, 38556, 29720, 198, 2996, 311, 279, 220, 779, 645, 220, 555, 25012, 220, 701, 2163, 33552, 389, 220, 279, 11347, 2739, 296, 11, 323, 220, 279, 198, 1315, 33552, 389, 220, 279, 1948, 315, 220, 279, 2010, 220, 8641, 220, 279, 4602, 379, 505, 220, 279, 27631, 198, 998, 279, 220, 56983, 482, 29819, 11, 1523, 311, 279, 11347, 2739, 296, 11, 656, 66580, 311, 279, 28678, 220, 315, 279, 198, 74, 69819, 11, 220, 323, 1913, 543, 379, 311, 279, 220, 779, 645, 220, 1555, 220, 279, 28678, 315, 220, 279, 14535, 627, 262, 4740, 220, 264, 2875, 220, 892, 315, 6725, 220, 499, 690, 2733, 279, 220, 2410, 6530, 311, 279, 198, 44, 287, 12, 11258, 13, 220, 7286, 220, 433, 57587, 308, 1555, 220, 279, 35776, 220, 323, 28678, 315, 279, 220, 14535, 198, 998, 279, 220, 28372, 526, 921, 10602, 13, 220, 8612, 656, 66580, 389, 279, 20953, 315, 220, 279, 7693, 779, 430, 220, 499, 198, 57676, 279, 779, 645, 220, 1633, 71249, 662, 763, 15748, 220, 5157, 220, 433, 1253, 220, 1935, 220, 264, 4647, 56229, 198, 269, 1403, 311, 636, 220, 279, 2410, 1139, 279, 56983, 482, 29819, 323, 4546, 220, 433, 1523, 311, 279, 198, 56, 69710, 921, 10602, 627, 262, 1442, 6680, 220, 28555, 2288, 16917, 220, 311, 279, 2010, 220, 2391, 220, 477, 1306, 220, 26168, 345, 688, 279, 3273, 7205, 555, 36666, 220, 279, 56983, 12, 11258, 323, 28372, 526, 921, 10602, 198, 327, 48815, 220, 1314, 220, 1306, 220, 470, 3577, 290, 13, 220, 2417, 59502, 220, 5457, 220, 690, 6530, 1523, 198, 1820, 2547, 220, 1555, 220, 1521, 220, 1403, 3585, 13, 220, 4740, 36666, 220, 279, 23783, 345, 35676, 4236, 220, 1825, 220, 279, 18654, 9594, 21914, 85557, 220, 779, 430, 872, 4907, 198, 12, 220, 9390, 220, 482, 26072, 220, 650, 198, 39240, 304, 264, 19815, 220, 16622, 11, 220, 323, 1070, 220, 690, 387, 912, 1205, 220, 311, 4546, 220, 279, 198, 17947, 220, 1523, 270, 583, 37224, 279, 1203, 220, 311, 279, 779, 645, 13, 816, 6033, 649, 1101, 4546, 220, 433, 198, 2996, 279, 4156, 315, 279, 220, 2547, 270, 583, 70, 305, 279, 4851, 220, 323, 308, 3963, 11, 220, 57587, 308, 311, 279, 198, 716, 483, 372, 11, 323, 220, 1523, 311, 279, 28678, 315, 220, 279, 31624, 220, 311, 279, 220, 779, 645, 13, 220, 1115, 198, 32676, 220, 706, 3629, 220, 9670, 220, 1579, 220, 6680, 220, 3577, 324, 384, 627, 262, 11583, 19541, 7720, 220, 315, 507, 959, 1122, 220, 11681, 44661, 220, 527, 8622, 1908, 994, 198, 716, 10365, 220, 304, 32546, 220, 449, 279, 507, 959, 1122, 220, 1219, 3577, 290, 220, 10368, 627, 2746, 279, 220, 66168, 552, 220, 527, 2288, 9439, 11, 220, 1070, 220, 690, 387, 264, 312, 1076, 822, 308, 304, 12876, 220, 369, 1877, 627, 46, 959, 1122, 220, 1219, 3577, 290, 11, 220, 555, 24808, 220, 279, 66168, 552, 11, 220, 690, 8369, 701, 4851, 198, 300, 1664, 13, 1102, 8779, 220, 499, 19858, 220, 1523, 994, 27681, 220, 927, 12, 12304, 220, 555, 198, 668, 12092, 220, 499, 311, 70903, 220, 2167, 220, 4602, 379, 1139, 323, 704, 315, 279, 220, 84168, 198, 4030, 13, 220, 1102, 22890, 220, 701, 7392, 220, 7019, 2781, 8915, 543, 379, 555, 1701, 220, 279, 16595, 198, 57735, 4529, 220, 505, 220, 279, 3805, 323, 36813, 220, 1202, 5714, 384, 1139, 701, 921, 287, 220, 34382, 627, 262, 29734, 220, 311, 15957, 220, 220, 21, 369, 810, 5653, 295, 379, 10631, 304, 16785, 220, 279, 198, 327, 48815, 220, 304, 420, 220, 12735, 627, 30035, 13, 220, 20, 13, 843, 49741, 220, 10919, 220, 11278, 198, 12, 220, 6804, 220, 482, 43537, 10753, 292, 3216, 1637, 12261, 198, 26072, 220, 21, 198, 43537, 10753, 292, 3216, 1637, 220, 12261, 198, 32, 13, 39767, 220, 12634, 220, 323, 11215, 198, 644, 14154, 220, 3115, 279, 60608, 1705, 5602, 3026, 323, 220, 3278, 220, 439, 28390, 198, 98131, 220, 323, 29511, 64, 54698, 13, 11205, 220, 7392, 220, 11552, 220, 27000, 220, 279, 11552, 220, 315, 198, 56, 258, 323, 25482, 389, 279, 56754, 18385, 2237, 13, 220, 11205, 1782, 268, 259, 3057, 264, 8696, 220, 311, 2324, 198, 438, 3575, 99246, 220, 293, 583, 70, 35423, 26348, 220, 311, 279, 9578, 627, 256, 60608, 1705, 1239, 277, 294, 893, 439, 4027, 323, 5333, 220, 439, 289, 264, 466, 25, 6785, 11, 994, 198, 47823, 11, 220, 44154, 220, 1633, 220, 5043, 323, 220, 1587, 220, 539, 1566, 1317, 13, 220, 1666, 584, 9932, 198, 686, 5741, 220, 433, 5097, 220, 892, 369, 3090, 311, 5662, 220, 1202, 50937, 220, 1486, 11, 220, 1120, 439, 433, 198, 79079, 220, 892, 311, 4546, 220, 264, 5333, 220, 311, 1077, 50937, 220, 1486, 13, 220, 9843, 220, 1364, 25501, 198, 9210, 1486, 11, 220, 1364, 690, 10519, 220, 433, 369, 220, 264, 1317, 220, 892, 627, 256, 60608, 1705, 617, 220, 7664, 294, 3278, 220, 439, 1877, 84, 543, 379, 16757, 220, 311, 757, 308, 11, 3686, 198, 906, 1518, 3432, 220, 430, 1690, 3278, 220, 527, 1877, 84, 543, 379, 31175, 391, 4611, 13, 9393, 198, 1820, 2077, 220, 3115, 315, 757, 308, 323, 220, 3278, 220, 527, 2204, 11, 220, 279, 7392, 198, 336, 32337, 220, 13980, 11, 220, 1690, 3115, 11, 289, 78942, 412, 279, 2539, 75123, 453, 315, 279, 289, 297, 1543, 627, 791, 58159, 220, 993, 10753, 274, 902, 12446, 220, 520, 420, 220, 87917, 220, 2237, 527, 220, 37104, 198, 300, 279, 220, 2860, 220, 38765, 13, 2650, 3596, 2533, 220, 279, 289, 297, 1543, 220, 706, 8813, 220, 1193, 198, 38106, 315, 1077, 220, 4754, 220, 369, 52573, 296, 11, 1364, 16246, 436, 2641, 8430, 220, 1095, 57587, 308, 345, 1658, 3497, 349, 294, 11, 20167, 349, 294, 11, 459, 911, 379, 11, 89358, 11, 220, 323, 25181, 627, 256, 2057, 3217, 220, 279, 2814, 458, 899, 315, 264, 470, 281, 1649, 220, 38765, 11, 264, 289, 297, 1543, 198, 25849, 387, 264, 51806, 430, 1070, 220, 527, 1690, 7504, 220, 1364, 2011, 22059, 10221, 11, 24129, 270, 198, 9739, 220, 3094, 220, 4602, 4954, 220, 3738, 220, 5596, 220, 315, 279, 220, 2547, 662, 578, 470, 281, 1649, 198, 1813, 10753, 374, 35946, 220, 1606, 220, 433, 38556, 342, 4861, 220, 323, 12716, 220, 17069, 220, 311, 198, 1820, 4553, 220, 2547, 13, 56496, 301, 379, 279, 6351, 349, 294, 958, 2739, 11051, 290, 220, 315, 38765, 520, 198, 15115, 5990, 11705, 220, 4907, 220, 737, 76527, 11, 220, 2533, 1193, 1063, 315, 279, 198, 1813, 598, 220, 323, 82375, 220, 527, 12936, 220, 7913, 220, 323, 539, 279, 4553, 220, 2547, 13, 1442, 264, 893, 198, 4919, 33482, 220, 813, 65146, 11, 220, 568, 649, 220, 1520, 220, 4546, 220, 279, 289, 297, 1543, 220, 311, 5190, 198, 43664, 289, 78942, 4382, 19567, 11, 323, 220, 279, 5743, 220, 690, 387, 3025, 220, 311, 5662, 198, 1820, 8592, 220, 26348, 220, 814, 649, 36861, 220, 304, 98892, 336, 1802, 627, 256, 578, 34806, 10753, 292, 3216, 86, 85009, 12261, 220, 320, 6518, 5042, 8464, 265, 294, 311, 304, 420, 198, 41326, 220, 439, 279, 220, 34806, 300, 19748, 74202, 289, 8, 10368, 220, 15972, 220, 1618, 220, 374, 264, 1648, 311, 198, 79601, 220, 279, 7392, 220, 4754, 220, 315, 264, 2413, 64, 308, 555, 24808, 220, 709, 1077, 7392, 198, 4030, 220, 264, 41033, 294, 315, 892, 311, 5766, 220, 420, 36980, 4043, 287, 220, 8957, 220, 315, 4455, 627, 256, 763, 682, 315, 279, 220, 6913, 220, 7392, 220, 7978, 220, 13375, 11, 220, 1690, 72474, 220, 617, 198, 12, 220, 4386, 220, 482, 26072, 220, 30768, 198, 82850, 220, 1903, 1297, 86, 8517, 264, 893, 753, 38765, 323, 220, 264, 5333, 753, 220, 38765, 345, 36046, 220, 304, 1148, 374, 2663, 220, 29171, 21914, 56037, 811, 1174, 902, 617, 220, 1027, 198, 2727, 40412, 220, 520, 8223, 12, 16006, 5104, 220, 315, 264, 2132, 13, 220, 8483, 220, 706, 1101, 220, 1766, 123956, 9210, 994, 264, 5333, 753, 220, 7392, 220, 36853, 220, 527, 77554, 486, 294, 439, 832, 198, 1723, 287, 220, 5089, 11, 220, 279, 3392, 315, 220, 57217, 220, 20438, 220, 374, 922, 220, 279, 10167, 384, 439, 198, 2000, 264, 7643, 308, 13, 2684, 2000, 384, 11, 1070, 220, 374, 912, 2944, 220, 311, 4510, 220, 430, 289, 638, 308, 753, 198, 1813, 300, 1026, 527, 220, 904, 2753, 3831, 220, 477, 8147, 1109, 220, 3026, 753, 627, 257, 578, 60608, 380, 274, 1154, 220, 10555, 220, 430, 270, 583, 70, 305, 5419, 220, 453, 1557, 856, 11, 3278, 345, 985, 220, 279, 1890, 296, 220, 1086, 220, 1511, 220, 555, 3026, 315, 13353, 220, 872, 220, 92624, 220, 7392, 198, 17947, 220, 63018, 323, 709, 86, 85009, 11, 649, 1380, 831, 19535, 420, 4602, 379, 1139, 264, 220, 7019, 2781, 198, 8370, 41687, 3738, 220, 45512, 82, 220, 304, 872, 220, 13162, 11, 220, 1567, 84, 31953, 28462, 198, 49818, 311, 5662, 220, 279, 17139, 18330, 220, 1046, 78, 64884, 819, 11540, 13, 578, 220, 34806, 300, 19748, 198, 8300, 220, 374, 264, 10073, 520, 290, 220, 369, 279, 18330, 220, 12659, 220, 315, 31663, 323, 220, 14851, 11, 902 ]
0xBreath/holistic-books
in the “now” are the keys to positive changes. 7. The point of power is always in the present moment.6 ANGER “I accept all my emotions with love.” Anger Checklist I am afraid of anger. If I get angry, I will lose control. I have no right to be angry. Anger is bad. When someone is angry, I get scared. It’s not safe to be angry. My parents won’t allow me to express anger. I won’t be loved if I get angry. I have to hide my anger. Stuffing anger makes me sick. I have never been angry. If I get angry, I will hurt someone. D o you recognize any of these feelings? Anger may be one of your big barriers. Anger is a natural and normal emotion. Babies get furious, express their fury and then it’s over. Many of us have learned that it’s not nice, or polite, or acceptable for us to be angry. We learn to swallow our angry feelings. Theysettle in our bodies, in the joints and muscles. They accumulate and become resentment. Layer upon layer of buried anger turned into resentment can contribute to dis-eases like arthritis, assorted pains, and even cancer. We need to acknowledge all our feelings, including anger, and find positive ways to express these feelings. We don’t have to hit people or dump on them, yet we can say simply and clearly, “This makes me angry.” Or “I am angry at what you did.” If it is not appropriate to say this, we still have many options: we can scream into a pillow. Beat the bed. Kick pillows. Run. Yell in the car with the windows rolled up. Play tennis. These are all healthy outlets. 1. What was the pattern of anger in your family? 2. What did your father do with his anger? 3. What did your mother do with her anger? 4. What did your brothers or sisters do with their anger?5. Was there a family scapegoat? 6. What did you do with your anger as a child? 7. Did you express your anger or did you stuff it? 8. What method did you use to hold it in? 9. Were you:an overeater? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Yes N0 always sick? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Yes N0 accident prone? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Yes N0 getting into fights? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Yes N0 a poor student? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Yes N0 crying all of the time? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Yes N0 10. How do you handle your anger now? 11. Do you see a family pattern? 12. Which family member are you like when it comes to expressing anger? 13. Do you have a “right” to be angry? 14. Why not? Who said so? 15. Can you give yourself permission to express all your feelings in appropriate ways? A quick and simple thing to do when you are overwhelmed with your feelings is to jump up and down several times saying in a loud voice, “Yes! No! Get off my back! Yes! No! Get off my back!” Try it. It works wonders for a quick release. If you have a lot of buried anger, you may be a person who walks around being angry all the time. The anger is smoldering just under the surface. The smallest thing will set it off. You may not express this anger, but you will mutter under your breath and have lots of resentful, judgmental thoughts. You may be a person who criticizes everyone around you. And if you do, you certainly will criticize yourself, too. So you may ask yourself: 1. What do I get from being angry all the time?2. What happens if I let go of my anger? 3. Am I willing to forgive and be free? EXERCISE: Write a Letter Think of someone who you are still angry with. Perhaps it is an old anger. Write this person a letter. Tell them all your grievances and how you feel. Don’t hold back. Really express yourself. Use additional paper if you need it.When you have finished the letter, read it once. Then fold it and on the outside write: “What I really want is your love and approval.” Then burn the letter and release it. MIRROR WORK Take another person, or the same person, you are angry with. Sit down in front of a mirror. Be sure to have some tissues nearby. Look into your own eyes and see the other person. Tell them what you are so angry about. When you are finished, tell them, “What I really want is your love and approval.” We are all seeking love and approval. That’s what we want from everyone, and that’s what everyone wants from us. Love and approval brings harmony into our lives. In order to be free, we need to release the old ties that bind us. So once again look into the mirror and
[ 17886, 33188, 197, 2118, 3409, 863, 197, 548, 33188, 81212, 198, 998, 197, 31587, 197, 19926, 627, 22, 13, 33026, 59574, 44323, 3303, 1223, 20501, 197, 33222, 17886, 33188, 3303, 2762, 2157, 13209, 13, 21, 198, 93468, 198, 10378, 197, 10543, 52060, 13938, 67304, 41356, 48048, 197, 31153, 49216, 10976, 261, 70572, 1638, 198, 25494, 197, 309, 197, 2642, 14152, 44323, 197, 4091, 627, 52792, 25494, 10582, 197, 526, 894, 11, 25494, 6831, 484, 197, 1497, 83886, 627, 25494, 9793, 525, 73204, 49021, 32809, 74242, 197, 526, 894, 627, 197, 10976, 261, 20501, 2282, 329, 627, 197, 4599, 1942, 638, 606, 20501, 197, 526, 894, 11, 25494, 10582, 31028, 1636, 627, 62635, 753, 98366, 1942, 5763, 32809, 74242, 197, 526, 894, 627, 79569, 25841, 82, 6831, 263, 1431, 197, 7331, 50394, 32809, 8285, 1911, 197, 4091, 627, 25494, 6831, 263, 1431, 74242, 197, 385, 2111, 748, 25494, 10582, 197, 526, 894, 627, 25494, 9793, 525, 32809, 197, 8727, 13938, 197, 4091, 627, 197, 87722, 287, 197, 4091, 2157, 2094, 50394, 1942, 875, 627, 25494, 9793, 525, 197, 37593, 74242, 268, 197, 526, 894, 627, 52792, 25494, 10582, 197, 526, 894, 11, 25494, 6831, 484, 9793, 5757, 1942, 638, 606, 627, 35, 198, 78, 197, 9514, 197, 34551, 553, 197, 3852, 44323, 197, 45010, 1186, 96551, 826, 30, 197, 10976, 261, 2157, 352, 74242, 197, 606, 44323, 14862, 414, 2282, 343, 198, 2308, 17740, 627, 10976, 261, 20501, 11575, 9215, 4688, 53577, 197, 8416, 67304, 6082, 13, 13083, 98141, 10582, 1186, 28626, 11, 8285, 1911, 33188, 404, 198, 69, 3431, 53577, 59733, 24263, 753, 197, 2017, 13, 197, 8607, 44323, 71275, 9793, 525, 197, 12964, 291, 64442, 24263, 753, 98366, 9215, 560, 11, 82266, 3303, 337, 635, 11, 82266, 198, 38116, 2066, 71275, 32809, 74242, 197, 526, 894, 13, 197, 1687, 197, 12964, 32809, 78395, 7331, 197, 414, 197, 526, 894, 1186, 96551, 826, 13, 197, 7009, 751, 11489, 17886, 197, 414, 2282, 10233, 11, 17886, 33188, 12710, 14737, 53577, 2157, 355, 19153, 13, 197, 7009, 197, 99487, 53577, 2282, 52521, 198, 2762, 479, 13, 197, 9368, 197, 59723, 67086, 44323, 2282, 324, 1142, 197, 4091, 197, 42286, 2129, 78, 197, 2762, 479, 94036, 198, 444, 2248, 32809, 35697, 5773, 2315, 197, 4908, 70440, 40485, 11, 197, 395, 13909, 3303, 1771, 11, 53577, 7883, 1055, 1470, 11967, 627, 1687, 197, 17483, 32809, 197, 474, 52286, 52060, 197, 414, 1186, 96551, 826, 11, 197, 16564, 197, 4091, 11, 53577, 81703, 197, 31587, 198, 2336, 32809, 8285, 1911, 197, 45010, 1186, 96551, 826, 13, 197, 1687, 2765, 263, 1431, 9793, 525, 32809, 95878, 197, 16455, 82266, 2765, 1538, 25653, 197, 49818, 345, 47492, 197, 906, 94036, 1942, 352, 1942, 318, 2603, 53577, 41508, 398, 11, 197, 31378, 2157, 2094, 50394, 197, 526, 894, 2029, 197, 2244, 197, 10378, 197, 309, 197, 526, 894, 36547, 198, 12840, 197, 9514, 2765, 307, 2029, 52792, 24263, 20501, 98366, 197, 29228, 32809, 1942, 352, 2090, 11, 197, 906, 18895, 484, 9793, 525, 197, 35676, 36600, 512, 906, 94036, 1942, 47100, 2129, 78, 11575, 3303, 97023, 13, 197, 44758, 33188, 2282, 291, 13, 40440, 875, 3303, 484, 4336, 13, 87052, 13, 66422, 616, 17886, 33188, 1470, 277, 198, 4291, 33188, 6831, 1519, 197, 21621, 60910, 13, 197, 9315, 197, 2002, 26209, 13, 197, 9673, 197, 548, 52060, 197, 38128, 14294, 10145, 627, 16, 13, 197, 3923, 6831, 300, 33188, 3303, 3307, 44323, 197, 4091, 17886, 14862, 414, 1186, 5285, 5380, 17, 13, 197, 3923, 2765, 307, 14862, 414, 1186, 1894, 20530, 48048, 9793, 285, 197, 4091, 5380, 18, 13, 197, 3923, 2765, 307, 14862, 414, 2157, 1605, 20530, 48048, 197, 1964, 197, 4091, 5380, 19, 13, 197, 3923, 2765, 307, 14862, 414, 2282, 299, 3058, 82266, 1942, 9487, 20530, 48048, 33188, 404, 197, 4091, 30, 20, 13, 17749, 300, 197, 19041, 11575, 1186, 5285, 1942, 5443, 3427, 266, 5380, 21, 13, 197, 3923, 2765, 307, 197, 9514, 20530, 48048, 14862, 414, 197, 4091, 61551, 11575, 59491, 5380, 22, 13, 197, 7131, 197, 9514, 8285, 1911, 14862, 414, 197, 4091, 82266, 2765, 307, 197, 9514, 18895, 1386, 24263, 5380, 23, 13, 197, 3923, 43357, 2765, 307, 197, 9514, 42919, 32809, 197, 6416, 24263, 17886, 5380, 24, 13, 17749, 486, 197, 9514, 25, 276, 197, 70030, 977, 30, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 1602, 197, 9642, 198, 18822, 15, 198, 33222, 1942, 875, 30, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 1602, 9642, 1602, 18822, 15, 198, 4575, 1748, 26736, 606, 30, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 1602, 9642, 1602, 18822, 15, 198, 51210, 2129, 78, 1186, 2866, 30, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 1602, 9642, 1602, 18822, 15, 198, 64, 3303, 10922, 197, 12307, 30, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 1602, 9642, 1602, 18822, 15, 198, 66, 28609, 52060, 44323, 33188, 22724, 30, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 197, 13, 1602, 9642, 1602, 18822, 15, 198, 605, 13, 197, 4438, 20530, 197, 9514, 54922, 14862, 414, 197, 4091, 82022, 5380, 806, 13, 197, 5519, 197, 9514, 197, 4151, 11575, 1186, 5285, 3303, 3307, 5380, 717, 13, 197, 23956, 1186, 5285, 2157, 1402, 197, 548, 197, 9514, 197, 4908, 61280, 24263, 197, 6716, 32809, 8285, 1911, 287, 198, 4091, 5380, 1032, 13, 197, 5519, 197, 9514, 9793, 525, 11575, 197, 2118, 1315, 863, 32809, 74242, 197, 526, 894, 5380, 975, 13, 197, 10445, 98366, 30, 197, 15546, 1942, 3864, 197, 708, 5380, 868, 13, 6391, 276, 197, 9514, 3253, 535, 14862, 414, 726, 197, 23443, 32809, 8285, 1911, 52060, 14862, 414, 1186, 96551, 826, 17886, 198, 29228, 197, 2336, 5380, 32, 197, 28863, 53577, 1942, 6592, 197, 1626, 32809, 20530, 61280, 197, 9514, 197, 548, 197, 2017, 16005, 2106, 48048, 14862, 414, 198, 57676, 826, 20501, 32809, 12710, 1538, 60910, 53577, 2765, 785, 85786, 17998, 3324, 1769, 1942, 17718, 17886, 11575, 8986, 3023, 197, 10063, 11, 197, 86508, 4999, 2822, 0, 38754, 197, 1885, 13938, 78546, 0, 197, 9642, 0, 197, 2822, 0, 38754, 197, 1885, 13938, 78546, 18319, 10473, 894, 24263, 13, 62635, 197, 19033, 6831, 28413, 2066, 198, 64, 197, 28863, 17643, 1655, 627, 2746, 197, 9514, 9793, 525, 11575, 8986, 354, 44323, 2282, 324, 1142, 197, 4091, 11, 197, 9514, 2157, 352, 74242, 11575, 99905, 197, 14965, 6831, 1727, 82, 197, 20019, 198, 35214, 197, 526, 894, 52060, 33188, 22724, 13, 33026, 197, 4091, 20501, 73123, 2061, 287, 197, 4345, 197, 8154, 33188, 1942, 10730, 13, 33026, 198, 3647, 19790, 197, 1626, 6831, 484, 8360, 24263, 197, 1885, 13, 197, 2675, 2157, 352, 98366, 8285, 1911, 2090, 197, 4091, 11, 2282, 332, 197, 9514, 6831, 484, 198, 76, 6339, 197, 8154, 14862, 414, 2282, 265, 589, 53577, 9793, 525, 8986, 2469, 44323, 197, 2762, 1285, 11, 12710, 664, 9247, 278, 197, 61665, 82, 13, 197, 2675, 198, 18864, 74242, 11575, 99905, 197, 14965, 1470, 50308, 4861, 7883, 1225, 606, 197, 20019, 197, 9514, 13, 197, 3112, 748, 197, 9514, 20530, 11, 197, 9514, 198, 66, 7770, 398, 6831, 484, 1470, 50308, 553, 14862, 414, 726, 11, 32809, 78, 13, 78012, 197, 9514, 2157, 352, 197, 1091, 14862, 414, 726, 512, 16, 13, 197, 3923, 20530, 25494, 10582, 43827, 197, 35214, 197, 526, 894, 52060, 33188, 22724, 30, 17, 13, 197, 3923, 9793, 680, 729, 748, 25494, 10428, 31780, 44323, 13938, 197, 4091, 5380, 18, 13, 197, 6219, 25494, 6831, 9585, 32809, 1186, 1813, 535, 53577, 74242, 17389, 5380, 3337, 28534, 9311, 25, 1602, 8144, 11575, 197, 35364, 198, 39787, 44323, 1942, 638, 606, 197, 14965, 197, 9514, 197, 548, 18895, 484, 197, 526, 894, 48048, 13, 197, 32576, 24263, 198, 20501, 1602, 276, 62928, 198, 4091, 13, 61473, 2090, 99905, 11575, 197, 9638, 13, 10473, 616, 197, 49818, 52060, 14862, 414, 3253, 462, 5230, 3095, 53577, 197, 5269, 197, 9514, 198, 57676, 13, 197, 8161, 1431, 197, 6416, 78546, 13, 197, 49885, 8285, 1911, 14862, 414, 726, 13, 96123, 13008, 3079, 3303, 3271, 198, 748, 1602, 9514, 198, 17483, 24263, 51861, 197, 9514, 9793, 525, 1186, 25682, 33188, 197, 9638, 11, 38143, 24263, 197, 13486, 13, 197, 12487, 1186, 820, 24263, 53577, 25653, 33188, 198, 68090, 25990, 25, 197, 44130, 25494, 17643, 750, 51880, 20501, 14862, 414, 197, 31153, 53577, 197, 55539, 2029, 197, 12487, 2282, 399, 33188, 198, 9638, 53577, 17643, 1655, 24263, 627, 44, 88617, 17749, 10874, 198, 18293, 197, 43063, 99905, 11, 82266, 33188, 1942, 373, 99905, 11, 197, 9514, 197, 548, 197, 526, 894, 48048, 13, 7721, 275, 2765, 785, 17886, 198, 7096, 44323, 11575, 2157, 29912, 13, 197, 3513, 1942, 554, 32809, 9793, 525, 1942, 638, 3324, 18934, 9215, 686, 1729, 13, 197, 10596, 2129, 78, 14862, 414, 197, 785, 198, 58331, 53577, 197, 4151, 33188, 197, 1605, 99905, 13, 10473, 616, 197, 49818, 197, 12840, 197, 9514, 197, 548, 197, 708, 197, 526, 894, 197, 9274, 627, 4599, 197, 9514, 197, 548, 1186, 25682, 11, 3324, 616, 197, 49818, 11, 197, 44130, 25494, 17643, 750, 51880, 20501, 14862, 414, 197, 31153, 53577, 198, 55539, 2029, 197, 1687, 197, 548, 52060, 197, 26797, 287, 197, 31153, 53577, 197, 55539, 13, 197, 4897, 753, 197, 12840, 197, 906, 51880, 43827, 198, 93057, 11, 53577, 64442, 753, 197, 12840, 7883, 1225, 606, 6831, 1821, 43827, 71275, 13, 15420, 1009, 53577, 197, 55539, 81355, 826, 198, 13279, 65527, 2129, 78, 197, 414, 8986, 1924, 627, 644, 43345, 32809, 74242, 17389, 11, 197, 906, 197, 17483, 32809, 17643, 1655, 33188, 62928, 3324, 552, 64442, 2282, 485, 71275, 13, 78012, 197, 13486, 198, 33871, 197, 7349, 2129, 78, 33188, 2157, 29912, 53577 ]
0xBreath/holistic-books
to oxidize (the same process that turns fat rancid), cells readily absorb it. Like sharks roaming the cell, free radicals will attack almost any molecule; the extent of the damage they do is so wide that the free-radical theory of aging has grown in popularity with each passing decade. Free radicals provide an excellent example of entropy at work, for the changes they produce tend to be one way, irreversible, and permanent.Wrinkled skin is less orderly than unwrinkled skin, and normally it does not repair itself. Likewise, when you break a dish, the damage to the plate is irreversible. This is because entropy follows the arrow of time. Once something orderly breaks apart, the dispersed matter and energy won’ t automatically come back together again. The future holds only more disorder: The bits of broken crockery will eventually get broken into smaller bits, and the aging skin will eventually wither and die. Paradoxically, free radicals are necessary to life. Chemically the body’ s free radicals are mostly unstable variations of the oxygen atom (hydrogen peroxide and hydroxyl are two common examples) that vary from their stable parent by having an extra electric charge in the outer electron shell. This apparently minor change makes free radicals want to bind instantly with nearby molecules in order to offset the extra charge and become stable. Thus a free radical is really a temporary stopping-point leading from one stable molecule to another. The normal life span of such unstable particles can be measured in thousandths of a second; millions of these fleeting molecules are emitted in every cell as it processes life-giving oxygen through the metabolism of food. If free radicals are so pernicious, why does the body produce them? Far from being loose bullets careening around the cell, free radicals fit into the body’ s overall balance. In some instances, they are extremely good to have: white cells in the immune system use free radicals to bond with invading bacteria and viruses and kill these invaders. In that role, the free radical’ s tendency to latch onto anything in sight saves your life. To protect itself from damage, every cell produces enzymes to degrade, neutralize, and detoxify free radicals. These “free-radical scavengers” include various antioxidants (such as superoxide dismutase and catalase) that can bond to highly reactive oxygen ions and render them harmless before they attack a vulnerable molecule. Once again, the balance of creation and destruction is the real issue, not the molecules or the chemical reactions involv ed. At the very origin of life, with the appearance of simple bacteria, Nature had already figured out how to counter free radicals by generating antioxidant enzymes. If this provision hadn’ t been made, the oxygen in our atmosphere could easily have destroyed the chances of lifeon Earth ; instead, thanks to the cellular intelligence that pushes against entropy, oxygen made life possible. Millions of people have become acquainted with the free-radical theory of aging thanks to the success of the 1983 book Life Extension by Durk Pearson and Sandy Shaw. The premise of their approach is that free radicals are the body’ s enemy, and readers are therefore urged to dose themselves with a wide variety of antioxidants. However, the eminent Japanese medical investigator Dr. Yukie Niwa, himself a staunch proponent of the free-radical theory, has demo nstrated in the laboratory that dosing a culture of cells with antioxidants usually does little to decrease free-radical productio n. It would be still less effective for a person to swallow these antioxidants. Many would be nullified by digestive juices in the mouth, stomach, and intestines long before they got to the cells they were meant to protect. Even so, life extenders swallow all manner of antioxidants in the form of vitamins, food additives, and prescription drugs. Among the most touted are vitamins C and E (two substances Dr. Niwa found particularly unsuccessful when he applied them to test-tube cells). Ironically, life extenders tend to be highly health-co nscious people, the sort who used to believe that food additives should be banned from bread, crackers, cookies, cereals, and other processed foods. Now, to follo w the dictates of life extensio n, the same people find themselves taking food preservatives such as BHT and BHA in massive amount s compared to the few parts per million neede d to keep a loaf of bread from going stale on the grocery shelf. More exotic prescription drugs with antioxidant properties include Hyder gine, L-dopa, and bromocriptine, none of which was originally intended to be taken for antiaging purposes. Each of these is a potent drug rife with side effects; each can cause permanent damage if taken in overdoses or for too long. The life-extension pharmacy hardly stops there. Throw in some other favorite antiaging supplements—beta carotene, the whole vitamin B complex, zinc, and selenium—and you are supposed to have armed yourself with the best, scientifically validated defense against the body’ s self-destruction through free radicals. But why should we believe that the body is self-destructive to begin with? The whole life-extension enterprise, I believe, misses the point. The damage caused by free radicals is secondary, not causal, just as the bulletfired from a gun cannot take responsibility for pulling the trigger. In its normal state, the body controls free radicals as a matter of course. Your body is not blindly fighti ng for its life against “bad” chemicals; such a notion is far too simplistic. If you could view a cell as it produces its myriad free radicals and myriad antioxidants at the same time, you would see the two floating around in the same environment, not like loose cannons on the deck but closely monitored and controlled by DNA ’s superlative intelligence. Both are kept in balance and used as they need to be. The main reason why free radicals hold such a strong appeal for scientists is that they are things; they fill our need for physica l objects that can be weighed, measured, labeled. There is no denying that free-ra dical damage occurs and is suspiciously linked with aging, along with cancer and heart disease, the two leading causes of death. Yet it has not been shown that older people necessarily have higher levels of free radicals in their cells or lower levels of antioxidants. What I’d like to suggest is that free-radical damag e is but one type of imbalance that can occur at the level of cellular intelligence when the balance tips toward entropy. If the body’ s intelligence is at full strength, disorder and chaos do not attack a cell. The basic tenet of life extension— preventing free-radical damage before it occurs—is sound. To do that, however, we need to understa nd how to influence a cell’s intelligence directly. Exercise: Working Against Entropy One of the simp lest ways to prevent entropy is to give the body something to do. In physics, entropy is opposed by work, which is defined as the orderly applicati on of energy. Without work, energy simply dissipates. We have already seen that mental and physical neglect (the “disuse syndrome”) promotes prema ture aging. No group is at higher risk for depression, disease, and early death than people who are completely sedentary, and by now the value of regular exercise for all age groups has been well documented. Physiologists used to believe that exercise primarily benefitsus at young ages, when muscl es are in their prime developm ental stage. However, research with the elderly has conclusively demonstrated that someone who takes up exercise at any age, including centenarians, will receive the same increase in strength, stamina, and muscle mass. (This is true for both men and women, by the way; in the past most exercise research was conducted on men, but now it has been established that women need to be just as active at every age.) One special advantage exercise delivers is that it can reverse the previous effects of entropy. Researcher s at Tufts University, where the federal government sponsors a major center for the study of human aging, have demonstrated that the major symptoms of biological aging can be improved through increased activity (the ef fect is boosted with secondary emphasis on improved diet). Two Tufts scien tists, William Evans and Brian Rosenber g, have outlined these findings in their book Biomarkers. The title refers to the ten markers for age that are now considered reversible: Lean body (muscle) mass Strength Basal metabolic rate Body fat Aerobic capacity Blood pressure Blood-sugar tolerance Cholesterol/HDL ratio Bone density Body temperature regulation These markers typically grow worse as people age. There are many variations from individual to individual; yet before the Tufts findings emer ged, normal aging was defined to include the following:   1.  Muscle mass. The average American loses 6.6 pounds of muscle with each decade after young adulthood; the rate of loss increases after age 45.  2.  Strength. Older people are less strong because bundles of muscles and motor nerves (called “motor units”) have been deteriorating. Between the ages of 30 and 70, the average person loses 20 percent of the motor units in the thighs,
[ 311, 36172, 553, 320, 1820, 1890, 1920, 430, 10800, 8834, 436, 1149, 307, 705, 7917, 31368, 198, 3518, 30986, 433, 13, 9086, 61535, 69353, 279, 2849, 11, 1949, 74356, 690, 3440, 4661, 904, 198, 76, 55269, 26, 279, 13112, 315, 279, 5674, 814, 656, 374, 779, 7029, 430, 279, 1949, 95855, 950, 198, 94304, 315, 30084, 706, 15042, 304, 23354, 449, 1855, 12579, 13515, 627, 11180, 74356, 3493, 459, 9250, 3187, 315, 48602, 520, 990, 11, 369, 279, 198, 19926, 814, 8356, 8541, 311, 387, 832, 1648, 11, 93294, 11, 323, 15690, 1196, 35465, 839, 6930, 374, 2753, 85869, 1109, 15375, 35465, 839, 6930, 11, 323, 14614, 433, 1587, 539, 198, 77539, 5196, 13, 50487, 11, 994, 499, 1464, 264, 12269, 11, 279, 5674, 311, 279, 12235, 374, 198, 404, 265, 65398, 13, 1115, 374, 1606, 48602, 11263, 279, 18404, 315, 892, 13, 9843, 198, 34431, 85869, 18808, 10980, 11, 279, 77810, 5030, 323, 4907, 2834, 529, 259, 198, 28172, 7167, 2586, 1203, 3871, 1578, 13, 578, 3938, 10187, 1193, 810, 198, 4338, 1382, 25, 578, 9660, 315, 11102, 14425, 377, 727, 690, 9778, 636, 11102, 1139, 198, 9181, 261, 9660, 11, 323, 279, 30084, 6930, 690, 9778, 449, 261, 323, 2815, 627, 4368, 40197, 2740, 1174, 1949, 74356, 527, 5995, 311, 2324, 13, 19531, 2740, 279, 2547, 529, 274, 198, 10816, 74356, 527, 10213, 45311, 27339, 315, 279, 24463, 19670, 320, 67229, 4469, 198, 716, 55189, 323, 17055, 87, 4010, 527, 1403, 4279, 10507, 8, 430, 13592, 505, 872, 198, 29092, 2748, 555, 3515, 459, 5066, 220, 9249, 6900, 304, 279, 16335, 17130, 12811, 627, 2028, 14132, 9099, 2349, 3727, 1949, 74356, 1390, 311, 10950, 22571, 198, 4291, 14373, 35715, 304, 2015, 311, 4445, 279, 5066, 6900, 323, 3719, 15528, 627, 45600, 264, 1949, 18336, 374, 2216, 264, 13643, 23351, 16983, 6522, 505, 832, 198, 29092, 43030, 311, 2500, 662, 578, 4725, 2324, 9575, 315, 1778, 45311, 19252, 198, 4919, 387, 17303, 304, 16579, 17323, 315, 264, 2132, 26, 11990, 315, 1521, 96435, 198, 76, 82206, 527, 48042, 304, 1475, 2849, 439, 433, 11618, 2324, 2427, 2299, 24463, 198, 20322, 279, 39097, 315, 3691, 627, 2746, 1949, 74356, 527, 779, 824, 77, 9824, 11, 3249, 1587, 279, 2547, 8356, 1124, 30, 13759, 198, 1527, 1694, 20784, 34164, 2512, 6147, 2212, 279, 2849, 11, 1949, 74356, 220, 5052, 1139, 279, 198, 2664, 529, 274, 8244, 8335, 13, 763, 1063, 13422, 11, 814, 527, 9193, 1695, 311, 617, 512, 5902, 7917, 304, 279, 22852, 1887, 1005, 1949, 74356, 311, 11049, 449, 83631, 198, 65, 78852, 323, 42068, 323, 5622, 1521, 91321, 13, 763, 430, 3560, 11, 279, 1949, 18336, 529, 274, 198, 83, 21906, 311, 58026, 8800, 4205, 304, 14254, 27024, 701, 2324, 627, 1271, 6144, 5196, 505, 5674, 11, 1475, 2849, 19159, 56067, 311, 96630, 345, 60668, 553, 11, 323, 61987, 1463, 1949, 74356, 13, 4314, 1054, 10816, 95855, 950, 83750, 15232, 89874, 1012, 5370, 81115, 320, 21470, 439, 2307, 55189, 834, 7129, 521, 323, 34454, 521, 340, 9210, 649, 11049, 311, 7701, 56563, 24463, 65125, 323, 3219, 1124, 53997, 198, 15145, 814, 3440, 264, 20134, 43030, 13, 9843, 1578, 11, 279, 8335, 315, 198, 38475, 323, 19814, 374, 279, 1972, 4360, 11, 539, 279, 35715, 477, 279, 11742, 198, 265, 4109, 4457, 85, 1608, 13, 2468, 279, 1633, 6371, 315, 2324, 11, 449, 279, 11341, 315, 4382, 198, 65, 78852, 11, 22037, 1047, 2736, 25720, 704, 1268, 311, 5663, 1949, 74356, 555, 198, 7642, 1113, 70339, 56067, 13, 1442, 420, 17575, 19117, 529, 259, 1027, 220, 1903, 11, 279, 198, 78, 19472, 304, 1057, 16975, 1436, 6847, 617, 14763, 279, 17393, 315, 2324, 263, 9420, 2652, 4619, 11, 9523, 311, 279, 35693, 11478, 430, 41802, 2403, 198, 50250, 1174, 24463, 1903, 2324, 3284, 627, 12608, 919, 315, 1274, 617, 3719, 73734, 449, 279, 1949, 95855, 950, 10334, 198, 1073, 30084, 9523, 311, 279, 2450, 315, 279, 220, 3753, 18, 2363, 9601, 27571, 220, 555, 20742, 74, 198, 92140, 942, 323, 39485, 36285, 662, 578, 41302, 315, 872, 5603, 374, 430, 1949, 74356, 198, 548, 279, 2547, 529, 274, 9354, 1174, 323, 13016, 527, 9093, 28932, 311, 19660, 5694, 198, 4291, 264, 7029, 8205, 315, 81115, 13, 4452, 1174, 279, 84629, 11002, 6593, 198, 43114, 58182, 2999, 13, 58763, 648, 22652, 10196, 11, 5678, 264, 82721, 463, 1166, 315, 279, 1949, 95855, 950, 198, 94304, 1174, 706, 17074, 308, 496, 660, 304, 279, 27692, 430, 8924, 287, 264, 7829, 315, 7917, 449, 198, 519, 42651, 1821, 6118, 1587, 2697, 311, 18979, 1949, 95855, 950, 2027, 822, 308, 13, 1102, 1053, 198, 1395, 2103, 2753, 7524, 369, 264, 1732, 311, 42276, 1521, 81115, 13, 9176, 198, 41450, 387, 854, 1908, 555, 60071, 65959, 304, 279, 11013, 11, 23152, 11, 323, 39408, 1572, 198, 4930, 1603, 814, 2751, 311, 279, 7917, 814, 1051, 8967, 311, 6144, 627, 13461, 779, 11, 2324, 13334, 388, 42276, 682, 11827, 315, 81115, 304, 279, 1376, 315, 198, 55911, 38925, 11, 3691, 85286, 11, 323, 22866, 11217, 13, 22395, 279, 1455, 67528, 527, 198, 55911, 38925, 356, 323, 469, 320, 20375, 33155, 2999, 13, 22652, 10196, 1766, 8104, 46025, 198, 9493, 568, 9435, 1124, 311, 1296, 2442, 3845, 7917, 570, 94980, 1174, 2324, 13334, 388, 8541, 311, 387, 198, 12156, 398, 2890, 23283, 308, 23995, 1274, 11, 279, 3460, 889, 1511, 311, 4510, 430, 3691, 198, 723, 51454, 1288, 387, 21501, 505, 16385, 11, 94911, 11, 8443, 11, 28091, 1147, 11, 323, 1023, 198, 35122, 15657, 662, 4800, 1174, 311, 9630, 385, 289, 279, 80330, 315, 2324, 1327, 729, 822, 308, 11, 279, 1890, 198, 16455, 1505, 5694, 4737, 3691, 1685, 79629, 1778, 439, 426, 2607, 323, 426, 17455, 304, 198, 27428, 535, 3392, 274, 7863, 311, 279, 2478, 5596, 824, 3610, 1205, 68, 294, 311, 2567, 264, 198, 385, 2642, 315, 16385, 505, 2133, 51451, 389, 279, 30687, 28745, 627, 7816, 39418, 22866, 11217, 449, 70339, 6012, 220, 2997, 198, 31916, 1126, 342, 483, 11, 445, 1773, 40952, 11, 323, 94571, 511, 462, 418, 483, 11, 7000, 315, 902, 574, 13517, 198, 396, 2954, 311, 387, 4529, 369, 7294, 4210, 10096, 13, 9062, 315, 1521, 374, 264, 36875, 5623, 198, 81, 1643, 449, 3185, 6372, 26, 1855, 649, 5353, 15690, 5674, 422, 4529, 304, 198, 2017, 67, 20274, 477, 369, 2288, 1317, 13, 578, 2324, 81639, 33400, 20781, 18417, 1070, 627, 23949, 304, 1063, 220, 1023, 7075, 7294, 4210, 33690, 2345, 19674, 1841, 354, 1994, 11, 279, 198, 67733, 28170, 426, 6485, 11, 49601, 11, 323, 37045, 17223, 499, 527, 10171, 311, 198, 19553, 17903, 6261, 449, 279, 1888, 11, 74647, 33432, 9232, 2403, 198, 1820, 2547, 529, 274, 659, 6953, 3099, 1555, 1949, 74356, 627, 4071, 3249, 1288, 584, 4510, 430, 279, 2547, 374, 659, 97322, 535, 311, 3240, 198, 4291, 30, 578, 4459, 2324, 81639, 20790, 11, 358, 4510, 11, 43394, 279, 1486, 13, 578, 198, 43965, 9057, 555, 1949, 74356, 220, 374, 14580, 1174, 539, 59557, 11, 1120, 439, 279, 17889, 69, 2757, 505, 264, 6166, 4250, 1935, 12014, 369, 23062, 279, 8346, 662, 763, 1202, 198, 8416, 1614, 11, 279, 2547, 11835, 1949, 74356, 439, 264, 5030, 315, 3388, 627, 7927, 2547, 374, 539, 89447, 4465, 72, 7933, 369, 1202, 2324, 2403, 1054, 14176, 863, 26333, 280, 21470, 264, 23035, 374, 3117, 2288, 78630, 13, 1442, 499, 1436, 1684, 264, 2849, 439, 433, 19159, 1202, 198, 2465, 47639, 1949, 74356, 323, 52909, 81115, 520, 279, 1890, 892, 11, 220, 499, 1053, 198, 4151, 279, 1403, 19596, 2212, 304, 279, 1890, 4676, 11, 539, 1093, 20784, 98014, 198, 263, 279, 9722, 719, 15499, 41223, 323, 14400, 555, 15922, 18217, 82, 2307, 75, 1413, 198, 93375, 13, 11995, 527, 8774, 304, 8335, 323, 1511, 439, 814, 1205, 311, 387, 13, 578, 1925, 198, 20489, 3249, 1949, 74356, 3412, 1778, 264, 3831, 14638, 369, 14248, 374, 430, 814, 198, 548, 2574, 26, 220, 814, 5266, 1057, 1205, 369, 4571, 3074, 326, 6302, 430, 649, 387, 47712, 345, 2727, 40412, 11, 30929, 627, 3947, 374, 912, 41566, 430, 1949, 59401, 294, 950, 5674, 13980, 323, 374, 32427, 398, 198, 44233, 449, 30084, 11, 3235, 449, 9572, 323, 4851, 8624, 11, 279, 1403, 6522, 198, 936, 4881, 315, 4648, 662, 14968, 433, 706, 539, 1027, 6982, 430, 9191, 1274, 14647, 198, 19553, 5190, 5990, 315, 1949, 74356, 304, 872, 7917, 477, 4827, 5990, 315, 198, 519, 42651, 1821, 13, 3639, 358, 7070, 1093, 311, 4284, 374, 430, 1949, 95855, 950, 3824, 351, 384, 374, 719, 832, 198, 1337, 315, 68331, 430, 649, 12446, 520, 279, 2237, 315, 35693, 11478, 994, 198, 1820, 8335, 10631, 9017, 48602, 662, 1442, 279, 2547, 529, 274, 11478, 374, 520, 2539, 8333, 345, 4338, 1382, 323, 28013, 656, 539, 3440, 264, 2849, 13, 578, 6913, 5899, 295, 315, 2324, 9070, 2345, 198, 1762, 82920, 1949, 95855, 950, 5674, 1603, 433, 13980, 55434, 5222, 13, 2057, 656, 430, 345, 98936, 1174, 584, 1205, 311, 14653, 64, 15953, 1268, 311, 10383, 264, 2849, 753, 11478, 198, 20384, 398, 16853, 53809, 25, 22938, 30241, 4968, 18237, 198, 4054, 315, 279, 12714, 64606, 5627, 311, 5471, 48602, 374, 311, 3041, 279, 2547, 220, 2555, 198, 998, 656, 13, 763, 22027, 11, 48602, 374, 16475, 555, 990, 11, 902, 374, 4613, 439, 279, 198, 1382, 398, 4666, 9491, 389, 315, 4907, 13, 17586, 990, 11, 4907, 5042, 93522, 988, 13, 1226, 198, 19553, 2736, 3970, 430, 10723, 323, 7106, 39332, 320, 1820, 1054, 4338, 817, 28439, 863, 340, 25475, 6429, 864, 1764, 259, 554, 30084, 13, 2360, 1912, 374, 520, 5190, 5326, 369, 18710, 345, 67, 56407, 11, 323, 4216, 4648, 1109, 1274, 889, 527, 6724, 11163, 306, 661, 1174, 323, 555, 198, 3409, 279, 907, 315, 5912, 10368, 369, 682, 4325, 5315, 706, 1027, 1664, 198, 6190, 291, 13, 13101, 72, 22012, 1511, 311, 4510, 430, 10368, 15871, 7720, 355, 520, 3995, 17051, 11, 994, 3167, 566, 1560, 527, 304, 872, 10461, 2274, 76, 1218, 278, 6566, 627, 11458, 1174, 3495, 449, 279, 29920, 706, 84082, 3210, 21091, 430, 198, 90579, 889, 5097, 709, 10368, 520, 904, 4325, 11, 2737, 2960, 268, 30627, 11, 690, 198, 42993, 279, 1890, 5376, 304, 8333, 11, 61784, 11, 323, 16124, 3148, 13, 320, 2028, 374, 198, 1904, 369, 2225, 3026, 323, 3278, 1174, 555, 279, 1648, 26, 304, 279, 3347, 1455, 10368, 198, 61564, 574, 13375, 389, 3026, 11, 719, 1457, 433, 706, 1027, 9749, 430, 198, 65762, 1205, 311, 387, 1120, 439, 4642, 520, 1475, 4325, 29275, 4054, 3361, 9610, 10368, 28421, 374, 430, 433, 649, 10134, 279, 3766, 198, 81524, 315, 48602, 662, 8483, 261, 274, 520, 29749, 45544, 3907, 1174, 1405, 279, 6918, 198, 87863, 39701, 264, 3682, 4219, 369, 279, 4007, 315, 3823, 30084, 11, 617, 198, 67, 7439, 496, 660, 430, 279, 3682, 13803, 315, 24156, 30084, 649, 387, 13241, 198, 20322, 7319, 5820, 320, 1820, 31469, 282, 440, 374, 65208, 449, 14580, 25679, 389, 198, 318, 96608, 10173, 570, 9220, 29749, 45544, 1156, 3675, 259, 1705, 11, 12656, 30563, 323, 17520, 35120, 655, 342, 345, 19553, 33740, 1521, 14955, 304, 872, 2363, 91608, 91141, 13, 220, 578, 2316, 19813, 311, 279, 198, 2002, 24915, 369, 4325, 430, 527, 1457, 6646, 81193, 512, 49862, 2547, 320, 38827, 9326, 8, 3148, 198, 53957, 198, 34703, 278, 41861, 4478, 198, 5561, 8834, 198, 32, 261, 31906, 8824, 198, 52586, 7410, 198, 52586, 1355, 8734, 25065, 198, 1163, 35244, 24240, 16931, 11595, 198, 63429, 17915, 198, 5561, 9499, 19812, 198, 9673, 24915, 11383, 3139, 220, 11201, 439, 1274, 4325, 13, 2684, 220, 527, 1690, 198, 959, 17583, 505, 220, 3927, 311, 3927, 26, 3686, 1603, 279, 29749, 45544, 14955, 198, 41996, 53293, 11, 4725, 30084, 574, 4613, 311, 2997, 279, 2768, 512, 4194, 4194, 16, 13, 4194, 4194, 62698, 9326, 3148, 13, 220, 578, 5578, 3778, 33291, 220, 21, 13, 21, 16701, 315, 16124, 198, 4291, 1855, 13515, 1306, 3995, 64033, 26, 279, 4478, 315, 4814, 12992, 198, 10924, 4325, 220, 1774, 13, 4194, 4194, 17, 13, 4194, 4194, 53957, 13, 220, 55025, 1274, 527, 2753, 3831, 1606, 49707, 315, 198, 38827, 19153, 323, 9048, 50581, 320, 44982, 1054, 59088, 8316, 33611, 617, 1027, 198, 67, 1430, 2521, 1113, 13, 28232, 279, 17051, 315, 220, 966, 323, 220, 2031, 11, 279, 5578, 1732, 198, 50441, 220, 508, 3346, 315, 279, 9048, 8316, 304, 279, 60611, 11 ]
0xBreath/holistic-books
thecom- plaints)arebetterforsittingdownandlettingthe limbshangdown(notsittingcrosslegged).Thesweat- ingmaybeprofuseandoccursonclosingtheeyes (anotherstrangesymptom)aswellasduringsleep. EMOTIONAL/MENTAL SYMPTOMS Anxious.Depressed.Memoryweak.Sensitiveto noise.Slow. Thesearemelancholicpeoplewhosebrainsseizeup afteraperiodofmentalstrain.Theycan'tread,and theymaysitlookingvacant,feelinganxiousandnot wantingtowork.Theyareeasilystartledbynoise, andtheireyesaresensitivetolight(althoughnot inflamed).Womenfeelworse,physicallyandemo- tionally,beforetheirperiods,whentheyfinditmore difficulttoconcentrateandwhenthevfeelgenerally miserable.thepersonhastosituptocough.Heorsheisunableto coughoutthemucus;itisswallowed,andthenthe personhastoliedowntorest.Thecoughisexhausting andisoftenaccompaniedbyafever. Dizzy SymptomsWithturningsensation. Worseformovingorturningtheheadquickly;for lyingdown. Thepersonfeelsasifheorsheisturninginacircle, andcannotwatchmovingobjects.Betterwhenquite stillwitheyesclosed. Exhaustion Withtrembling;numbness. Betterforfreshair. Worseforslightestexertion;afterstool;forwalking. Injuries SymptomsInjuries:ofbreasts;oftesticles;stonyhard lumps,sensitive,swollen,cold,inflamed. Injuredpartsbecomelumpyandpainfulandfeel stonyhard.Afterabangorabruisethereistingling withstitchingpains. Insomnia SymptomsSleepiessbeforemidnight.Withnight- mares. Periodproblems SymptomsBreasts:lumpy;stitchingpains.With exhaustion(seeabove). Worsebeforemenstrualperiod. Thebreastsfeelheavy,andswellbeforeaperiod. Thetypicalemotionalmentalsymptomswillalsobe present. PHYSICALCOMPLAINTS Breastfeedingproblems SymptomsBreastlumpsworseinrightbreast. Thesebreastlumpsarenotnecessarilypainful. Cough SymptomsCough:dry;irritating;tickling;violent; mustsitupassoonascoughstarts.Expectoration: difficult;mustswallowwhatcomesup. Worselyingdowninbed;intheevenings;fordeep breathing;duringfever. Thecoughiscausedbyadry,ticklingspotinthe larynx;itstartsonfirstlyingdown(dayornight)andCuprummetallicum (Cupr.) Commonname:copper Copperisareddish-brown metallicelementthatis minedinmanycountriesthroughouttheworld.Itisa malleablemetal,andwasthefirstmetalusedtomake toolsandweapons.Thoughitisverysoftonitsown,it canbehardenedbybeingmixedwithothermetals (withtintomakebronzeandwithzinctomakebrass, forexample).Copperisaverygoodconductorofheat andelectricity,anditisusedtomakeelectricwiresand cablesandwaterpipes.Itisalsousedinagreatvariety ofpigmentsforartists'powders,andwascommonlv 84•Dioscorea(Dios.) INTERNALMATERIAMEDICA usedbydoctorsandvetsatonetimeinointmentsfor wounds. Copper'spoisonousqualitieswerefirstnotedin coppersmiths,whenworkerssufferedfromchronic poisoning,withcolic,diarrhoea,cough,anddifficulty withassimilationoffoodbeingthemainsymptoms. Acutepoisoning israre,withsymptomsofviolent stomachcramps,vomiting,paleface,icy-coldextrem- ities,restlessnessatnightandviolentheadache. Ifthe sufferersurvivesthenliverdiseasealwaysfollows. Thehomeopathicpreparation ismadefromthe trituratedpuremetal. GENERALSYMPTOMS Extremitiescold.Face:blue;pale.Lipsblue.Taste: sweet.Painscramping. Betterforcolddrinks. Worsefortouch;forvomiting. CrampsareanimportantpartoftheCuprumpicture; themusclesfeelknottedup.Thetirednessisfrom mentalexhaustionorsometimesfromlossofsleep, andtheheadachesandcrampsmaywellfollowa periodofheavywork.Cuprumtypeslookpaleand drawnandhavebluishlips. EMOTIONAL/MENTAL SYMPTOMS Restlessatnightinbed. Thisremedydoesnothaveastrong'character'; its generalsymptomsandspecificcomplaintswilllead youtoprescribe it. PHYSICALCOMPLAINTS Colic SymptomsPains:cramping;violent.Withnausea; VOMITING. Thebellyissore,bruised,tenderandhot. Convulsions Causesteethingchildren;vexation. Theseconvulsionsareaccompaniedbybluelipsand coldhandsandfeet(seecough). Seekprofessionaladviceimmediately. Cough SymptomsBreathing: difficult;fast.Cough:inlong fitsatirregularintervals;uninterrupted; suffocative; violent;whooping. Betterforsipsofcoldwater. Althoughdrinkingcoldwaterhelpsthecough(likeCausticum)coldaircanaggravate it.Theremaybea metallictasteinthemouth.Duringacoughing fitthe childloseshisbreathandthengoesstiff,andthenmay gointoaconvulsionwithfingersandtoestwitching. Betweenthecoughingfitsthebreathingishurriedand panting.Thisisaveryseriouscoughandisfrightening forparents-professionalhelpshouldalwaysbe soughtimmediately.Meanwhile,Cuprumwillgive reliefifprescribedatthistime;theneedforother medicationmaythenbeavoided. Cramp SymptomsCramp:incalves;feet;legs. Causeschildbirth. Exhaustion SymptomsHeadachebetweentheeyes. Causeslossofsleep;mentalexhaustion. Dioscorea (Dios.) Familyname:Dioscoreaceae Othernames:devil'sbones;dioscoreavillosa,wild yam,colicroot Dioscoreaisaperennialcreeperorvinethatgrowswild inhedgesandentwinedaroundtreesandother objectsinthesouthernStatesofNorthAmerica.Ithas INTERNALMATERIAMEDICA Droserarotundifolia(Dros.)•85 longbeenrespectedasaneffectivecureofcertain typesofbiliouscolic. Thehomeopathicpreparation ismadefromthe plant'slong,knottedroot,whichisgatheredin Septemberandchoppedandpoundedtoapulp.This ismixedwithalcoholandlefttostandforeightdaysin adark,coolplacebeforebeingstrainedandsuccussed. GENERALANDEMOTIONAL/ MENTALSYMPTOMS Dioscorcaisasmallremedythathasnogreatgeneralor emotional/mental symptoms,butitissuchanim- portantcolicremedy,especiallyinbabies,thatIhave included ithere. PHYSICALCOMPLAINTS Colic SymptomsInbabies.Belly:rumbling;windy.Pains: cramping;cutting;griping;aroundthenavel;twisting. Betterforbendingback;forstretchingout. Worseforbendingforward;duringthemorning. Infantsarchbackandscream(theoppositeofthe Colocyiithispicturewithitsdrawingupoflegs).They haverumblv,windyturnsanddonotwanttoliedown butarebetterforbeingheldupright. Droserarotundifolia (Dros.) Familyname:Droseraceae Othernames:dewplant;round-leavedsundew, moor-grass;redrot;youthwort;roseedusoleil Droserarotundifolia isasmallperennialcarnivorous plantthatgrowsclosetothegroundonmossy,turfy, marshygroundthroughoutBritain,northernEurope, northernAsiaandNorthAmerica. ItflowersinJuly andAugustbuttheflowersthemselvesareopenonly inthemornings-theyclosewhenthesunisatits height.Theleavesareinterestingfortheircurious abilitytotrapinsects;theiruppersurfacesarecovered withlongredhairswithglandsthatsecreteafluidto helptraptheinsectandthen'digest'it.Thesesecre- tionsshineinthesunlightandlooklikedewdrops, henceitsnickname. Droserawasusedbyphysiciansofthesixteenth centuryfortreatingtuberculosisbuttheherbalist Ger
[ 339, 66274, 7058, 32397, 82, 8, 548, 58234, 69, 1105, 15154, 2996, 438, 1169, 1303, 1820, 198, 4763, 65, 939, 526, 2996, 1471, 2469, 15154, 29942, 1978, 3640, 570, 1016, 288, 906, 266, 7058, 287, 18864, 65, 752, 299, 96692, 438, 511, 2407, 942, 86877, 1820, 58331, 198, 39602, 1605, 496, 5637, 1631, 80797, 8, 300, 9336, 300, 71792, 826, 3583, 627, 2783, 55101, 984, 14, 5441, 984, 16466, 44, 2898, 1937, 50, 198, 2127, 30351, 35948, 14715, 72262, 13451, 815, 729, 275, 344, 11269, 198, 53318, 815, 10516, 627, 9673, 548, 28226, 3581, 7918, 16455, 86243, 33725, 325, 553, 455, 198, 10924, 3271, 3205, 1073, 93221, 78726, 11829, 3418, 276, 956, 888, 51526, 198, 20670, 76, 954, 275, 20986, 54803, 519, 11, 1897, 20659, 276, 30351, 438, 1962, 198, 53757, 76019, 363, 672, 76369, 548, 68, 30149, 599, 472, 839, 1729, 53318, 345, 438, 1820, 556, 9891, 5518, 729, 275, 99754, 337, 492, 7, 37241, 1962, 198, 258, 1517, 3690, 570, 36190, 57676, 86, 11073, 11, 42305, 2740, 438, 6868, 7058, 28491, 750, 8568, 4746, 50828, 19862, 82, 11, 1336, 306, 36661, 3990, 275, 6518, 198, 13798, 3951, 998, 444, 1189, 7853, 438, 1336, 306, 81913, 57676, 7642, 750, 198, 76, 12329, 481, 13991, 752, 1293, 71, 561, 35154, 7717, 511, 1409, 52425, 1105, 383, 285, 47028, 998, 198, 66, 1409, 412, 49818, 38601, 26, 275, 1056, 86, 21642, 51526, 339, 306, 383, 198, 9164, 71, 561, 337, 1142, 13197, 42519, 11829, 66, 1409, 76353, 15424, 287, 198, 438, 285, 61917, 73087, 22840, 1729, 5763, 424, 627, 35, 91591, 198, 29012, 52273, 2409, 413, 826, 42725, 627, 54, 11073, 630, 9308, 371, 54444, 1820, 2025, 28863, 398, 26, 2000, 198, 6852, 2996, 627, 791, 9164, 1897, 2053, 300, 333, 383, 1105, 383, 380, 54444, 258, 582, 7219, 345, 438, 34360, 14658, 66215, 19761, 1823, 22120, 9493, 84270, 198, 44466, 89619, 36661, 3380, 9443, 627, 849, 15424, 290, 198, 2409, 83, 1864, 9894, 26, 2470, 65, 2136, 627, 56351, 2000, 72408, 1334, 627, 54, 11073, 69, 1105, 4238, 478, 327, 531, 290, 26, 10924, 267, 1786, 26, 2000, 81749, 627, 644, 90927, 198, 29012, 52273, 644, 90927, 25, 1073, 21152, 12019, 26, 14450, 478, 4440, 26, 267, 3633, 19221, 198, 75, 12055, 10900, 19245, 11, 2332, 33389, 10317, 820, 54788, 1517, 3690, 627, 644, 80491, 18753, 17106, 316, 301, 6895, 438, 92724, 1285, 438, 57676, 198, 267, 3633, 19221, 37992, 370, 526, 269, 370, 2739, 285, 774, 486, 11330, 2785, 198, 4291, 267, 1641, 287, 79, 1771, 627, 15841, 50405, 198, 29012, 52273, 42845, 72, 434, 15145, 16497, 9471, 27216, 9471, 7058, 63636, 627, 24684, 96440, 198, 29012, 52273, 51329, 12019, 89497, 6895, 26, 267, 1641, 287, 79, 1771, 27216, 198, 327, 15424, 290, 7, 4151, 49532, 4390, 54, 11073, 15145, 5794, 496, 940, 19862, 627, 791, 21152, 12019, 57676, 89945, 51526, 2332, 616, 15145, 3271, 3205, 627, 1016, 295, 1100, 292, 22317, 41964, 479, 1147, 1631, 80797, 2332, 484, 1147, 15784, 198, 29844, 627, 11079, 9579, 15942, 8867, 2989, 32, 3301, 50, 198, 51329, 561, 46519, 96440, 198, 29012, 52273, 51329, 561, 75, 1538, 2332, 11073, 258, 1315, 21152, 561, 627, 9673, 21152, 561, 75, 12055, 548, 1962, 77, 4093, 277, 321, 1100, 467, 1285, 627, 34, 1409, 198, 29012, 52273, 34, 1409, 41522, 894, 26, 404, 1018, 1113, 26, 35255, 2785, 26, 90162, 280, 25849, 47965, 455, 395, 9186, 5171, 1409, 66976, 82993, 7769, 512, 13798, 3951, 26, 25849, 2332, 7331, 12840, 6716, 455, 627, 54, 1105, 989, 287, 2996, 258, 2788, 26, 258, 1820, 17206, 826, 26, 2000, 33980, 198, 21152, 44661, 26, 82977, 1897, 424, 627, 791, 66, 1409, 285, 936, 2656, 1729, 329, 894, 14287, 875, 19342, 19644, 258, 1820, 198, 75, 661, 24244, 26, 275, 2527, 942, 3983, 6852, 2996, 38434, 1540, 492, 8, 438, 34, 455, 10952, 55108, 416, 372, 320, 34, 455, 81, 29275, 11076, 609, 49131, 18994, 198, 34, 18994, 285, 548, 634, 819, 1481, 4935, 9501, 4859, 1001, 339, 3689, 198, 1083, 31501, 1543, 3418, 1656, 376, 13744, 71, 1458, 412, 16142, 1410, 28628, 10994, 198, 76, 5164, 481, 55108, 51526, 86, 561, 383, 3983, 55108, 2656, 38501, 731, 198, 16297, 438, 85865, 5221, 1409, 20000, 1225, 3594, 263, 1220, 785, 80824, 198, 4919, 1395, 19221, 6901, 1729, 35214, 57785, 4291, 1605, 4150, 1147, 198, 17411, 83, 396, 316, 731, 68557, 3059, 438, 4291, 89, 7956, 316, 731, 1347, 395, 345, 1348, 87, 1545, 570, 34, 18994, 285, 25727, 19045, 444, 36869, 1073, 20559, 198, 438, 64465, 488, 51526, 20000, 2656, 38501, 731, 64465, 86, 3946, 438, 198, 66, 4893, 438, 13284, 87820, 28628, 285, 1147, 788, 31501, 351, 1244, 30265, 2676, 198, 1073, 90600, 1392, 2000, 77735, 6, 22491, 12601, 51526, 16514, 5581, 22580, 198, 5833, 6806, 35, 3614, 2202, 64, 5549, 3614, 6266, 73755, 44, 19706, 40, 70622, 32101, 198, 2656, 1729, 3055, 12816, 438, 85, 1441, 24444, 4199, 258, 60617, 2000, 198, 86, 3171, 627, 34, 18994, 596, 5481, 3416, 788, 83465, 52898, 3983, 1962, 31501, 198, 66, 32542, 44774, 82, 11, 9493, 56058, 82, 2084, 291, 1527, 7562, 292, 198, 5481, 3416, 287, 11, 4291, 2119, 292, 11, 8747, 1138, 77035, 64, 10317, 1409, 51526, 72964, 198, 4291, 395, 318, 13763, 1885, 1411, 35214, 49818, 1771, 1631, 52273, 627, 32, 10453, 752, 78, 3416, 287, 94662, 548, 11, 4291, 24738, 80797, 708, 69, 90162, 198, 267, 316, 613, 5192, 14989, 14605, 316, 5977, 7385, 1604, 1594, 11, 2912, 1824, 820, 428, 1864, 7058, 1385, 11, 4014, 33028, 266, 9471, 438, 90162, 2025, 1815, 13, 1442, 1820, 198, 82, 2084, 388, 97860, 344, 478, 12301, 75, 1553, 67, 56407, 33222, 19070, 82, 627, 791, 5227, 62209, 1762, 36235, 374, 20920, 830, 442, 1820, 198, 376, 53030, 660, 52833, 55108, 627, 95836, 80334, 2898, 1937, 50, 198, 6899, 1864, 1385, 88172, 71897, 25, 12481, 57013, 1604, 1236, 3153, 12481, 844, 5642, 512, 95928, 1087, 1771, 5192, 31557, 627, 56351, 2000, 2119, 634, 81, 15872, 627, 54, 11073, 4057, 3102, 26, 2000, 85, 316, 5977, 627, 16384, 14989, 548, 276, 15693, 4581, 1073, 1820, 34, 455, 81, 1538, 3911, 280, 49818, 355, 19153, 57676, 19639, 15889, 455, 5221, 295, 2757, 2136, 285, 1527, 198, 479, 56975, 15424, 290, 1105, 12982, 1527, 2353, 708, 3933, 3583, 345, 438, 1820, 2025, 14576, 438, 5192, 1141, 3647, 352, 9336, 19070, 64, 198, 19862, 1073, 89945, 1816, 732, 455, 10952, 9426, 7349, 79, 1604, 438, 198, 7788, 77, 438, 19553, 2067, 51220, 75, 3153, 627, 2783, 55101, 984, 14, 5441, 984, 16466, 44, 2898, 1937, 50, 198, 12698, 1752, 266, 9471, 258, 2788, 627, 2028, 1864, 9497, 28156, 2201, 339, 525, 64, 4620, 6, 19740, 7112, 1202, 198, 7642, 1147, 1631, 52273, 2914, 15934, 884, 32397, 2332, 484, 27152, 198, 88, 412, 454, 417, 3191, 433, 627, 11079, 9579, 15942, 8867, 2989, 32, 3301, 50, 198, 6255, 292, 198, 29012, 52273, 47, 1771, 25, 5192, 31557, 26, 90162, 27216, 3458, 817, 64, 280, 53, 1937, 964, 1753, 627, 791, 9978, 398, 1056, 461, 11, 33713, 4147, 14287, 1693, 438, 10847, 627, 35992, 14630, 919, 198, 62012, 5455, 2350, 5988, 26, 85, 327, 367, 627, 9673, 12296, 14630, 919, 548, 73087, 22840, 1729, 2067, 4088, 3153, 438, 198, 88172, 89112, 438, 1897, 295, 10698, 762, 1409, 4390, 40450, 66886, 329, 1805, 318, 44287, 627, 34, 1409, 198, 29012, 52273, 51329, 44661, 25, 5107, 26, 9533, 732, 1409, 25, 258, 4930, 198, 30322, 266, 404, 23108, 396, 43298, 26, 359, 55905, 291, 26, 8657, 511, 1413, 280, 90162, 26, 14965, 34807, 627, 56351, 69, 1105, 575, 708, 8480, 820, 13284, 627, 16179, 3696, 16113, 88172, 13284, 8823, 267, 42750, 1409, 7, 4908, 23389, 592, 86231, 48086, 820, 1334, 4919, 351, 36490, 349, 433, 844, 1964, 336, 50891, 64, 198, 55108, 21937, 5642, 48121, 87141, 920, 1711, 582, 1409, 287, 5052, 1820, 198, 3124, 2353, 4385, 285, 21152, 589, 438, 339, 833, 7217, 267, 3168, 51526, 3473, 18864, 198, 70, 787, 20103, 12296, 34003, 4291, 69, 14437, 438, 998, 478, 5656, 287, 627, 57299, 906, 306, 42750, 1409, 287, 6410, 267, 383, 21152, 44661, 819, 324, 4588, 438, 198, 79, 519, 287, 5221, 9667, 25727, 94427, 66, 1409, 438, 285, 69, 1315, 6147, 198, 2000, 26534, 93408, 16151, 8823, 5562, 33222, 1395, 198, 82, 2509, 318, 44287, 1345, 5420, 3556, 11541, 455, 10952, 14724, 47530, 198, 3833, 4843, 333, 24544, 17890, 266, 339, 380, 547, 26, 339, 1994, 291, 2000, 1605, 198, 2106, 20901, 18864, 3473, 1395, 48956, 291, 627, 16384, 1141, 198, 29012, 52273, 16384, 1141, 25, 2910, 278, 2396, 26, 1897, 295, 26, 73336, 627, 23389, 4881, 3124, 28813, 627, 849, 15424, 290, 198, 29012, 52273, 12626, 1815, 29651, 906, 306, 383, 58331, 627, 23389, 4881, 2353, 708, 3933, 3583, 26, 479, 56975, 15424, 290, 627, 35, 3614, 2202, 64, 320, 35, 3614, 29275, 15547, 609, 64943, 3614, 2202, 114785, 198, 46, 6456, 986, 25, 81252, 596, 82091, 100249, 3614, 2202, 402, 66037, 64, 25576, 699, 198, 88, 309, 52596, 2823, 354, 198, 35, 3614, 2202, 2852, 3271, 32331, 66, 770, 26904, 9799, 774, 266, 70, 1849, 68974, 198, 21538, 17327, 438, 306, 86, 1619, 20019, 91512, 438, 1605, 198, 1735, 16319, 6509, 283, 6456, 24137, 1073, 26287, 32132, 2506, 339, 300, 198, 51525, 44, 19706, 40, 70622, 32101, 57967, 805, 277, 354, 1263, 333, 39260, 5549, 3714, 6266, 6806, 5313, 198, 4930, 82850, 417, 4136, 300, 2194, 40784, 66, 554, 1073, 66, 7770, 198, 9426, 1073, 49938, 1245, 2119, 292, 627, 791, 5227, 62209, 1762, 36235, 374, 20920, 830, 442, 1820, 198, 21494, 596, 4930, 16539, 77, 15889, 2959, 11, 8370, 285, 96825, 31501, 198, 30649, 438, 331, 18033, 438, 79, 13382, 998, 391, 13136, 29845, 198, 2191, 3366, 4291, 278, 11353, 438, 2414, 83, 537, 438, 1348, 492, 14097, 258, 198, 329, 847, 11, 43296, 2050, 15145, 35214, 58827, 2914, 14912, 59942, 627, 95836, 1111, 95406, 55101, 984, 6018, 5441, 984, 80334, 2898, 1937, 50, 198, 35, 3614, 6133, 936, 285, 10753, 543, 1864, 9497, 339, 589, 66636, 540, 1244, 25615, 269, 198, 336, 41964, 14, 93221, 13803, 100004, 275, 1056, 1412, 16348, 7058, 403, 519, 2119, 292, 1864, 9497, 11, 36046, 258, 48822, 552, 11, 9210, 40, 19553, 198, 83722, 78942, 486, 627, 11079, 9579, 15942, 8867, 2989, 32, 3301, 50, 198, 6255, 292, 198, 29012, 52273, 644, 48822, 552, 1823, 12160, 25, 10952, 9894, 26, 19703, 88, 1087, 1771, 512, 5192, 31557, 26, 10453, 1303, 26, 70, 4664, 287, 26, 20019, 3473, 3963, 26, 15930, 11330, 627, 56351, 2000, 65, 2518, 1445, 26, 2000, 73184, 287, 412, 627, 54, 11073, 2000, 65, 2518, 13741, 26, 82977, 49818, 80675, 627, 19998, 1821, 1132, 1445, 2914, 47100, 31524, 454, 13921, 1073, 1820, 198, 6255, 34946, 72, 411, 13391, 3911, 4291, 1220, 81949, 455, 1073, 73336, 570, 7009, 198, 71, 7403, 372, 2067, 85, 11, 19703, 88, 413, 92346, 15357, 354, 53757, 21220, 1142, 785, 198, 8248, 548, 58234, 2000, 35214, 28708, 455, 1315, 627, 35, 299, 805, 277, 354, 1263, 333, 39260, 320, 35, 3714, 29275, 15547, 609, 64943, 299, 805, 114785, 198, 46, 6456, 986, 41522, 365, 21494, 26, 1067, 31307, 4234, 82, 1263, 365, 345, 6489, 269, 25313, 395, 26, 1171, 4744, 71963, 2969, 32251, 26, 299, 23425, 355, 1286, 321, 198, 35, 299, 805, 277, 354, 1263, 333, 39260, 374, 10753, 543, 716, 32331, 66, 1923, 344, 20857, 198, 21494, 9210, 70, 1849, 33678, 751, 8942, 797, 1067, 263, 76, 3746, 88, 14287, 30463, 88, 345, 37339, 88, 1993, 20322, 412, 91838, 10337, 269, 6456, 31880, 345, 45807, 6456, 39563, 438, 26287, 32132, 13, 1102, 89770, 258, 29527, 198, 438, 32559, 8248, 339, 830, 15115, 31177, 12116, 4372, 548, 2569, 3323, 198, 48121, 336, 52785, 7716, 1216, 5669, 1336, 306, 17082, 359, 285, 266, 1220, 198, 2627, 11829, 273, 4798, 548, 88657, 2000, 50828, 2407, 1245, 198, 2968, 28879, 4714, 258, 55529, 26, 50828, 455, 32390, 324, 7760, 548, 21468, 198, 4291, 4930, 1171, 51729, 22966, 70, 1974, 267, 9379, 325, 9537, 64, 67125, 998, 198, 8823, 57014, 1820, 258, 9885, 438, 3473, 4265, 15505, 6, 275, 5221, 84836, 762, 265, 7058, 28491, 26618, 483, 258, 6509, 359, 4238, 438, 7349, 44336, 365, 91612, 345, 71, 768, 1220, 40513, 627, 35, 299, 805, 675, 300, 2656, 1729, 42305, 9818, 1073, 6509, 953, 46487, 198, 1189, 3431, 4057, 73910, 83, 392, 74554, 8248, 1820, 1964, 13616, 380, 198, 66497 ]
0xBreath/holistic-books
not launch, to those, superior universes? Swiftly I shrivel at the thought of God, At nature and its wonders, Time and Space and Death, But that I, turning, call to thee O soul, thou actual Me, Thou matest Time, smilest content at Death, And fillest, swellest full the vastness of Space. The key phrase in this passage, for me, is “... thou actual Mex And so it is with you, no different than Walt Whitman or anyone else in the universe. This concludes the fourth principle of spiritual manifestation. A summary of this principle tells us that there is an intelligence and a power in all of nature that is creative and responsive. This intelli- gence is amenable to suggestion from us. 69 WAYNE W. DYER You are a part of nature and of this intelligence that is greater than any single individual. The individual you are is also a particularized form of this intelligence. This infinite power is in all things and all space, and it will manifest from the spiritual or formless energy that is in the unseen world into the world of form and boundaries. When we know this beyond a doubt, and put it into practice in our lives, we will see the pictures of our hearts’ desires transformed into our outer reality. The fifth principle explains the importance of our feeling absolutely worthy of receiving these gifts. 70 HONORING YOUR WORTHINESS TO RECEIVE The Fifth Principle n order to become a manifester, literally taking part in the process of co-creating your life and attracting to yourself the objects of your heart’s desires, you must know that you are worthy of receiv- ing. This will mean examining the attitudes that you knowingly and unknowingly hold about your life. Your thoughts, which are the architects of the foundation of your material world, are what you want to examine. Manifesting involves using the power of your inner world to craft a fuller relationship with life and attract to you what you desire. You can remind yourself all day long that the same power that brought anything into the physical world also brought you, but if you do not 71 WAYNE W. DYER feel worthy, you will disrupt the natural flow of energy into your life and create a blockage that makes manifestation impossible. The fifth principle reminds you that you are worthy of abundance. If your thoughts are based on an image of unworthiness for any rea- son at all, you will manifest what those thoughts impart to the uni- versal mind. The energy described in the fourth principle will align with what it is that you radiate. “As a man thinks, so is he,” are not empty words. They state a basic truth of how the universe works. Thinking that abundance is incompatible with spirituality is a myth that influences many of us and is the largest impediment there is to feeling worthy. SELFISH? The myth that abundance and spirituality are incompatible is fueled by thoughts that it is selfish and improper to visualize and desire material things. Let’s examine this attitude and determine if you have been influenced into believing it to be your truth. Take a look around your world and notice the abundance and end- lessness of our universe. It goes on and on, beyond our ability to imagine its vastness. This abundance flows from the same energy that comprises our fundamental essence. It is you. You are it. Make no mistake about it. Material form is how spirit makes itself known to us while we are in form ourselves. Spirit manifests in trees, oceans, fish, birds, min- erals, vegetables, flowers and you. All that you see around you is a part of the material manifestation of spirit. Matter is not an illusion, or something that ought not to be, but is the necessary means through which spirit differentiates itself on this plane of existence. To feel that it is selfish or non-spiritual to desire and manifest is to divide the world of spirit and the world of matter into polar oppo- sites. When we adopt an attitude of spirit being incompatible with matter, we are denying the spirit that is in matter as its originating 72 Manifest Your Destiny energy. We also deny the validity of ourselves as spiritual beings. There is no reason to feel ashamed of wanting things to come into your life. It is far better to have an attitude of deserving whatever shows up in your life and to be willing to participate in the dance of creation as a co-creator. When we shift to seeing that together they comprise one harmonious whole, we remove the stigma of selfish- ness. Just as each of us is one harmonious whole comprised of spirit and matter, so, too, is the entire universe. The process of life taking form is a mystery. That mystery is gov- erned by a creative energy that is knowable when we genuinely feel worthy of receiving its blessings in form. Abundance is the way of the creative force in the universe. You are entitled to have abundance in your life, and to radiate prosperity to all that you encounter in your world. Nothing is gained by making yourself small and insignificant other than to manifest smallness and insignificance in your life. To facilitate an attitude of deserving abundance, it will be helpful to examine what you want to change in order to cultivate this know- ing at the cellular level of your being. THE CORE COMPONENTS OF WORTHINESS Everything that you need to master in order to make this fifth principle a working model in your life is available as a mental activity. You do not need to go out into the world and conquer it in any way. It is simply a matter of changing your mind about your basic worthi- ness to receive all of God’s blessings, be they material or otherwise. There has been a lot of effort put into conditioning us to feel unworthy of having all that life has to offer. Most of us have accepted a lot of the stuff that egos have thrown our way, beginning with our arrival as infants. Certainly there is nothing wrong with an attitude of poverty and asceticism. If this is your path, you know it deep within syourself and you know that God appears in all things material and nonmaterial. Spirit cannot be divided into better or worse, depend- 73 WAYNE W. DYER ing on which of God’s creations you opt to have or not have in your life. Feeling worthy of any blessings or desires is a feature of your inner life. To remove the stigma of materialistic selfishness you may need to rearrange your inner perceptions. Here are the major perceptions of beings who know they are worthy and deserving of all of God’s bless- ing. 74 My self-esteem comes from myself. This person’s statement of his or her inner perception might be something like the following: “As a child of God, my worthiness is a given. I am not divided into spirit and body, rather, I am a part of the all-knowing creation called God itself. I am a human expressing God without reserva- tion or restraint.” One of the reasons children are often able to express genius is because they have not yet been hypnotized by the idea of being limited. If they are able to resist this hypnotic spell, they remain geniuses and are able to express their unlimited selves through- out their lives on earth. Too often the ideas of other egos are what constitute our impressions of ourselves as unworthy. We listen to the admoni- tions of others who have low self-regard, and who are attempting to exert influence and power over us. We then take on the exter- nal validations of our unworthiness and begin to see ourselves as some significant others would have us believe we are. It is beyond the scope of most young children to resist these ideas. But, as adults, we can look back at this hypnosis and free our- selves from its absurdity. You must know within that you are a part of the light that lighteth every man. You are evidence of the existence of God, and in your own particularized individuality, you have God within you. Therefore, you must be able to say with conviction, Manifest Your Destiny “God is me, and I am God.” It is this truth that will free you from your feelings of unworthiness to attract to yourself all that you desire. Think of your own desires to manifest as having been placed there by spirit, and that those desires, which are housed in love and service, are precisely what God wants to give you, and that your desire is the direct path to receiving those blessings. Let go of the idea that desire is selfishness and remind yourself that if you had no desires ever, you would still be living an infantile existence with toys in a sandbox. Whenever you feel unworthy of having your manifestations arrive, remind yourself that no one is unworthy and that the same divine energy that flows through you flows through all of God’s children and that all are worthy. This includes you. Your desires are the very tools that allow you to grow and experience the perfection of the universe. They take you beyond any limitations that you might have embraced and lead you to a higher spiritual awareness. Even the idea of achieving enlighten- ment and mastery is
[ 539, 7195, 11, 311, 1884, 11, 16757, 11159, 288, 30, 720, 56436, 398, 358, 14362, 21169, 520, 279, 3463, 315, 4359, 11, 720, 1688, 7138, 323, 1202, 40164, 11, 4212, 323, 11746, 323, 16290, 11, 720, 4071, 430, 358, 11, 13353, 11, 1650, 311, 40344, 507, 13836, 11, 34223, 5150, 2206, 11, 720, 1016, 283, 296, 14217, 4212, 11, 15648, 267, 2262, 520, 16290, 11, 720, 3112, 37254, 267, 11, 2064, 6853, 267, 2539, 279, 13057, 2136, 315, 11746, 13, 720, 791, 1401, 17571, 304, 420, 21765, 11, 369, 757, 11, 374, 1054, 13, 662, 662, 34223, 5150, 9553, 720, 3112, 779, 433, 374, 449, 499, 11, 912, 2204, 1109, 36367, 27484, 1543, 477, 5606, 720, 1531, 304, 279, 15861, 13, 720, 2028, 45537, 279, 11999, 17966, 315, 18330, 64050, 13, 362, 720, 1743, 315, 420, 17966, 10975, 603, 430, 1070, 374, 459, 11478, 323, 264, 720, 13477, 304, 682, 315, 7138, 430, 374, 11782, 323, 27078, 13, 1115, 528, 21148, 12, 720, 29355, 374, 1097, 12837, 311, 24710, 505, 603, 13, 720, 3076, 720, 42903, 4031, 468, 13, 96958, 643, 720, 2675, 527, 264, 961, 315, 7138, 323, 315, 420, 11478, 430, 374, 7191, 1109, 720, 3852, 3254, 3927, 13, 578, 3927, 499, 527, 374, 1101, 264, 4040, 1534, 720, 630, 315, 420, 11478, 13, 1115, 24746, 2410, 374, 304, 682, 2574, 323, 682, 720, 8920, 11, 323, 433, 690, 14794, 505, 279, 18330, 477, 1376, 1752, 4907, 430, 720, 285, 304, 279, 64233, 1917, 1139, 279, 1917, 315, 1376, 323, 23546, 13, 720, 4599, 584, 1440, 420, 7953, 264, 10712, 11, 323, 2231, 433, 1139, 6725, 304, 720, 414, 6439, 11, 584, 690, 1518, 279, 9364, 315, 1057, 23492, 529, 32097, 24411, 720, 18614, 1057, 16335, 8903, 13, 578, 18172, 17966, 15100, 279, 12939, 315, 720, 414, 8430, 11112, 28390, 315, 12588, 1521, 21258, 13, 720, 2031, 720, 39, 715, 878, 1753, 21592, 468, 37041, 24221, 5257, 89975, 720, 791, 23690, 82086, 720, 77, 2015, 311, 3719, 264, 893, 333, 5302, 11, 16280, 4737, 961, 304, 279, 720, 4734, 315, 1080, 12, 46002, 701, 2324, 323, 51647, 311, 6261, 279, 6302, 720, 1073, 701, 4851, 753, 32097, 11, 499, 2011, 1440, 430, 499, 527, 28390, 315, 2215, 344, 12, 720, 287, 13, 1115, 690, 3152, 38936, 279, 33726, 430, 499, 68113, 323, 720, 3200, 3409, 11559, 3412, 922, 701, 2324, 13, 4718, 11555, 11, 902, 527, 279, 720, 1132, 8525, 82, 315, 279, 16665, 315, 701, 3769, 1917, 11, 527, 1148, 499, 720, 53757, 311, 21635, 13, 720, 39595, 287, 18065, 1701, 279, 2410, 315, 701, 9358, 1917, 311, 11003, 264, 720, 9054, 261, 5133, 449, 2324, 323, 9504, 311, 499, 1148, 499, 12876, 13, 1472, 720, 4919, 24928, 6261, 682, 1938, 1317, 430, 279, 1890, 2410, 430, 7263, 720, 73254, 1139, 279, 7106, 1917, 1101, 7263, 499, 11, 719, 422, 499, 656, 539, 720, 6028, 720, 42903, 4031, 468, 13, 96958, 643, 720, 57676, 28390, 11, 499, 690, 24927, 279, 5933, 6530, 315, 4907, 1139, 701, 2324, 720, 438, 1893, 264, 2565, 425, 430, 3727, 64050, 12266, 13, 720, 791, 18172, 17966, 35710, 499, 430, 499, 527, 28390, 315, 37492, 13, 720, 2746, 701, 11555, 527, 3196, 389, 459, 2217, 315, 15375, 2419, 1918, 369, 904, 312, 64, 12, 720, 942, 520, 682, 11, 499, 690, 14794, 1148, 1884, 11555, 70772, 311, 279, 48986, 12, 720, 3078, 278, 4059, 13, 578, 4907, 7633, 304, 279, 11999, 17966, 690, 5398, 720, 4291, 1148, 433, 374, 430, 499, 12164, 349, 13, 1054, 2170, 264, 893, 15849, 11, 779, 374, 568, 2476, 527, 539, 720, 3274, 4339, 13, 2435, 1614, 264, 6913, 8206, 315, 1268, 279, 15861, 4375, 13, 720, 95045, 430, 37492, 374, 53924, 449, 75456, 374, 264, 720, 2465, 339, 430, 34453, 1690, 315, 603, 323, 374, 279, 7928, 50502, 3904, 1070, 720, 285, 311, 8430, 28390, 13, 720, 66873, 16849, 30, 720, 791, 21849, 430, 37492, 323, 75456, 527, 53924, 374, 720, 69, 361, 839, 555, 11555, 430, 433, 374, 45743, 323, 41086, 311, 51187, 323, 720, 5919, 556, 3769, 2574, 13, 6914, 753, 21635, 420, 19451, 323, 8417, 422, 720, 9514, 617, 1027, 28160, 1139, 35090, 433, 311, 387, 701, 8206, 13, 720, 18293, 264, 1427, 2212, 701, 1917, 323, 5406, 279, 37492, 323, 842, 12, 720, 33028, 315, 1057, 15861, 13, 1102, 5900, 389, 323, 389, 11, 7953, 1057, 5845, 311, 720, 318, 24281, 1202, 13057, 2136, 13, 1115, 37492, 28555, 505, 279, 1890, 4907, 430, 720, 884, 26500, 1057, 16188, 28591, 13, 1102, 374, 499, 13, 1472, 527, 433, 13, 7557, 912, 720, 80024, 731, 922, 433, 13, 720, 13721, 1376, 374, 1268, 9090, 3727, 5196, 3967, 311, 603, 1418, 584, 527, 720, 258, 1376, 13520, 13, 17326, 84332, 304, 12690, 11, 54280, 11, 7795, 11, 20229, 11, 1332, 12, 720, 17822, 11, 24822, 11, 19837, 323, 499, 13, 2052, 430, 499, 1518, 2212, 499, 374, 264, 720, 4581, 315, 279, 3769, 64050, 315, 9090, 13, 34464, 374, 539, 459, 41919, 11, 720, 269, 2555, 430, 22525, 539, 311, 387, 11, 719, 374, 279, 5995, 3445, 720, 20322, 902, 9090, 2204, 43398, 5196, 389, 420, 11277, 315, 14209, 13, 720, 1271, 2733, 430, 433, 374, 45743, 477, 2536, 1355, 53829, 940, 311, 12876, 323, 14794, 374, 311, 720, 60494, 279, 1917, 315, 9090, 323, 279, 1917, 315, 5030, 1139, 25685, 4083, 78, 12, 720, 55864, 13, 3277, 584, 11142, 459, 19451, 315, 9090, 1694, 53924, 449, 720, 60065, 11, 584, 527, 41566, 279, 9090, 430, 374, 304, 5030, 439, 1202, 71373, 720, 5332, 720, 39595, 4718, 51497, 720, 17947, 13, 1226, 1101, 23973, 279, 32939, 315, 13520, 439, 18330, 23837, 13, 720, 3947, 374, 912, 2944, 311, 2733, 51975, 315, 19762, 2574, 311, 2586, 1139, 720, 22479, 2324, 13, 1102, 374, 3117, 2731, 311, 617, 459, 19451, 315, 76554, 8996, 720, 60556, 709, 304, 701, 2324, 323, 311, 387, 10032, 311, 16136, 304, 279, 15612, 315, 720, 38475, 439, 264, 1080, 12, 33498, 13, 3277, 584, 6541, 311, 9298, 430, 3871, 814, 720, 884, 9868, 832, 18249, 1245, 4459, 11, 584, 4148, 279, 60381, 315, 45743, 12, 720, 2136, 13, 4702, 439, 1855, 315, 603, 374, 832, 18249, 1245, 4459, 40056, 315, 9090, 720, 438, 5030, 11, 779, 11, 2288, 11, 374, 279, 4553, 15861, 13, 720, 791, 1920, 315, 2324, 4737, 1376, 374, 264, 23347, 13, 3011, 23347, 374, 48725, 12, 720, 944, 291, 555, 264, 11782, 4907, 430, 374, 1440, 481, 994, 584, 36297, 2733, 720, 43629, 315, 12588, 1202, 56650, 304, 1376, 13, 3765, 98681, 374, 279, 1648, 315, 279, 720, 52817, 5457, 304, 279, 15861, 13, 1472, 527, 20458, 311, 617, 37492, 304, 720, 22479, 2324, 11, 323, 311, 12164, 349, 44202, 311, 682, 430, 499, 13123, 304, 701, 720, 14957, 13, 12334, 374, 18661, 555, 3339, 6261, 2678, 323, 73521, 720, 1605, 1109, 311, 14794, 2678, 2136, 323, 54127, 100104, 304, 701, 2324, 13, 720, 1271, 28696, 459, 19451, 315, 76554, 37492, 11, 433, 690, 387, 11190, 720, 998, 21635, 1148, 499, 1390, 311, 2349, 304, 2015, 311, 67632, 420, 1440, 12, 720, 287, 520, 279, 35693, 2237, 315, 701, 1694, 13, 720, 17673, 51283, 71403, 50, 3083, 468, 37041, 24221, 720, 36064, 430, 499, 1205, 311, 7491, 304, 2015, 311, 1304, 420, 18172, 720, 652, 16379, 264, 3318, 1646, 304, 701, 2324, 374, 2561, 439, 264, 10723, 5820, 13, 720, 2675, 656, 539, 1205, 311, 733, 704, 1139, 279, 1917, 323, 51630, 433, 304, 904, 1648, 13, 720, 2181, 374, 5042, 264, 5030, 315, 10223, 701, 4059, 922, 701, 6913, 5922, 72, 12, 720, 2136, 311, 5371, 682, 315, 4359, 753, 56650, 11, 387, 814, 3769, 477, 6062, 13, 720, 3947, 706, 1027, 264, 2763, 315, 5149, 2231, 1139, 35121, 603, 311, 2733, 720, 359, 43629, 315, 3515, 682, 430, 2324, 706, 311, 3085, 13, 7648, 315, 603, 617, 11928, 720, 64, 2763, 315, 279, 6392, 430, 8866, 437, 617, 15338, 1057, 1648, 11, 7314, 449, 1057, 720, 78179, 439, 42534, 13, 53466, 1070, 374, 4400, 5076, 449, 459, 19451, 315, 720, 5481, 17098, 323, 14943, 5411, 2191, 13, 1442, 420, 374, 701, 1853, 11, 499, 1440, 433, 5655, 2949, 720, 82, 22479, 726, 323, 499, 1440, 430, 4359, 8111, 304, 682, 2574, 3769, 323, 720, 6414, 8407, 13, 17326, 4250, 387, 18255, 1139, 2731, 477, 11201, 11, 6904, 12, 720, 5958, 720, 42903, 4031, 468, 13, 96958, 643, 720, 287, 389, 902, 315, 4359, 753, 53862, 499, 3469, 311, 617, 477, 539, 617, 304, 701, 720, 14789, 13, 720, 6251, 20659, 28390, 315, 904, 56650, 477, 32097, 374, 264, 4668, 315, 701, 9358, 720, 14789, 13, 2057, 4148, 279, 60381, 315, 3769, 4633, 45743, 2136, 499, 1253, 1205, 311, 720, 265, 1138, 853, 701, 9358, 51866, 13, 5810, 527, 279, 3682, 51866, 315, 720, 1395, 826, 889, 1440, 814, 527, 28390, 323, 76554, 315, 682, 315, 4359, 753, 16458, 12, 720, 287, 13, 720, 5728, 3092, 659, 65906, 4131, 505, 7182, 13, 1115, 1732, 753, 5224, 315, 813, 477, 720, 1964, 9358, 21063, 2643, 387, 2555, 1093, 279, 2768, 25, 1054, 2170, 720, 64, 1716, 315, 4359, 11, 856, 5922, 1918, 374, 264, 2728, 13, 358, 1097, 539, 18255, 1139, 720, 86390, 323, 2547, 11, 4856, 11, 358, 1097, 264, 961, 315, 279, 682, 100220, 287, 9886, 720, 44982, 4359, 5196, 13, 358, 1097, 264, 3823, 37810, 4359, 2085, 99744, 12, 720, 28491, 477, 59456, 2029, 720, 4054, 315, 279, 8125, 2911, 527, 3629, 3025, 311, 3237, 35201, 374, 720, 28753, 814, 617, 539, 3686, 1027, 76551, 1534, 555, 279, 4623, 315, 1694, 720, 18736, 13, 1442, 814, 527, 3025, 311, 22884, 420, 76551, 292, 13141, 11, 814, 7293, 720, 4469, 72, 4881, 323, 527, 3025, 311, 3237, 872, 27862, 84137, 1555, 12, 720, 412, 872, 6439, 389, 9578, 13, 720, 32346, 3629, 279, 6848, 315, 1023, 8866, 437, 527, 1148, 35256, 1057, 720, 318, 40973, 315, 13520, 439, 15375, 34594, 13, 1226, 9020, 311, 279, 83085, 72, 12, 720, 83, 919, 315, 3885, 889, 617, 3428, 659, 33263, 569, 11, 323, 889, 527, 19969, 720, 998, 43844, 10383, 323, 2410, 927, 603, 13, 1226, 1243, 1935, 389, 279, 55367, 12, 720, 43078, 84488, 315, 1057, 15375, 2419, 1918, 323, 3240, 311, 1518, 13520, 439, 720, 15031, 5199, 3885, 1053, 617, 603, 4510, 584, 527, 13, 1102, 374, 720, 65, 23478, 279, 7036, 315, 1455, 3995, 2911, 311, 22884, 1521, 6848, 13, 720, 4071, 11, 439, 12884, 11, 584, 649, 1427, 1203, 520, 420, 9950, 76205, 323, 1949, 1057, 12, 720, 82, 4372, 505, 1202, 32677, 488, 13, 720, 2675, 2011, 1440, 2949, 430, 499, 527, 264, 961, 315, 279, 3177, 430, 720, 4238, 774, 1475, 893, 13, 1472, 527, 6029, 315, 279, 14209, 315, 4359, 11, 720, 438, 304, 701, 1866, 4040, 1534, 3927, 488, 11, 499, 617, 4359, 720, 56950, 499, 13, 15636, 11, 499, 2011, 387, 3025, 311, 2019, 449, 29191, 11, 720, 39595, 4718, 51497, 720, 2118, 28622, 374, 757, 11, 323, 358, 1097, 4359, 2029, 1102, 374, 420, 8206, 430, 690, 1949, 499, 720, 1527, 701, 16024, 315, 15375, 2419, 1918, 311, 9504, 311, 6261, 682, 430, 720, 9514, 12876, 13, 720, 39787, 315, 701, 1866, 32097, 311, 14794, 439, 3515, 1027, 9277, 720, 19041, 555, 9090, 11, 323, 430, 1884, 32097, 11, 902, 527, 52258, 304, 3021, 720, 438, 2532, 11, 527, 24559, 1148, 4359, 6944, 311, 3041, 499, 11, 323, 430, 720, 22479, 12876, 374, 279, 2167, 1853, 311, 12588, 1884, 56650, 13, 6914, 733, 720, 1073, 279, 4623, 430, 12876, 374, 45743, 2136, 323, 24928, 6261, 430, 422, 720, 9514, 1047, 912, 32097, 3596, 11, 499, 1053, 2103, 387, 5496, 459, 31383, 458, 720, 93772, 449, 23939, 304, 264, 43854, 13, 720, 65361, 499, 2733, 15375, 34594, 315, 3515, 701, 78167, 720, 1138, 535, 11, 24928, 6261, 430, 912, 832, 374, 15375, 34594, 323, 430, 279, 720, 25030, 30467, 4907, 430, 28555, 1555, 499, 28555, 1555, 682, 315, 720, 28622, 753, 2911, 323, 430, 682, 527, 28390, 13, 1115, 5764, 499, 13, 720, 7927, 32097, 527, 279, 1633, 7526, 430, 2187, 499, 311, 3139, 323, 720, 50659, 279, 39143, 315, 279, 15861, 13, 2435, 1935, 499, 7953, 720, 3852, 9669, 430, 499, 2643, 617, 43603, 323, 3063, 499, 311, 264, 720, 90447, 18330, 17985, 13, 7570, 279, 4623, 315, 32145, 41316, 268, 12, 720, 479, 323, 66763, 374 ]
0xBreath/holistic-books
also extensively cultivated for its seed oil. Parts Used Aerial parts, flowers, seed oil. Constituents Borage contains mucilage, tannins, and pyrrolizidine alkaloids, which in isolation are toxic to the liver. The seeds contain up to 24% gamma-linolenic acid.in a poultice, or as an infusion. The flowers encourage sweating and the leaves are diuretic. The seed oil is particularly rich in polyunsaturated fats, and is superior in this respect to evening primrose oil ( Oenothera biennis, p. 241). Borage seed oil is used to treat premenstrual complaints, rheumatic problems, eczema, and other chronic skin conditions. Cautions Due to the presence of toxic pyrrolizidine alkaloids, there is uncertainty over borage’s safety as a medicine. It is subject to legal restrictions in some countries and should not be taken internally. These restrictions and cautions do not apply to borage seed oil. Borage’s attractive blue flowers are traditionally used to decorate salads. History & Folklore The herbalist John Gerard, writing in 1597, extols borage’s virtues, “A syrup made of the flowers of borage comforteth the heart, purgeth melancholy, and quieteth the phreneticke or lunaticke person.” Gerard also quotes the old saying, “I, Borage, bring always courage.” Medicinal Actions & Uses With its high mucilage content, borage is a demulcent herb and soothes respiratory problems. Its emollient qualities make it helpful for sore and inflamed skin—prepared either as freshly squeezed juice, US_158-179_Abies_balsa_Boswe_serratta.indd 179 26/02/16 12:47 pm 180Brassica oleracea Brassica oleracea (Brassicaceae) Cabbage Description Biennial or perennial herb growing to 8 ft (2.5 m). Has a thick stem, grey leaves, and 4-petaled yellow flowers. Within the first year, it produces a greatly enlarged terminal bud that develops into the familiar cabbage head in late summer. Habitat & Cultivation Wild cabbage is native to coasts of the English Channel and the Mediterranean. Cultivated varieties are produced worldwide as a vegetable. Parts Used Leaves. Constituents Cabbage is rich in vitamins A, B1, B2, and C. History & Folklore The wholesome cabbage is one of the oldest vegetables. According to Greek myth, the plant sprang into existence from the perspiration of Zeus. In a Greek ritual, cabbage was given to expectant mothers shortly before birth in order to establish good breast-milk production. The Romans used cabbage as an antidote, especially to alcohol, believing it countered intoxication and prevented or reduced a hangover. They also used cabbage leaves to cleanse infected wounds. It is thought to have been cultivated in Britain from around 500 ce. One traditional method of making a cabbage poultice, still used today, is to cut out the thick midrib of a leaf and iron it, placing it while still hot on the area to be treated. Medicinal Actions & Uses Cabbage’s best- known medicinal use is as a poultice—the leaves of the wild or cultivated plant are blanched, crushed, or chopped, and applied to swellings, tumors, and painful joints. Wild cabbage leaves eaten raw or cooked aid digestion and the breakdown of toxins in the liver—so the Romans’ eating it to ease a hangover was in fact quite justified. Cabbage is also detoxifying and helpful in the long-term treatment of arthritis. The high vitamin C content of cabbage has made it useful in the prevention of scurvy. Caution A cabbage poultice may cause blisters if left on for several hours. Bryonia dioica syn. B. cretica subsp. dioica (Cucurbitaceae) White Bryony Description Perennial climbing vine with fleshy taproot up to 6 in (15 cm) thick. Straggling stem with tendrils, greenish flowers, and red berries. Habitat & Cultivation White bryony is native to southern England and parts of Europe. The root is dug up in autumn. Part Used Root. Constituents White bryony contains cucurbitacins, glycosides, volatile oil, and tannins. The cucurbitacins kill cells and so act on tumors. History & Folklore From prehistory to the Middle Ages, the thick roots of white bryony were cut into a human shape as a substitute (or a counterfeit) for mandrake root (Mandragora officinarum, p. 232), which was believed to afford magical protection. The Greek physician Dioscorides (1st century ce) reports that the leaves, fruit, and root of white bryony were applied to gangrenous wounds. In medieval England, the plant was used to treat leprosy.o t h e r m e d i c i n a l p l a n t sRelated Species B. alba is used in homeopathic medicine. Black bryony (Tamus communis) is an unrelated plant with approximately similar uses. RQ Cautions Bryony is a toxic plant. Use only under professional supervision. Do not take during pregnancy. Butea monosperma (Fabaceae) Palas, Flame of the Forest, Bengal Kino Description Deciduous tree growing to 49 ft (15 m). Has 3-lobed leaves and large orange-red flowers in clusters. Habitat & Cultivation Palas is native to India and Southeast Asia. It grows in forests and in open areas to altitudes of 3,900 ft (1,200 m). Parts Used Bark, flowers, leaves, gum, and seeds. Constituents All parts of the tree except the seeds contain tannins. Medicinal Actions & Uses The gum that oozes from incisions made in palas bark is known as Bengal kino. Mildly astringent, it is used as a substitute for the kino derived from bastard teak (Pterocarpus marsupium). Bengal kino is taken as a decoction or a tincture for acid indigestion, diarrhea, and dysentery, and used as a gargle for sore throats and as a douche for vaginitis. Early research suggests that the leaves and bark have the potential to treat diabetes, and that the leaves exert a beneficial action on diarrhea. Caution Do not take during pregnancy.Cabbage White bryony has antitumor and antirheumatic properties. Medicinal Actions & Uses A powerful cathartic and purgative, bryony is used with great caution in herbal medicine today. It is principally prescribed for painful rheumatic conditions. It may be taken internally, or applied as a counterirritant, causing swelling and increased blood flow to the area. White bryony is also given for other inflammatory conditions such as duodenal ulcers, asthma, bronchitis, and pleurisy, and may be used to reduce high blood pressure. The whole herb has antiviral activity and research is now suggesting that it acts as an adaptogen—helping the body to adapt more effectively to stress and strain.caesalpinia bonduc (Caesalpiniaceae) Nikkar Nut Description Thorny bush growing to 30 ft (9 m), with spiny compound leaves, yellow flowers in dense clusters, and prickly pods containing yellow seeds (nuts). Habitat & Cultivation Nikkar nut is pan- tropical, common in both tropical Asia and Africa. Its seeds are gathered when ripe. Parts Used Seeds. Constituents The seeds contain isoflavonoids, diterpenes, a bitter principle, and a fixed oil (20%) rich in linoleic acid (68%). Medicinal Actions & Uses Nikkar seeds are used to treat fevers and are taken as a tonic and aphrodisiac. In India, they are often mixed with black pepper (Piper nigrum, p. 250) for medicinal use. The seeds are also taken for inflammatory conditions such as arthritis. Roasted nikkar seeds are used in the treatment of diabetes. US_180-201_Brassica_dictamnus.indd 180 26/02/16 12:47 pm181Camellia sinensis o th er m ed icin al plan tsRelated Species A decoction of the bark of the Caribbean C. bahamensis is used for liver and kidney infections, and a decoction of the wood is used for diabetes. An infusion of the leaves of C. pulcherrima (native to Asia and Africa) is taken for liver problems and mouth ulcers. Calamintha ascendens syn. C. sylvatica, C. officinalis (Lamiaceae) Calamint Description Mint-scented perennial growing to 2 ft (60 cm). Has hairy oval leaves, and purple flowers in late
[ 1101, 42817, 67166, 369, 1202, 720, 23425, 5707, 627, 30021, 12477, 220, 362, 2918, 5596, 11, 19837, 11, 10533, 5707, 627, 1128, 3781, 84, 812, 220, 426, 2747, 5727, 65104, 88076, 11, 720, 83, 1036, 1354, 11, 323, 4611, 81, 1098, 450, 91073, 66787, 17390, 11, 902, 304, 720, 285, 36062, 527, 21503, 311, 279, 26587, 13, 578, 19595, 6782, 2355, 455, 311, 220, 1187, 4, 22350, 2922, 258, 17648, 292, 13935, 1896, 264, 17258, 4937, 560, 11, 477, 439, 459, 71308, 13, 578, 19837, 720, 967, 61140, 81366, 323, 279, 11141, 527, 1891, 554, 29150, 13, 720, 791, 10533, 5707, 374, 8104, 9257, 304, 10062, 11099, 35467, 720, 69, 1900, 11, 323, 374, 16757, 304, 420, 5201, 311, 11714, 720, 18375, 25888, 5707, 320, 507, 268, 1605, 64, 6160, 16550, 1174, 281, 13, 220, 13341, 570, 426, 2747, 720, 23425, 5707, 374, 1511, 311, 4322, 864, 5794, 496, 940, 21859, 11, 720, 81, 383, 33030, 5435, 11, 12208, 89, 9355, 11, 323, 1023, 21249, 720, 37282, 4787, 627, 34, 2784, 919, 220, 24586, 311, 279, 9546, 315, 21503, 720, 3368, 81, 1098, 450, 91073, 66787, 17390, 11, 1070, 374, 27924, 927, 720, 65, 2747, 753, 7296, 439, 264, 16088, 13, 1102, 374, 3917, 311, 5897, 720, 28998, 919, 304, 1063, 5961, 323, 1288, 539, 387, 720, 83261, 34167, 13, 4314, 17294, 323, 2211, 4065, 2355, 3055, 539, 3881, 311, 293, 2747, 10533, 5707, 627, 33, 2747, 753, 19411, 6437, 720, 89770, 527, 36342, 2355, 2656, 311, 57681, 77852, 627, 13730, 612, 65337, 20763, 220, 578, 51487, 380, 3842, 82218, 11, 720, 26372, 304, 220, 11068, 22, 11, 1327, 3145, 293, 2747, 753, 66627, 11, 1054, 32, 45322, 720, 28010, 315, 279, 19837, 315, 293, 2747, 6981, 774, 2355, 1820, 4851, 11, 4087, 456, 71, 87163, 5849, 11, 323, 11594, 774, 2355, 1820, 1343, 1466, 5411, 441, 477, 33073, 780, 441, 1732, 2029, 82218, 2355, 19171, 17637, 279, 2362, 5605, 11, 1054, 40, 11, 426, 2747, 11, 4546, 2355, 33222, 25775, 49216, 13613, 292, 992, 27820, 612, 39923, 3161, 1202, 1579, 720, 76, 1791, 88076, 2262, 11, 293, 2747, 374, 264, 2486, 360, 1189, 39999, 2355, 438, 44276, 6509, 42631, 5435, 13, 11699, 991, 337, 1477, 720, 83465, 1304, 433, 11190, 369, 36366, 323, 4704, 3690, 2355, 37282, 2345, 61212, 3060, 439, 50999, 65262, 23661, 11, 2355, 2078, 62, 11286, 12, 11128, 1596, 57773, 890, 42926, 1702, 437, 906, 646, 618, 33019, 29573, 67, 256, 220, 11128, 220, 1627, 14, 2437, 14, 845, 256, 220, 717, 25, 2618, 9012, 198, 5245, 6971, 395, 3074, 297, 1565, 83682, 198, 6971, 395, 3074, 297, 1565, 83682, 320, 6971, 65444, 114785, 340, 34, 57589, 198, 5116, 220, 12371, 32331, 477, 74718, 39999, 7982, 720, 998, 220, 23, 10702, 320, 17, 13, 20, 296, 570, 11697, 264, 12314, 19646, 11, 20366, 11141, 11, 323, 720, 19, 2320, 1955, 839, 14071, 19837, 13, 25218, 279, 1176, 1060, 11, 2355, 275, 19159, 264, 19407, 74117, 15372, 37808, 2355, 9210, 39671, 1139, 279, 11537, 74873, 2010, 2355, 258, 3389, 7474, 627, 39, 40027, 266, 612, 26676, 40227, 220, 13944, 74873, 374, 2355, 30838, 311, 1080, 12019, 315, 279, 6498, 13740, 323, 279, 38785, 13, 26676, 55786, 36680, 527, 9124, 15603, 439, 264, 36581, 627, 30021, 12477, 220, 78614, 627, 1128, 3781, 84, 812, 220, 356, 57589, 374, 9257, 304, 46192, 362, 11, 426, 16, 11, 720, 33, 17, 11, 323, 356, 627, 13730, 612, 65337, 20763, 220, 578, 88318, 74873, 720, 285, 832, 315, 279, 24417, 24822, 13, 10771, 311, 18341, 720, 2465, 339, 11, 279, 6136, 8314, 526, 1139, 14209, 505, 279, 7565, 29579, 315, 75457, 13, 763, 264, 18341, 28278, 11, 74873, 574, 2728, 311, 1755, 519, 27698, 20193, 1603, 7342, 304, 720, 1382, 311, 5813, 1695, 17659, 1474, 34263, 720, 23452, 13, 578, 49817, 1511, 720, 66, 57589, 439, 459, 90687, 1295, 11, 720, 36046, 311, 13200, 11, 35090, 720, 275, 86167, 72815, 367, 2355, 438, 32098, 477, 11293, 264, 720, 21313, 2017, 13, 2435, 1101, 1511, 74873, 720, 273, 4798, 311, 81155, 29374, 34254, 13, 1102, 374, 3463, 311, 617, 1027, 67166, 720, 258, 13527, 505, 2212, 220, 2636, 3846, 13, 720, 4054, 8776, 1749, 315, 3339, 264, 74873, 17258, 4937, 560, 11, 2103, 1511, 3432, 11, 374, 311, 4018, 704, 279, 12314, 5209, 1936, 315, 264, 16312, 323, 11245, 433, 11, 25012, 433, 1418, 2103, 4106, 389, 279, 3158, 311, 387, 12020, 627, 13613, 292, 992, 27820, 612, 39923, 220, 356, 57589, 753, 1888, 7058, 5391, 58041, 1005, 374, 439, 264, 17258, 4937, 560, 22416, 11141, 2355, 1073, 279, 8545, 477, 67166, 6136, 527, 1529, 276, 2454, 11, 33745, 11, 2355, 269, 38525, 11, 323, 9435, 311, 78353, 826, 11, 56071, 11, 323, 26175, 35358, 13, 13944, 74873, 11141, 35661, 7257, 477, 30205, 12576, 74502, 323, 279, 31085, 315, 62186, 304, 279, 26587, 2345, 708, 279, 49817, 529, 12459, 433, 311, 14553, 264, 15020, 2017, 574, 304, 2144, 5115, 35516, 13, 356, 57589, 374, 1101, 61987, 7922, 323, 11190, 304, 279, 1317, 9860, 6514, 315, 55652, 13, 578, 1579, 28170, 356, 2262, 315, 74873, 706, 1903, 433, 5505, 304, 279, 27344, 315, 1156, 324, 14029, 627, 23389, 1516, 220, 362, 74873, 17258, 4937, 560, 1253, 5353, 1529, 9487, 2355, 333, 2163, 389, 369, 3892, 4207, 13, 720, 33, 894, 21947, 65570, 3074, 6925, 662, 426, 13, 1922, 83055, 720, 2008, 2203, 13, 65570, 3074, 320, 34, 1791, 324, 4590, 114785, 340, 14404, 19803, 3633, 198, 5116, 220, 3700, 32331, 30608, 30050, 449, 282, 645, 8671, 720, 31147, 2959, 709, 311, 220, 21, 304, 320, 868, 10166, 8, 12314, 13, 4610, 16094, 2785, 19646, 720, 4291, 91346, 8839, 11, 6307, 819, 19837, 11, 323, 2579, 63494, 627, 39, 40027, 266, 612, 26676, 40227, 220, 5929, 293, 894, 3633, 374, 10068, 311, 18561, 9635, 323, 5596, 315, 4606, 13, 578, 3789, 720, 285, 44120, 709, 304, 42774, 627, 5920, 12477, 220, 19385, 627, 1128, 3781, 84, 812, 220, 5929, 293, 894, 3633, 5727, 720, 66, 1791, 324, 4590, 582, 1354, 11, 37807, 9594, 3422, 11, 17509, 5707, 11, 323, 259, 1036, 1354, 13, 578, 75391, 324, 4590, 582, 1354, 5622, 7917, 323, 779, 1180, 389, 56071, 627, 13730, 612, 65337, 20763, 5659, 864, 19375, 311, 2355, 1820, 12877, 50093, 11, 279, 12314, 20282, 315, 4251, 293, 894, 3633, 1051, 4018, 1139, 264, 3823, 6211, 439, 264, 28779, 320, 269, 2355, 64, 83734, 8, 369, 11837, 81, 731, 3789, 320, 44, 438, 4193, 6347, 2856, 14080, 372, 11, 281, 13, 220, 12338, 705, 902, 574, 11846, 311, 10150, 24632, 9313, 13, 578, 18341, 28378, 69198, 6133, 3422, 320, 16, 267, 9478, 3846, 8, 6821, 430, 279, 11141, 11, 14098, 11, 323, 3789, 315, 4251, 293, 894, 3633, 1051, 9435, 311, 13481, 1466, 788, 34254, 13, 763, 42108, 9635, 11, 279, 6136, 574, 1511, 311, 4322, 514, 782, 23707, 14778, 259, 305, 384, 436, 220, 296, 384, 294, 602, 272, 602, 308, 264, 326, 220, 281, 326, 264, 308, 259, 274, 11948, 51567, 220, 426, 13, 453, 4749, 374, 1511, 304, 2162, 62209, 720, 83543, 13, 5348, 293, 894, 3633, 320, 51, 56455, 34561, 285, 8, 374, 459, 46305, 6136, 449, 13489, 4528, 5829, 627, 432, 48, 356, 2784, 919, 220, 19803, 3633, 374, 264, 21503, 6136, 13, 5560, 720, 3323, 1234, 6721, 38217, 13, 3234, 539, 1935, 2391, 20209, 627, 33, 1088, 64, 1647, 437, 716, 1764, 320, 53267, 114785, 340, 20577, 300, 11, 720, 3968, 373, 315, 279, 20585, 11, 2355, 33, 833, 278, 735, 3394, 720, 5116, 220, 3799, 307, 9373, 5021, 7982, 311, 220, 2491, 10702, 720, 7, 868, 296, 570, 11697, 220, 18, 12, 1718, 291, 11141, 323, 3544, 19087, 32698, 720, 89770, 304, 28066, 627, 39, 40027, 266, 612, 26676, 40227, 220, 11165, 300, 374, 10068, 311, 6890, 720, 438, 36664, 13936, 13, 1102, 28815, 304, 36658, 323, 304, 1825, 5789, 311, 4902, 21237, 315, 220, 18, 11, 7467, 10702, 320, 16, 11, 1049, 296, 4390, 30021, 12477, 220, 60629, 11, 19837, 11, 11141, 11, 42365, 11, 323, 19595, 627, 1128, 3781, 84, 812, 220, 2052, 5596, 315, 279, 5021, 3734, 279, 720, 325, 6910, 6782, 259, 1036, 1354, 627, 13613, 292, 992, 27820, 612, 39923, 220, 578, 42365, 430, 720, 2689, 32893, 505, 3709, 6948, 1903, 304, 11091, 300, 54842, 374, 3967, 439, 50120, 90355, 13, 61289, 398, 264, 928, 306, 11, 433, 374, 1511, 439, 264, 28779, 369, 279, 90355, 14592, 505, 74677, 1028, 587, 320, 47, 466, 511, 8035, 355, 48449, 455, 2411, 570, 50120, 90355, 374, 4529, 439, 220, 264, 68652, 407, 477, 264, 259, 7956, 554, 369, 13935, 1280, 15505, 290, 11, 69393, 11, 323, 22709, 306, 727, 11, 323, 1511, 439, 264, 97183, 273, 369, 36366, 60187, 1900, 323, 439, 264, 85453, 369, 17764, 2381, 285, 13, 23591, 3495, 13533, 430, 279, 11141, 323, 54842, 617, 220, 279, 4754, 311, 4322, 20335, 11, 323, 430, 279, 11141, 43844, 264, 24629, 1957, 389, 69393, 627, 23389, 1516, 220, 3234, 539, 1935, 2391, 20209, 732, 57589, 198, 14404, 293, 894, 3633, 706, 720, 519, 275, 69361, 323, 3276, 404, 383, 33030, 6012, 627, 13613, 292, 992, 27820, 612, 39923, 220, 362, 8147, 720, 66, 589, 81987, 323, 4087, 70, 1413, 11, 293, 894, 3633, 374, 1511, 449, 2294, 720, 936, 1516, 304, 51487, 16088, 3432, 13, 1102, 374, 92381, 32031, 369, 26175, 68132, 33030, 4787, 13, 1102, 1253, 387, 4529, 34167, 11, 477, 9435, 439, 264, 5663, 404, 1018, 519, 11, 14718, 55307, 323, 7319, 6680, 6530, 311, 220, 279, 3158, 13, 5929, 293, 894, 3633, 374, 1101, 2728, 369, 1023, 47288, 4787, 1778, 439, 3930, 55836, 278, 8725, 17254, 11, 51643, 11, 31071, 331, 20000, 11, 323, 7245, 324, 29113, 11, 323, 1253, 387, 1511, 220, 311, 8108, 1579, 6680, 7410, 13, 578, 4459, 39999, 706, 3276, 344, 37478, 5820, 323, 3495, 374, 1457, 23377, 430, 433, 14385, 439, 459, 10737, 11968, 2345, 8823, 287, 279, 2547, 311, 10737, 810, 13750, 311, 8631, 323, 26800, 25109, 288, 278, 13576, 689, 7970, 7697, 720, 3100, 77684, 278, 79, 6729, 114785, 340, 45, 1609, 29234, 18878, 198, 5116, 220, 78024, 88, 30773, 7982, 311, 220, 966, 10702, 320, 24, 296, 705, 720, 4291, 993, 6577, 24549, 11141, 11, 14071, 19837, 304, 720, 81386, 28066, 11, 323, 89800, 398, 55687, 8649, 14071, 19595, 320, 64866, 4390, 39, 40027, 266, 612, 26676, 40227, 220, 22300, 29234, 10184, 374, 7363, 7058, 83, 51172, 11, 4279, 304, 2225, 35148, 13936, 323, 10384, 13, 11699, 19595, 527, 20802, 994, 57796, 627, 30021, 12477, 220, 74089, 627, 1128, 3781, 84, 812, 220, 578, 19595, 6782, 374, 1073, 79936, 263, 17390, 11, 720, 67, 2058, 2821, 288, 11, 264, 26242, 17966, 11, 323, 264, 8521, 5707, 320, 508, 11587, 9257, 304, 10006, 1286, 292, 13935, 320, 2614, 4, 4390, 13613, 292, 992, 27820, 612, 39923, 220, 22300, 29234, 19595, 527, 720, 2656, 311, 4322, 1172, 3078, 323, 527, 4529, 439, 264, 99305, 323, 89111, 299, 4338, 18029, 13, 763, 6890, 11, 814, 527, 3629, 9709, 449, 3776, 25349, 320, 47, 13154, 308, 5346, 372, 11, 281, 13, 220, 5154, 8, 369, 58041, 1005, 13, 578, 19595, 527, 1101, 4529, 369, 47288, 4787, 1778, 439, 55652, 13, 12093, 15386, 76202, 29234, 19595, 527, 1511, 304, 279, 6514, 315, 20335, 13, 720, 2078, 62, 5245, 12, 679, 1702, 81, 395, 3074, 5356, 309, 77, 355, 29573, 67, 256, 220, 5245, 220, 1627, 14, 2437, 14, 845, 256, 220, 717, 25, 2618, 9012, 10562, 26479, 616, 689, 7589, 87778, 198, 78, 198, 339, 198, 261, 296, 198, 291, 198, 292, 258, 198, 278, 3197, 198, 2641, 11948, 51567, 220, 362, 68652, 407, 315, 279, 54842, 315, 720, 1820, 35374, 356, 13, 43029, 309, 87778, 220, 374, 1511, 369, 26587, 323, 720, 64381, 3520, 30020, 11, 323, 264, 68652, 407, 315, 279, 7732, 2355, 285, 1511, 369, 20335, 13, 1556, 71308, 315, 279, 11141, 315, 2355, 34, 13, 7893, 331, 618, 7675, 220, 320, 30838, 311, 13936, 323, 10384, 8, 374, 4529, 2355, 2000, 26587, 5435, 323, 11013, 8725, 17254, 627, 9027, 8778, 23218, 76412, 729, 2355, 20960, 13, 356, 13, 274, 15095, 54397, 11, 356, 13, 2856, 992, 285, 2355, 5063, 10830, 114785, 340, 9027, 309, 396, 198, 5116, 220, 42410, 1355, 1189, 291, 74718, 7982, 2355, 998, 220, 17, 10702, 320, 1399, 10166, 570, 11697, 51133, 61137, 11141, 11, 323, 25977, 720, 89770, 304, 3389 ]
0xBreath/holistic-books
holism 29, 30, 34, 37 see also Ayurvedic medicine hollyhock 165, 221 holy basil 37, 116, 286 holy thistle 137, 191 holy weed (yerba santa) 205 homeopathy 80 homeostasis 12 honeysuckle 229–30 hong hua (safflower) 42, 183 hoodia 220 Hoodia, H. currori 44 H. gordonii 220 hops 16, 33, 104 Hordeum vulgare 220–21 hormonally active herbs, action of 13 horse chestnut 15, 58 horsemint 236 horseradish 171–72 horsetail 13, 16, 136, 205 hot flashes 316 hou po 40, 232 houseleek 269 huai niu xi (chaff flower) 159 huang bai 247 huang lian 43, 195 huang qi (astragalus) 68 huang quin (Baical skullcap) 134 Humulus lupulus 16, 33, 104 Hungarian pepper 74 huo ma ren (marijuana) 182 huo xiang 42, 161 Hydrangea aborescens 221 Hydrastis canadensis 27, 47, 49, 51, 105, 178 Hydrocotyle vulgaris 76 Hygrophila, H. guayensis 221 H. spinosa 221 Hyoscyamus, H. muticus 222 H. niger 69, 221–22 hyperactivity 308 Hypericum perforatum 30, 31, 32, 51, 79, 106, 286, 298 hyssop 33, 222 Hyssopus officinalis 33, 222 I Ibn Cordoba 21 Ibn El Beitar 44 iboga 44–45 Iceland moss 186 Ilex, I. guayusa 222 I. paraguariensis syn. I. paraguensis 222 Illicium verum 222–23 immune system, effect of herbs 12, 13 Imperatoria ostruthium syn. Peucedanum ostruthium 223 impotence & premature ejaculation 316 Inca wheat 165Indian asparagus 174 Indian berry 167 Indian borage 84 Indian coral tree 206 Indian corn 154 “Indian ginseng” (withania) 152 Indian gooseberry 31, 204 Indian lobelia 279 Indian mallow 158 Indian medicine 19, 20, 21, 36–39 see also A yurvedic medicine Indian mulberry 237 Indian olibanum 179 Indian pennywort 76 Indian snakeroot 261 Indian tobacco 110 Indian turnip 171 indigestion 307 infants & children 299, 318 influenza see flu infused oils 294 infusions 291, 299 inhalations see steam inhalations insecticides/insect repellents 66, 70, 97, 108 insomnia 309, 313, 317, 318 intoxicant herbs, African 45 Inula, I. helenium 13, 26, 107 I. japonica 107 inulin 26 ipecac 52, 186 Ipomeoea, I. batatas 223 I. pandurata 49 I. purga syn. Convolvulus jalapa 223 I. turpethum 223 I. violacea 223 Iris versicolor 223 Irish moss 189 irritable bowel syndrome 307 Islamic medicine (Unani Tibb) 21, 33, 36–37, 39 ispaghula (psyllium) 123 ivy 219 J Jack-in-the-pulpit 171 jalap 223 Jamaica dogwood 251 jambul 274 Japanese gentian 99 Japanese medicine 22, 42–43 jasmine 224 Jasminum, J. grandiflorum 224 J. officinale 41 J. sambac 224 Jateorhiza palmata 44, 224 java tea 243 jequirity 38, 158 ji xue teng 235 jiang huang (turmeric) 90 jin qian cao 231 jin yin hua 78, 229–30 jing jie 40, 268 Joe Pye weed 209 joint pain & stiffness 313 ju hua 13, 43, 78, 229, 256 jue ming zi 75 Juglans, J. cinerea 50, 224 J. nigra 224 J. regia 224 juices 297 jujube 283 juniper 20, 71, 224–25 Juniperus, J. communis 20, 71, 224–25 US_323-331_Index_General.indd 327 26/02/16 4:43 pm 328 general indexJ. oxycedrus 225 J. rigida 225J. sabina 225J. virginicus 185 K kampoh see Japanese medicinekanghi 158kanna 44–45kava 46, 122kava kava 122kelp 16, 213K’Eogh 169, 174, 187, 203, 206, 214, 220, 252, 264 kerala 48–49, 236khat 185khellin 62kigelia 45, 225Kigelia pinnata syn. K. africana 45, 225kino 46, 258kiratatiktah 167knitbone 137knotgrass 124, 253kola nut 13, 45, 192–93Korean medicine 42–43Korean mint 161Krameria, K. cystisoides 225 K. parvifolia 225K. triandra 225 kudzu 258–59kumarhou 254kuth 267–68 L Lactuca, L. sativa 226 L. virosa 225–26 lady’s bedstraw 214–15lady’s mantle 163–64, 286lady’s slipper 199–200Lamium album 226lapacho 13, 139larch 226Larix decidua syn. L. europaea 226Larrea, L. divaricata 226 L. tridentata 226 Laurus, L. camphora see Cinnamomum camphora L. nobilis 226–27, 286 Lavandula, L. angustifolia syn. L. officinalis 35, 108, 286 L. spica 108L. stoechas 108 lavender 35, 108, 286Lawsonia inermis syn. L. alba 227laxative herbs, action of 11, 13lemon 11, 14, 16, 38, 82, 191lemon balm 13, 113, 286lemon grass 48, 198–99, 286lemon verbena 52, 151, 228–29Leonurus, L. cardiaca 227 L. heterophyllus 227L. sibiricus 227 Lepidium, L. meyenii 228 L. virginicum 227–28 Leptandra virginica syn. Veronicastrum virginicum 228 lesser celandine 260–61lesser periwinkle 282lesser skullcap 135Levant storax 229Levant wormwood 172–73Levisticum officinale syn. Ligusticum levisticum 228lian qiao 212life root 269lignum vitae 23, 218Ligusticum, L. chuanxiong 228 L. levisticum see Levisticum officinaleL. sinense 228L. wallachii 42, 117 lily of the valley 31, 194lime (Citrus aurantiifolia) 177, 191, 250lime (Tilia spp.) 277Lind, James 25linden 277ling 180Linnaeus, Carolus 200, 270, 277linseed 16, 18, 109Linum, L. catharticum 109 L. usitatissimum 16, 18, 109 lippia 227Lipp
[ 8619, 2191, 220, 1682, 11, 220, 966, 11, 220, 1958, 11, 220, 1806, 198, 4151, 1101, 220, 24852, 80627, 292, 16088, 198, 8619, 398, 71, 1197, 220, 10680, 11, 220, 12425, 198, 71, 5849, 68186, 220, 1806, 11, 220, 8027, 11, 220, 17361, 198, 71, 5849, 270, 29400, 220, 10148, 11, 220, 7529, 198, 71, 5849, 40475, 320, 27253, 4749, 72851, 8, 220, 10866, 198, 5227, 54042, 220, 1490, 198, 5227, 537, 10949, 220, 717, 198, 26322, 1065, 57075, 220, 14378, 4235, 966, 198, 111882, 305, 4381, 320, 82, 2715, 15115, 8, 220, 2983, 11, 220, 10750, 198, 5812, 689, 220, 8610, 198, 39, 1411, 689, 11, 473, 13, 2917, 7787, 72, 220, 220, 2096, 198, 39, 13, 342, 22231, 3893, 220, 8610, 198, 71, 3806, 220, 845, 11, 220, 1644, 11, 220, 6849, 198, 40701, 451, 372, 11981, 70, 548, 220, 220, 8610, 4235, 1691, 198, 71, 494, 263, 750, 4642, 42393, 11, 1957, 315, 220, 1032, 198, 60775, 15489, 24217, 220, 868, 11, 220, 2970, 198, 20100, 7143, 396, 220, 14087, 198, 20100, 805, 329, 819, 220, 11123, 4235, 5332, 198, 20100, 751, 607, 220, 1032, 11, 220, 845, 11, 220, 9795, 11, 220, 10866, 198, 10847, 62385, 220, 15340, 198, 18664, 3273, 220, 220, 1272, 11, 220, 12338, 198, 7830, 273, 1247, 220, 16955, 198, 17156, 2192, 13080, 84, 38690, 220, 320, 331, 2715, 23153, 8, 220, 11068, 198, 17156, 526, 293, 2192, 220, 220, 14125, 198, 17156, 526, 908, 276, 220, 220, 3391, 11, 220, 6280, 198, 17156, 526, 75205, 320, 21100, 69212, 355, 8, 220, 2614, 198, 17156, 526, 934, 258, 320, 59927, 950, 35113, 11600, 8, 220, 9565, 198, 49619, 19990, 99889, 19990, 220, 845, 11, 220, 1644, 11, 220, 6849, 198, 90475, 8997, 25349, 220, 5728, 198, 17156, 78, 7643, 5790, 320, 76, 2850, 13567, 8, 220, 10828, 198, 17156, 78, 865, 28323, 220, 2983, 11, 220, 10718, 198, 31916, 3696, 853, 64, 671, 4692, 66, 729, 220, 220, 12425, 198, 31916, 3696, 561, 285, 649, 329, 87778, 220, 220, 1544, 11, 220, 2618, 11, 220, 2491, 11, 220, 3971, 11, 2355, 6550, 11, 220, 11256, 198, 31916, 11513, 65598, 982, 74260, 285, 220, 220, 4767, 198, 31916, 70, 22761, 10746, 11, 473, 13, 1709, 352, 87778, 220, 220, 12425, 198, 39, 13, 12903, 12252, 220, 12425, 198, 31916, 437, 11377, 56455, 11, 473, 13, 5318, 59344, 220, 220, 9716, 198, 39, 13, 308, 7420, 220, 3076, 11, 220, 12425, 4235, 1313, 198, 69292, 7323, 220, 14498, 198, 75046, 86231, 84868, 27349, 220, 220, 966, 11, 220, 2148, 11, 220, 843, 11, 220, 3971, 11, 220, 4643, 11, 720, 7461, 11, 220, 17361, 11, 220, 17690, 198, 8671, 784, 454, 220, 1644, 11, 220, 9716, 198, 31916, 784, 46970, 2856, 992, 285, 220, 220, 1644, 11, 220, 9716, 198, 40, 198, 40, 11328, 37987, 27931, 220, 1691, 198, 40, 11328, 4072, 2893, 12635, 220, 2096, 198, 581, 14361, 220, 2096, 4235, 1774, 198, 40, 36316, 78343, 220, 9714, 198, 40, 2635, 11, 358, 13, 1709, 352, 31853, 220, 220, 9716, 198, 40, 13, 1370, 47820, 2850, 87778, 220, 6925, 13, 358, 662, 1370, 47820, 87778, 220, 220, 9716, 198, 12319, 416, 2411, 2807, 372, 220, 220, 9716, 4235, 1419, 198, 70155, 1887, 11, 2515, 315, 42393, 220, 717, 11, 220, 1032, 198, 1453, 77966, 689, 67094, 952, 2411, 220, 6925, 13, 5250, 24921, 276, 372, 720, 78, 496, 952, 2411, 220, 12533, 198, 6802, 98660, 612, 42227, 99302, 220, 220, 15340, 198, 644, 936, 34153, 220, 10680, 48664, 439, 94789, 220, 11771, 198, 48664, 86188, 220, 11515, 198, 48664, 293, 2747, 220, 5833, 198, 48664, 53103, 5021, 220, 11056, 198, 48664, 14095, 220, 10559, 198, 2118, 48664, 342, 1354, 833, 863, 320, 4291, 9345, 8, 220, 9756, 198, 48664, 63237, 15717, 220, 2148, 11, 220, 7854, 198, 48664, 41253, 37029, 220, 17267, 198, 48664, 296, 7331, 220, 11286, 198, 48664, 16088, 220, 777, 11, 220, 508, 11, 220, 1691, 11, 220, 1927, 4235, 2137, 198, 1518, 1101, 220, 362, 379, 80627, 292, 16088, 198, 48664, 15975, 15717, 220, 14590, 198, 48664, 297, 2808, 276, 372, 220, 11128, 198, 48664, 50169, 32251, 220, 4767, 198, 48664, 4224, 4506, 1944, 220, 15602, 198, 48664, 27531, 220, 5120, 198, 48664, 2543, 575, 220, 11123, 198, 485, 15505, 290, 220, 220, 14777, 198, 13885, 1821, 612, 2911, 220, 220, 15531, 11, 220, 17592, 198, 258, 1517, 10529, 4458, 220, 1518, 20236, 198, 13885, 2656, 32462, 220, 17168, 198, 13885, 36807, 220, 17335, 11, 220, 15531, 198, 258, 12130, 811, 1518, 20930, 77773, 811, 198, 258, 9885, 76195, 18480, 9885, 88874, 812, 220, 2287, 11, 220, 2031, 11, 2355, 3534, 11, 220, 6640, 198, 1354, 50405, 220, 220, 15500, 11, 220, 15231, 11, 220, 16718, 11, 220, 17592, 198, 396, 82329, 519, 42393, 11, 11904, 220, 1774, 198, 644, 5724, 11, 358, 13, 305, 15127, 220, 220, 1032, 11, 220, 1627, 11, 220, 7699, 198, 40, 13, 80497, 3074, 220, 7699, 198, 258, 24292, 220, 1627, 198, 72, 1007, 582, 220, 4103, 11, 220, 9714, 198, 24267, 638, 4748, 64, 11, 358, 13, 16120, 19907, 220, 220, 12533, 198, 40, 13, 12495, 324, 460, 220, 220, 2491, 198, 40, 13, 4087, 6885, 6925, 13, 1221, 12821, 85, 19990, 77074, 18826, 220, 220, 12533, 198, 40, 13, 13535, 79, 774, 372, 220, 220, 12533, 198, 40, 13, 4738, 83682, 220, 220, 12533, 198, 40, 6091, 5553, 74909, 220, 12533, 198, 49213, 819, 78343, 220, 9378, 198, 404, 23349, 66358, 28439, 220, 220, 14777, 198, 98273, 16088, 320, 1844, 5676, 37916, 65, 8, 220, 1691, 11, 220, 1644, 11, 720, 1927, 4235, 1806, 11, 220, 2137, 198, 13391, 34856, 5724, 320, 1725, 25734, 2411, 8, 220, 4513, 198, 65605, 220, 13762, 198, 41, 198, 33731, 3502, 10826, 2320, 13136, 275, 220, 11123, 198, 48792, 391, 220, 12533, 198, 41, 3105, 3074, 5679, 6798, 220, 13860, 198, 73, 3042, 360, 220, 16590, 198, 52566, 16265, 1122, 220, 1484, 198, 52566, 16088, 220, 1313, 11, 220, 2983, 4235, 3391, 198, 30826, 6095, 220, 10697, 198, 41, 300, 1083, 372, 11, 622, 13, 6800, 333, 9761, 372, 220, 220, 10697, 198, 41, 13, 2856, 258, 1604, 220, 220, 3174, 198, 41, 13, 274, 3042, 582, 220, 220, 10697, 198, 41, 349, 269, 71, 17528, 33552, 460, 220, 220, 2096, 11, 220, 10697, 198, 10248, 15600, 220, 14052, 198, 3841, 11642, 488, 220, 1987, 11, 220, 11286, 198, 7910, 865, 361, 42249, 220, 220, 12422, 198, 64647, 34065, 526, 220, 320, 66467, 2165, 8, 220, 1954, 198, 50900, 2874, 1122, 101373, 220, 220, 12245, 198, 50900, 379, 258, 305, 4381, 220, 220, 2495, 11, 220, 14378, 4235, 966, 198, 99268, 503, 648, 220, 1272, 11, 220, 16332, 198, 41444, 5468, 68, 40475, 220, 12652, 198, 33950, 6784, 612, 70334, 220, 220, 15231, 198, 8783, 305, 4381, 220, 220, 1032, 11, 220, 3391, 11, 220, 2495, 11, 220, 14378, 11, 220, 4146, 198, 73, 361, 73259, 64573, 220, 2075, 198, 41, 773, 75, 598, 11, 622, 13, 8628, 68209, 220, 220, 1135, 11, 220, 10697, 198, 41, 13, 83870, 969, 220, 10697, 198, 41, 13, 1239, 689, 220, 10697, 198, 8783, 1238, 220, 18163, 198, 8783, 73, 3845, 220, 16085, 198, 58781, 13154, 220, 508, 11, 220, 6028, 11, 220, 10697, 4235, 914, 198, 36690, 13154, 355, 11, 622, 13, 34561, 285, 220, 220, 508, 11, 220, 6028, 11, 220, 220, 10697, 4235, 914, 198, 2078, 62, 15726, 12, 16707, 51461, 2712, 18958, 29573, 67, 256, 220, 13817, 220, 1627, 14, 2437, 14, 845, 256, 220, 19, 25, 3391, 9012, 198, 16884, 198, 25615, 1963, 41, 13, 99690, 2041, 20962, 220, 11057, 198, 41, 13, 13552, 4849, 220, 11057, 41, 13, 19972, 2259, 220, 11057, 41, 13, 36999, 59344, 220, 9741, 198, 42, 198, 74, 1141, 2319, 1518, 11002, 16088, 74, 526, 6151, 220, 11286, 74, 12930, 220, 2096, 4235, 1774, 74, 2979, 220, 2790, 11, 220, 8259, 74, 2979, 597, 2979, 220, 8259, 74, 1290, 220, 845, 11, 220, 11702, 42, 529, 36, 65036, 220, 11739, 11, 220, 11771, 11, 220, 9674, 11, 220, 9639, 11, 220, 11056, 11, 220, 11584, 11, 220, 8610, 11, 720, 12326, 11, 220, 12815, 198, 74, 51081, 220, 2166, 4235, 2491, 11, 220, 14087, 74, 9379, 220, 9741, 31764, 616, 258, 220, 5538, 74, 343, 37029, 220, 1774, 11, 220, 11057, 42, 343, 37029, 281, 6258, 460, 6925, 13, 735, 13, 86064, 99605, 220, 1774, 11, 220, 11057, 74, 3394, 220, 2790, 11, 220, 15966, 69031, 93584, 32680, 1494, 220, 11515, 19639, 275, 20337, 220, 10148, 74, 1962, 54454, 220, 8874, 11, 220, 14022, 114011, 10184, 220, 1032, 11, 220, 1774, 11, 220, 5926, 4235, 6365, 42, 46295, 16088, 220, 2983, 4235, 3391, 42, 46295, 29437, 220, 10718, 42, 47469, 689, 11, 735, 13, 63581, 285, 590, 288, 220, 11057, 198, 42, 13, 1370, 85, 333, 39260, 220, 11057, 42, 13, 2463, 24155, 220, 11057, 198, 114371, 26738, 220, 15966, 4235, 2946, 74, 31967, 18664, 220, 12375, 74, 952, 220, 16567, 4235, 2614, 198, 43, 198, 43, 533, 84, 936, 11, 445, 13, 7731, 10126, 220, 14057, 198, 43, 13, 3355, 3714, 64, 220, 11057, 4235, 1627, 198, 121466, 753, 4950, 496, 675, 220, 11584, 4235, 868, 121466, 753, 71532, 220, 9892, 4235, 1227, 11, 220, 17361, 121466, 753, 21818, 716, 220, 2550, 4235, 1049, 43, 309, 2411, 8176, 220, 14057, 16338, 64529, 220, 1032, 11, 220, 10125, 75, 1132, 220, 14057, 43, 277, 953, 70493, 4381, 6925, 13, 445, 13, 63021, 71435, 220, 14057, 43, 277, 5325, 11, 445, 13, 3512, 277, 292, 460, 220, 14057, 198, 43, 13, 490, 1748, 460, 220, 14057, 198, 43, 43613, 11, 445, 13, 6730, 764, 6347, 1518, 356, 6258, 309, 316, 372, 720, 11860, 764, 6347, 198, 43, 13, 13348, 121038, 220, 14057, 4235, 1544, 11, 220, 17361, 198, 43, 402, 438, 5724, 11, 445, 13, 6590, 592, 333, 39260, 6925, 13, 445, 13, 2856, 992, 285, 720, 1758, 11, 220, 6640, 11, 220, 17361, 198, 43, 13, 993, 3074, 220, 6640, 43, 13, 357, 4748, 59779, 220, 6640, 198, 79936, 1693, 220, 1758, 11, 220, 6640, 11, 220, 17361, 39166, 942, 689, 304, 4289, 285, 6925, 13, 445, 13, 453, 4749, 220, 14206, 75, 710, 1413, 42393, 11, 1957, 315, 220, 806, 11, 220, 1032, 273, 1677, 220, 806, 11, 220, 975, 11, 220, 845, 11, 220, 1987, 11, 220, 6086, 11, 220, 7529, 273, 1677, 293, 7828, 220, 1032, 11, 220, 8190, 11, 220, 17361, 273, 1677, 16763, 220, 2166, 11, 220, 3753, 4235, 1484, 11, 220, 17361, 273, 1677, 19120, 7304, 220, 4103, 11, 220, 9690, 11, 220, 14261, 4235, 1682, 73004, 56266, 11, 445, 13, 73151, 17544, 220, 14206, 198, 43, 13, 30548, 5237, 25734, 355, 220, 14206, 43, 13, 274, 83560, 59344, 220, 14206, 198, 43, 752, 307, 2411, 11, 445, 13, 757, 77251, 3893, 220, 14261, 198, 43, 13, 36999, 86231, 220, 14206, 4235, 1591, 198, 2356, 418, 24155, 36999, 3074, 6925, 13, 83621, 496, 372, 720, 46957, 8326, 86231, 220, 14261, 198, 645, 805, 272, 18615, 483, 220, 11387, 4235, 5547, 645, 805, 824, 38181, 36244, 220, 16544, 645, 805, 35113, 11600, 220, 8878, 2356, 77282, 34789, 710, 220, 14378, 2356, 77282, 35311, 6798, 220, 10861, 4235, 5958, 2356, 85, 4633, 372, 2856, 258, 1604, 6925, 13, 99278, 592, 86231, 720, 3532, 4633, 372, 220, 14261, 92898, 2874, 23332, 220, 11227, 14789, 3789, 220, 16955, 75, 93260, 64220, 220, 1419, 11, 220, 13302, 43, 343, 592, 86231, 11, 445, 13, 523, 10602, 87, 290, 70, 220, 14261, 198, 43, 13, 23464, 4633, 372, 1518, 28120, 4633, 372, 2856, 258, 1604, 43, 13, 7589, 1137, 220, 14261, 43, 13, 7147, 613, 3893, 220, 2983, 11, 220, 8546, 198, 75, 1570, 315, 279, 34681, 220, 2148, 11, 220, 6393, 40043, 320, 65661, 20962, 44521, 15719, 333, 39260, 8, 220, 11242, 11, 220, 7529, 11, 220, 5154, 40043, 320, 51, 25045, 91799, 6266, 220, 16367, 43, 485, 11, 7957, 220, 914, 75, 59317, 220, 16367, 2785, 220, 5245, 51697, 3458, 90802, 11, 10463, 355, 220, 1049, 11, 220, 10914, 11, 220, 16367, 3817, 23425, 220, 845, 11, 220, 972, 11, 220, 7743, 51697, 372, 11, 445, 13, 31747, 81987, 372, 220, 7743, 198, 43, 13, 603, 48877, 1056, 3375, 220, 845, 11, 220, 972, 11, 220, 7743, 198, 75, 2877, 689, 220, 14206, 43, 2877 ]
0xBreath/holistic-books
as a mere absence of symptoms or of any diagnosable illn ess. How many of us have no known symptoms yet we just don’ t fee l well? Nothing is wrong, yet something is. That something is our disconnect from our T ruth. Our physical symptoms, our mental/emotional turmoil is simply a result of tha t disconnect. Our symptoms tell us when a disease shows up physically, but that is not where it originates. Debbie came to me with sever e digestive issues. Her doctors suggested sur gery, which did not sit well w ith her as she was bar ely r ecovering fr om a pr evious sur gery for these same issues. After going thr ough th e details of the consultation, I asked her what was r eally going on. That’ s when she burst into tears and shar ed with me the story of her marital difficulties. Pr essur e to make her marriage work at any cost was keeping he r quiet and she was outwar dly trying to accept the situation. Internally, s he was not able to “digest” the state of her marriage, causing the health issues she was experiencing. Giving her some herbs and dietary r ecommendations without helping her to r esolve the underlying cause would not go far. She had never thought about what her expectations and needs we r e fr om her marriage. She was denying herself the right to be happy and fulf illed for the sake of keeping the marriage going. Along with giving Debbie some dietary guidelines, I also guided her to r esolve the marital conflict. In the medical w orld, the causes of an illness are believed to be physical, hence the endless testing to see w hat’ s going on with the physica l only. This may be needed, but it isn’ t the complete picture. At the very best, any psychological i ssues are referred to a psychologist or a psychiatrist, fragmenting the patient as if their physical health is separate from their psychological health. Y ou may get a little help from pursuing both routesseparately, but the whole pictu re is missed. This creates a huge internal confusion and conflict for the patient and they never really understand what’ s going on and how to fix it. W e are not a piece of machinery whose parts can be outsourced to dif ferent experts to “fix” what’ s broken. Every part of our being af fects every other part and only a holistic view can reveal the real problems. Rita came to me in the hopes of avoiding sur gery for her hip. She was in a wheelchair and had been unable to walk for the pr evious thr ee years. The lack of movement had caused further tissue deterioration. Accor ding to her, she became paralyzed all of a sudden out of the blue. This did not make sense to me as I could not find any physical r easons for her condition. I had picked u p fr om her pulse that ther e had been a past heartache t hat had not been r es olved. A fter I ruled eve rything else out for her condit ion, I asked her if she had e ndur ed a trauma in the past that was not yet healed. And ther e was. She r eported immedi ately that her inability to walk occurr ed at the same time as she had felt abandoned by one of her family members. This is the first time that she had con nected the trauma to her inability to walk. Now we both knew wher e the issues wer e and what needed healing. The roo t cause of disease is se ldom physical. Healing is about going to those deep root causes and creating shifts there. When we change that one thing in that deep place, chang es begin to cascade into every area of our life. Even the sm allest shift will have a profound ef fect, just like a little stir at the bottom of the ocean can create tidal waves. Healing is built in and healing i s what our human journey on this planet is about. M any of us are compell ed to go beyond the physical when struck with a terminal illness, a tragedy or just one of life’ s challenges. This innate healing is your T ruth, the wholeness that is trying to find you. S pirituality is about connecting with your spirit, as it knows the truth, and healing is the experience or result of that connection. All healing in that regard is spiritual. In the world of fixing, improving and navigating the web of societal conditioning, sp iritual healing is a breath of fresh air  awakening us to the knowing that we are whole, and are at the perfect place and time in ourlives.  It is in this place that the process becomes more of Self-discovery than of self-improvement. This is where we know that we can heal from anything and overcome any obstacles that get in our way. W e can always take a pill! And at times, it may be necessary for a short while so we can start to think straight. But if w e really want to heal at every level of our existence, then we must dig deeper, ask the bigger questions and develop a bigger context for our health. “Why do you th ink you are hav ing the health issues that you are having?” Asking this question to my clients takes them beyond the symptoms and allows their life story to emer g e. They often begin to see how the same story is playing out in other areas of their life, such as their wo rk and their relationships. Simply the willingness to look beyond the physical symptoms raises the level o f our awareness and we begin to see a bigger picture than we had before. That in itself is empowering and begins the healing process at the level of our awareness. U N R E S O L V E D S T O R I E S A N D D I S E A S E More times than not, a disease i s about our unresolved story. Th e only way to resolve or to heal the story is to go into the experience of it. What we experience at the cellular level will continuously repeat in other areas of our life and in our illness, until i t is resolved. The only way to heal that experience is first to allow it and open our heart to it as it is very much a part of who we are. And then w e may ask the bigger question. What may I learn from this experience? What’ s the lesson? This is where we do the work, d ig a little deeper and learn and heal what we need to heal. Our beliefs change, our habits line up and our body begins to heal. When we r ealize that we have the power to change our story, we begin to heal. This work isn’ t e asy. It requires a certain kind of stamina, but it is definitely easier th an livin g with an illness. Y ou may experience resistance in all kind of dif ferent ways, rationalizing the situation away or pretending that all is okay, w hen it isn’ t. Fear shows up in all kinds of distorted w ays. This is where you need expert guidance to help you through. Healing is an or ganicprocess. W e can’ t will it or force it to occur. W e allow it and stay present to it. That is healin g! It has its own timing, and we can facilitate i t by getting out of the way. These are the ancient teachings and the wisdom. W e can heal from anything if we use it for that purpose and with that intention. Healing r equires that we be willing to take a deep dive within and can stay the course. Healing is chosen, while illness happens b y default. Y ou can heal from anything and overcome the blocks that show up in the process. I believe that! In order for you to heal, you must believ e that, too. W e have the power to heal ourselves. Annie came to m e wanting to g et off her medication for colitis. In spite of doing e verything right, she felt her body had abandoned her. As we continued to work deeper, aband onment was the r ecurring theme in her life and it started with the passing of one of her par ents. Since th en she tried har d to hold on to the people in her life out of fear of being abandoned. That was the un r esolved issue that had manifested as colitis. I t was a big r elief for her to discover this an d to connect the physical to her emotions. Now we both knew wher e she needed help. What’ s unr esolved in your life? Something always is, as our lives ar e a work-in-pr ogr ess. When we ar e conscious of it, we see the unr esolved as it is, rather than giving it mor e power than it deserves. Whe n we give it mor e power, that’ s when it can manifest physically.C H A P T E R 9O u r C o n n e c t i o n w i t h C r e a t i o n W e are each a part of the whole of Creation. That which created us created everything aroun d us. The five elements, Ether, Air, Fire
[ 220, 439, 264, 17983, 19821, 315, 13803, 477, 315, 904, 198, 8747, 3326, 437, 481, 5986, 77, 4043, 13, 2650, 1690, 315, 603, 617, 912, 3967, 13803, 3686, 584, 1120, 198, 15357, 529, 259, 11307, 326, 1664, 30, 12334, 374, 5076, 11, 3686, 2555, 374, 13, 3011, 2555, 374, 1057, 198, 53092, 505, 1057, 350, 54246, 13, 5751, 7106, 13803, 11, 1057, 10723, 63876, 41964, 198, 66467, 61147, 374, 5042, 264, 1121, 315, 49588, 259, 30069, 13, 5751, 13803, 3371, 603, 994, 264, 198, 67, 56407, 5039, 709, 22655, 1174, 719, 430, 374, 539, 1405, 433, 99970, 627, 1951, 55971, 3782, 311, 757, 449, 3285, 384, 60071, 4819, 13, 6385, 16410, 12090, 198, 20370, 342, 727, 1174, 902, 1550, 539, 2503, 1664, 289, 78942, 1077, 439, 1364, 574, 3703, 658, 88, 436, 384, 93013, 1448, 8019, 264, 198, 652, 384, 2528, 1765, 342, 727, 369, 1521, 1890, 4819, 13, 4740, 2133, 8983, 220, 1409, 270, 384, 3649, 315, 198, 1820, 29173, 11, 358, 4691, 1077, 1148, 574, 436, 384, 750, 2133, 389, 13, 3011, 529, 274, 994, 1364, 198, 58838, 1139, 24014, 323, 26708, 1608, 449, 757, 279, 3446, 315, 1077, 60439, 27129, 627, 3617, 4043, 324, 384, 311, 1304, 1077, 11103, 990, 520, 904, 2853, 574, 10494, 568, 436, 11594, 323, 198, 32158, 574, 704, 11710, 294, 398, 4560, 311, 4287, 279, 6671, 13, 4514, 750, 1174, 274, 568, 574, 539, 198, 481, 311, 1054, 37439, 863, 220, 279, 1614, 315, 1077, 11103, 11, 14718, 279, 2890, 220, 4819, 1364, 198, 16514, 25051, 13, 58951, 1077, 1063, 42393, 323, 34625, 436, 384, 31628, 811, 198, 30096, 10695, 1077, 311, 436, 1560, 4035, 279, 16940, 5353, 1053, 539, 220, 733, 3117, 662, 3005, 198, 32345, 2646, 3463, 922, 1148, 1077, 17078, 323, 3966, 584, 436, 384, 1448, 8019, 1077, 198, 5730, 8950, 13, 3005, 574, 41566, 11937, 279, 1314, 311, 387, 6380, 323, 5716, 69, 3900, 839, 369, 279, 198, 82, 731, 315, 10494, 279, 11103, 2133, 627, 50909, 449, 7231, 64489, 1063, 34625, 17959, 11, 358, 1101, 33687, 1077, 311, 198, 81, 1560, 4035, 279, 60439, 12324, 627, 644, 279, 6593, 289, 477, 509, 11, 279, 11384, 315, 459, 17563, 527, 11846, 311, 387, 7106, 345, 71, 768, 279, 26762, 7649, 311, 1518, 289, 9072, 529, 274, 2133, 389, 449, 279, 4571, 3074, 326, 1193, 662, 1115, 198, 18864, 387, 4460, 11, 719, 433, 4536, 529, 259, 279, 4686, 6945, 13, 2468, 279, 1633, 1888, 11, 904, 198, 92109, 5848, 602, 11107, 1157, 527, 14183, 311, 264, 54595, 477, 264, 73969, 345, 43302, 287, 279, 8893, 439, 422, 872, 7106, 2890, 374, 8821, 220, 505, 872, 198, 92109, 5848, 2890, 13, 816, 6033, 1253, 636, 264, 2697, 1520, 505, 34118, 2225, 11543, 325, 1768, 2718, 1174, 719, 279, 4459, 72829, 84, 312, 374, 13942, 13, 1115, 11705, 264, 6908, 5419, 198, 6263, 7713, 323, 12324, 369, 279, 8893, 323, 814, 2646, 2216, 3619, 198, 12840, 529, 274, 2133, 389, 323, 1268, 311, 5155, 433, 627, 54, 384, 527, 539, 264, 6710, 315, 26953, 6832, 5596, 649, 387, 23651, 54492, 220, 311, 1422, 18728, 306, 198, 4683, 15916, 311, 1054, 5862, 863, 1148, 529, 274, 11102, 13, 7357, 961, 315, 1057, 1694, 8136, 282, 115192, 1475, 1023, 198, 4581, 323, 1193, 264, 61876, 1684, 649, 16805, 279, 1972, 5435, 627, 49, 6388, 3782, 311, 757, 304, 279, 16388, 315, 31526, 1765, 342, 727, 369, 1077, 18638, 13, 3005, 574, 304, 264, 198, 39690, 35296, 323, 1047, 1027, 12153, 311, 4321, 369, 279, 550, 384, 2528, 8983, 37443, 1667, 13, 578, 198, 105516, 315, 7351, 1047, 9057, 4726, 20438, 82189, 13, 11683, 269, 67542, 311, 1077, 13801, 32158, 6244, 88968, 682, 315, 264, 11210, 704, 315, 279, 6437, 13, 1115, 1550, 539, 1304, 198, 98935, 311, 220, 757, 439, 358, 1436, 539, 1505, 904, 7106, 436, 384, 99949, 369, 1077, 3044, 13, 358, 1047, 198, 94599, 577, 281, 1448, 8019, 1077, 28334, 430, 9139, 384, 1047, 1027, 264, 3347, 4851, 1815, 259, 9072, 1047, 539, 198, 82850, 436, 1560, 8492, 2111, 13, 362, 282, 466, 358, 21989, 49996, 35019, 1626, 775, 704, 369, 1077, 9955, 275, 28772, 11, 358, 4691, 198, 1964, 422, 1364, 1047, 384, 15953, 324, 1608, 264, 30988, 304, 279, 3347, 430, 574, 539, 3686, 62320, 13, 1628, 198, 700, 384, 574, 13, 3005, 436, 384, 36626, 5668, 520, 989, 430, 1077, 38550, 311, 4321, 3056, 8186, 1608, 520, 198, 1820, 1890, 892, 439, 1364, 1047, 6612, 23838, 555, 832, 315, 1077, 3070, 3697, 13, 1115, 198, 285, 279, 1176, 892, 430, 1364, 1047, 390, 308, 1599, 279, 30988, 311, 1077, 38550, 311, 4321, 627, 7184, 584, 2225, 7020, 421, 261, 384, 279, 4819, 7205, 384, 323, 1148, 4460, 21730, 627, 791, 938, 78, 259, 5353, 315, 8624, 374, 513, 326, 5717, 7106, 13, 49741, 374, 922, 2133, 311, 198, 54719, 5655, 3789, 11384, 323, 6968, 29735, 1070, 13, 3277, 584, 2349, 430, 832, 198, 1626, 304, 430, 5655, 2035, 11, 2609, 1560, 3240, 311, 43118, 1139, 1475, 3158, 315, 1057, 198, 14789, 13, 7570, 279, 1554, 12584, 267, 6541, 690, 617, 264, 28254, 31469, 282, 440, 11, 1120, 1093, 264, 2697, 23935, 198, 266, 279, 5740, 315, 279, 18435, 649, 1893, 86559, 17301, 627, 1548, 6260, 374, 5918, 304, 323, 21730, 602, 274, 1148, 1057, 3823, 11879, 389, 420, 11841, 374, 198, 9274, 13, 386, 904, 315, 220, 603, 527, 1391, 616, 1608, 311, 733, 7953, 279, 7106, 994, 17948, 198, 4291, 264, 15372, 17563, 11, 264, 31926, 220, 477, 1120, 832, 315, 2324, 529, 274, 11774, 13, 1115, 65070, 198, 383, 6260, 374, 701, 350, 54246, 11, 279, 421, 17648, 434, 430, 374, 4560, 311, 1505, 499, 13, 328, 281, 7051, 10965, 374, 198, 9274, 21583, 449, 701, 9090, 11, 439, 433, 8964, 279, 8206, 11, 323, 21730, 374, 279, 198, 50659, 477, 1121, 315, 430, 3717, 13, 2052, 21730, 304, 430, 5363, 374, 198, 86390, 940, 627, 644, 279, 1917, 315, 36351, 11, 18899, 323, 60499, 279, 3566, 315, 59529, 198, 9233, 287, 11, 993, 6348, 275, 940, 21730, 374, 264, 11745, 315, 7878, 3805, 4194, 75149, 603, 311, 279, 198, 33134, 287, 430, 584, 527, 4459, 11, 323, 527, 520, 279, 4832, 2035, 323, 892, 304, 1057, 75, 1924, 13, 4194, 1102, 374, 304, 420, 2035, 430, 279, 1920, 9221, 810, 315, 10323, 10694, 7601, 198, 54895, 315, 659, 38025, 782, 7986, 13, 1115, 374, 1405, 584, 1440, 430, 584, 649, 27661, 505, 198, 73254, 323, 23075, 904, 32116, 430, 636, 304, 1057, 1648, 662, 468, 384, 649, 2744, 198, 23609, 264, 15530, 0, 1628, 520, 3115, 11, 433, 1253, 387, 5995, 369, 264, 2875, 1418, 779, 584, 649, 198, 2527, 311, 1781, 7833, 13, 2030, 422, 289, 384, 2216, 1390, 311, 27661, 520, 1475, 2237, 315, 1057, 198, 93772, 11, 1243, 584, 2011, 4170, 19662, 1174, 2610, 279, 11493, 4860, 323, 2274, 264, 198, 65, 4601, 2317, 369, 1057, 2890, 627, 2118, 10445, 656, 499, 270, 27513, 499, 527, 31081, 6892, 279, 2890, 4819, 430, 499, 527, 3515, 12671, 198, 2170, 10789, 420, 3488, 311, 856, 8403, 5097, 1124, 7953, 279, 13803, 323, 198, 56967, 872, 2324, 3446, 311, 991, 261, 342, 384, 13, 2435, 3629, 3240, 311, 1518, 1268, 279, 1890, 198, 27583, 374, 5737, 704, 304, 1023, 5789, 315, 872, 2324, 11, 1778, 439, 872, 24670, 59106, 323, 872, 198, 86924, 13, 29524, 279, 39375, 311, 1427, 7953, 279, 7106, 13803, 198, 33371, 279, 2237, 297, 282, 1057, 17985, 323, 584, 3240, 311, 1518, 264, 11493, 6945, 1109, 198, 906, 1047, 1603, 13, 3011, 304, 5196, 374, 66388, 323, 12302, 279, 21730, 1920, 198, 266, 279, 2237, 315, 1057, 17985, 627, 52, 452, 432, 469, 328, 507, 445, 650, 469, 423, 220, 328, 350, 507, 432, 358, 469, 328, 220, 362, 452, 423, 220, 423, 358, 328, 469, 362, 328, 469, 198, 7816, 3115, 1109, 539, 11, 264, 8624, 602, 274, 922, 1057, 81261, 3446, 662, 666, 384, 1193, 1648, 198, 998, 9006, 477, 311, 27661, 279, 3446, 374, 311, 733, 1139, 279, 3217, 315, 433, 13, 3639, 584, 198, 50659, 520, 279, 35693, 2237, 690, 31978, 13454, 304, 1023, 5789, 315, 1057, 198, 14789, 323, 304, 1057, 220, 17563, 11, 3156, 602, 259, 374, 20250, 13, 578, 1193, 1648, 311, 27661, 430, 198, 50659, 374, 1176, 311, 2187, 433, 323, 1825, 1057, 4851, 311, 433, 439, 433, 374, 1633, 1790, 264, 198, 4581, 315, 889, 584, 527, 13, 1628, 1243, 289, 384, 1253, 2610, 279, 11493, 3488, 13, 3639, 1253, 358, 198, 12964, 505, 420, 3217, 30, 3639, 529, 274, 279, 18228, 30, 1115, 374, 1405, 584, 656, 279, 198, 1816, 11, 294, 19935, 264, 2697, 19662, 323, 4048, 323, 27661, 1148, 584, 1205, 311, 27661, 13, 5751, 198, 9978, 30921, 2349, 11, 1057, 26870, 1584, 709, 323, 1057, 2547, 12302, 311, 27661, 627, 4599, 584, 436, 384, 278, 553, 430, 584, 617, 279, 2410, 311, 2349, 1057, 3446, 1174, 584, 3240, 198, 998, 27661, 627, 2028, 990, 4536, 529, 259, 384, 439, 88, 662, 1102, 7612, 264, 3738, 3169, 315, 61784, 11, 719, 433, 374, 8659, 198, 68, 77783, 270, 459, 15471, 258, 342, 449, 459, 17563, 662, 816, 6033, 1253, 3217, 13957, 304, 682, 3169, 198, 1073, 1422, 18728, 306, 5627, 11, 25442, 4954, 279, 6671, 3201, 477, 55906, 430, 682, 374, 198, 94317, 1174, 289, 48916, 433, 4536, 529, 259, 13, 43067, 5039, 220, 709, 304, 682, 13124, 315, 62236, 289, 264, 1065, 13, 1115, 374, 198, 2940, 499, 1205, 6335, 19351, 311, 1520, 499, 1555, 13, 49741, 374, 459, 477, 25893, 292, 4734, 13, 468, 384, 649, 529, 259, 690, 433, 477, 5457, 433, 311, 12446, 662, 468, 384, 2187, 433, 323, 4822, 3118, 311, 198, 275, 13, 3011, 374, 27661, 258, 342, 0, 1102, 706, 1202, 1866, 18912, 11, 323, 584, 649, 28696, 602, 259, 555, 3794, 198, 412, 315, 279, 1648, 16853, 9673, 527, 279, 14154, 45572, 323, 279, 24278, 13, 468, 384, 649, 27661, 505, 4205, 198, 333, 584, 1005, 433, 369, 430, 7580, 323, 449, 430, 14944, 13, 49741, 436, 3312, 3946, 430, 198, 906, 387, 10032, 311, 220, 1935, 264, 5655, 30963, 2949, 323, 649, 4822, 279, 3388, 662, 49741, 374, 198, 64175, 11, 1418, 17563, 8741, 293, 379, 1670, 13, 220, 816, 6033, 220, 649, 220, 27661, 505, 4205, 323, 198, 2017, 2063, 279, 10215, 430, 1501, 709, 304, 279, 1920, 13, 358, 4510, 430, 0, 763, 2015, 369, 198, 9514, 311, 27661, 11, 499, 2011, 2888, 85, 384, 430, 11, 2288, 13, 468, 384, 617, 279, 2410, 311, 27661, 198, 2530, 4372, 627, 2127, 11044, 3782, 311, 296, 384, 19762, 311, 342, 1880, 1022, 1077, 24099, 369, 1400, 20000, 13, 763, 34781, 315, 198, 45359, 384, 1633, 1626, 1314, 11, 1364, 6612, 1077, 2547, 1047, 23838, 1077, 662, 1666, 584, 198, 86957, 311, 990, 19662, 1174, 671, 438, 389, 479, 574, 279, 436, 384, 46839, 7057, 304, 1077, 2324, 198, 438, 433, 3940, 449, 279, 12579, 315, 832, 315, 1077, 1370, 37952, 13, 8876, 270, 665, 1364, 6818, 198, 13279, 294, 311, 3412, 389, 220, 311, 279, 1274, 304, 1077, 2324, 704, 315, 8850, 315, 1694, 23838, 627, 4897, 574, 279, 653, 436, 1560, 8905, 4360, 430, 1047, 79754, 439, 1400, 20000, 13, 358, 259, 574, 264, 2466, 198, 81, 658, 4843, 369, 220, 1077, 311, 7142, 420, 459, 294, 311, 4667, 279, 7106, 311, 1077, 21958, 627, 7184, 584, 2225, 7020, 421, 261, 384, 1364, 4460, 1520, 627, 3923, 529, 274, 41480, 1560, 8905, 304, 701, 2324, 30, 25681, 2744, 374, 11, 439, 1057, 6439, 802, 384, 264, 198, 1816, 3502, 27748, 96361, 4043, 13, 3277, 584, 802, 384, 17371, 315, 433, 11, 584, 1518, 279, 41480, 1560, 8905, 439, 198, 275, 374, 11, 4856, 1109, 7231, 433, 4411, 384, 220, 2410, 1109, 433, 30675, 13, 33104, 308, 584, 3041, 433, 198, 57902, 384, 2410, 1174, 430, 529, 274, 994, 433, 649, 14794, 22655, 662, 34, 473, 362, 393, 350, 469, 432, 220, 220, 24, 46, 577, 436, 220, 356, 297, 308, 308, 384, 272, 259, 602, 297, 308, 220, 289, 602, 259, 305, 220, 356, 436, 384, 264, 259, 602, 297, 308, 198, 54, 384, 527, 1855, 264, 961, 315, 279, 4459, 315, 35386, 13, 3011, 902, 3549, 603, 3549, 198, 73826, 66208, 77, 294, 603, 13, 578, 4330, 5540, 11, 35978, 1174, 6690, 1174, 6785 ]
0xBreath/holistic-books
Only at low tide, he says, co uld the inland cave dwellers trek to the sea and un dertake the hazardous venture of harvesting mussels and other mollusks against the pounding surf. Trapped in the direst distress, our ancestors had no avenue of physical rescue or escape. How did they find the means to rescue themselves? E d i t i n g R e a l i t y The answer is not physical. Fascinating as these archeological discoveries are, it wasn’t harsh external pressure that forced our ancestors to adapt. It took a great reality shift “in here.” We became a consciousness-based species, using the mind to outwit Nature’s challenges. One of the most important factors in the expansion of human consciousness was that our brains became too big, efficient, and complex for their own good. A kind of brain overload fueled our desperate need to whittle it down so th at daily life wou ld be manageable. If the rush and hubbub of a mod ern city seem li ke over load, that’s nothing compared to the mental crisis our remote ancestors faced. The pro blem wasn’t that the human brain simply grew and couldn’t stop. The problem was that instinct, which guides how other cr eatures behave, bega n to dwindle in us. A honeybee seeks only flo wers; it instinctually stings an intruder; only the queen bee lays egg s. Hum an beings have a choice in all three behaviors. We explore Nature for all manner of food. We fight or keep the peace in different circumstances. We mate according to extremely complex behavior patterns. Having been freed from instinct, thechoices that face us are lite rally infinite. The brain cannot be infinitely large, however. So how can the human mind fit infinite choice within a finite physiology? This wa sn’t a dilemma faced only by our remote ance stors. Every newbor n baby comes into a world where too much information is constantly bombarding the higher brain, a flood of raw data that could never be processed in its totality. Think of searching for your car in a crowded parking lot. To find it, you don’t visually take in the pave ment, sky, people, and every vehicle, still or moving, in your field of vision. Instead, you have a mental image of your car, and, wi th focused attention, you edit out everything that’s irrelevant to one task, finding a specific vehicle. This points to another reason we develop an ego. People identify with what they can do. A car mechanic is different from a concert violinist. A sentence that begins with “I am X” can end with all kinds of behaviors, tr aits, talents, and preferences. By the same token, a sentence that b egins with “I am not Y” can also end in many ways. As it turns out, the list of things that we choose not to be is much l onger than that of the things we choose to b e. If you are a Christia n, that’s a si ngle choice that excludes all other religions—at p resent count, there are 4,200 faiths in the world that a person with one faith d oesn’t have to think about e xcept in passing. As we exclude countless choices without even thinking about th em, w e are editing re ality according to the dictates of the individual “I.” This ability to edit raw realit y was already present in an imals that hunt for a specific prey, for example, but there was no conscious choo sing involved. When penguins and other seabirds that nes t in huge colonies come back to shore with their c rops full of food, they somehow find t he one specific fledgling that belongs to them in the overwhelming din of noise created by thousands of chicks. The arctic fox can detect the movement of mice underneath several feet of snow in the winter and pounce precisely on its prey. Monarch butterflies can follow an exact migration patt ern to and from one locale in Mexico wh ere they breed. There’s an enormous myste ry about how humans developed focused attenti on, not for specific types of food and locales, but asa tr ait we can turn on and off. The things you’re interested in fascinate you and hold your attention, while the things you have no inte rest in escape your n otice. The appeal of detective novels lies in how c leverly a Sherlock Holmes notices the tiniest, seemingly irrel evant clue. (Holmes, we are told, was an e xpert in cigar as h and what kind of tobacco each ash represented, but he didn’t know that the Earth r evolves around the Sun because that bit of knowledge was useless in the art of crime detection.) Even though we cannot solve this mystery of paying attention versus tuning out, there’s no doubt that “I” is in charge of both. My wif e and children and grandchildren are objects of deep personal interest to me (the kind of interest we label as “love”) while th ey are total strangers to nearly seven billion other people on the planet. Once attention is focused, emotion follows. Growing up, my son Go tham loved the Boston Celtics basketball team and hated th e Los Angeles Lakers. This became part of who he was, an either/or decision that he identified with. Either/or is the most basic ed iting tool our minds possess, and it b egins with “me or not me.” Ego separates each pers on from every other person though countless decisions about “me or not me.” M any such decisions have no real purpose except to reinforce the ego. (It’s not as if Celtics fans are better, smarter, or more well-off than Lakers fans. Yet when Gotham found himself moving to Los Angeles, and his wor k put him in close contact with the Lakers, it was a wrenching c hange. Turning “not me” into “me” can be very hard. Imagine, for example, that you had to spend a year working for a political party you’ve disliked all your life.) As the ego metastasized over time, the “other” acquired differences became the basis of social suspicion and disapproval. Before my children were born, I was a newly arrived immigrant working at a h ospital in New Jersey during the doctor s hortage caused by the Vietnam War in the 1970s. Every day going to work, I kn ew in the back of my min d that the American-born doctors in the emergency room looked upon me as their inferior because I had come from India. If we stand back and consider the whole picture, “I” edits reality too much and for se lfish reasons. We deliberately close ourselves off from new possibilities to suit old, fixed pref erences.Everyone’s past is a chaotic c ollection of choices about what they like and dislike, how they fee l emotionally, and the memories they carry ar ound as baggage, not to mention their fixed beliefs, family history, and every life-altering experience since birth. You weren’t shaped by what happened to you since birth. You were sh aped b y what you th ought about those happenin gs. The ego and every response it has ever had is a vast mental construct— the metastasis of “I”—that grew from the seeds of ego in our remote ancest ors. Our ability to edit reality is responsible for everything a human being c an decide to pay attention to, and since w e pay attention to billions of things, reality in its unedited state must be v astly larger. Human achievements represen t a tiny fraction of what reality has to offer—the horizon spreading before us is unlimited. D e c i d i n g t o L e t G o We’ve b een covering what might be called the natural history of “I,” and it has told us many important things about how the virtual reality we accept as real is actually mind-made. In the human mind, reality is constructed so that The available information isn’t overwhelming and chaotic. We feel free to accept or reject any aspect of reality we choose. We seek to repeat the most familiar, safe, and agreeable experiences. We avoid the most threatening, strange, and disagreeable experiences. The ultimate judge of what’s real is the ego, which is highly personal and selective about how we interpret the world. I’m not here to declare that the ego is your enemy, which would be just another ego judgment. From a neutral standpoint, the egois limiti ng. Having chosen to travel through life with “I” as your most intimate companion, you have silently agreed to filter, censor, and judge your exp eriences. That’s the primary use of consciousness in most people ’s lives, and it’s like using a powerful computer just for emails. To limit your personal reality shuts you off from the infinite potential that is the greatest gift of consciousness. At some point “I” edits out too much reality or misse s the important things that could expand love, compassion, creativity, and evolution. We spend too much mental energy focusing on things that are damaging and self-defeating. If you’ve attended a
[ 8442, 520, 3428, 43038, 11, 568, 198, 98036, 11, 1080, 8725, 67, 279, 77289, 26457, 44935, 388, 45688, 311, 279, 9581, 323, 653, 294, 531, 731, 198, 1820, 51024, 26255, 315, 66747, 296, 32964, 323, 1023, 55509, 355, 2857, 198, 69849, 279, 70627, 20884, 627, 1305, 5795, 304, 279, 13510, 267, 35104, 11, 1057, 38618, 1047, 912, 62803, 315, 198, 47692, 17629, 477, 12731, 13, 2650, 1550, 814, 1505, 279, 3445, 311, 17629, 198, 339, 12116, 4372, 5380, 36, 294, 602, 259, 602, 308, 342, 220, 432, 384, 264, 326, 602, 259, 379, 198, 791, 4320, 374, 539, 7106, 13, 70707, 16252, 439, 1521, 802, 1557, 5848, 198, 98729, 552, 527, 11, 433, 5828, 1431, 25984, 9434, 7410, 430, 9770, 1057, 198, 685, 267, 1105, 311, 10737, 13, 1102, 3952, 264, 2294, 8903, 6541, 1054, 258, 1618, 2029, 1226, 198, 17106, 373, 264, 25917, 6108, 9606, 11, 1701, 279, 4059, 311, 704, 89619, 198, 79519, 753, 11774, 13, 3861, 315, 220, 279, 1455, 3062, 9547, 304, 279, 198, 4683, 10722, 315, 3823, 25917, 574, 430, 1057, 35202, 6244, 198, 37227, 2466, 11, 11297, 11, 323, 6485, 369, 872, 1866, 1695, 13, 362, 3169, 315, 8271, 198, 2017, 1096, 59461, 1057, 28495, 220, 1205, 311, 421, 2433, 433, 1523, 779, 270, 520, 7446, 198, 14789, 289, 283, 27221, 387, 71128, 13, 1442, 279, 13270, 323, 19240, 65, 392, 315, 264, 1491, 93029, 3363, 198, 325, 336, 908, 2004, 927, 2865, 11, 430, 753, 4400, 7863, 311, 279, 10723, 11501, 198, 414, 8870, 38618, 17011, 627, 791, 463, 293, 3516, 5828, 1431, 430, 279, 3823, 8271, 5042, 14264, 323, 198, 92062, 1431, 3009, 13, 578, 3575, 574, 430, 31655, 11, 902, 28292, 1268, 198, 1605, 1589, 384, 2859, 36792, 11, 2197, 64, 308, 311, 14156, 58863, 304, 603, 13, 362, 26828, 33131, 26737, 198, 3323, 9943, 289, 388, 26, 433, 31655, 1870, 357, 826, 459, 10805, 33719, 26, 1193, 279, 29006, 38328, 198, 64459, 19151, 274, 13, 20449, 459, 23837, 617, 264, 5873, 304, 682, 2380, 28198, 13, 1226, 198, 4683, 20763, 22037, 369, 682, 11827, 315, 3691, 13, 1226, 4465, 477, 2567, 279, 9096, 198, 258, 2204, 13463, 13, 1226, 30276, 4184, 311, 9193, 198, 24126, 7865, 12912, 13, 20636, 1027, 28634, 505, 31655, 11, 279, 25825, 430, 3663, 603, 527, 50772, 19768, 24746, 13, 578, 8271, 4250, 387, 198, 13885, 7627, 3544, 1174, 4869, 13, 2100, 1268, 649, 279, 3823, 4059, 5052, 220, 24746, 198, 12008, 2949, 264, 35326, 78152, 5380, 2028, 10667, 4224, 1431, 264, 55867, 17011, 1193, 555, 1057, 8870, 44260, 357, 1105, 627, 11769, 502, 9552, 308, 8945, 4131, 1139, 264, 1917, 1405, 2288, 1790, 198, 26125, 374, 15320, 13054, 29510, 279, 5190, 8271, 11, 264, 18197, 315, 198, 1059, 828, 430, 1436, 2646, 387, 15590, 304, 1202, 2458, 2786, 13, 21834, 315, 198, 1874, 287, 369, 701, 1841, 304, 264, 39313, 13217, 2763, 13, 2057, 1505, 433, 11, 499, 198, 15357, 1431, 43395, 1935, 304, 279, 94123, 11540, 11, 13180, 11, 1274, 11, 323, 1475, 7458, 345, 44466, 477, 7366, 1174, 304, 701, 2115, 315, 11376, 13, 12361, 11, 499, 617, 264, 10723, 198, 1843, 315, 701, 1841, 11, 323, 11, 24129, 270, 10968, 6666, 11, 499, 4600, 704, 198, 73826, 430, 753, 40815, 311, 832, 3465, 11, 9455, 264, 3230, 7458, 627, 2028, 3585, 311, 2500, 2944, 584, 2274, 459, 37374, 13, 9029, 198, 81496, 449, 1148, 814, 649, 656, 13, 362, 1841, 45239, 374, 2204, 505, 264, 198, 89405, 63137, 380, 13, 362, 11914, 220, 430, 12302, 449, 1054, 40, 1097, 1630, 863, 649, 842, 198, 4291, 682, 220, 13124, 315, 28198, 11, 490, 264, 1220, 11, 35032, 11, 323, 19882, 13, 3296, 279, 198, 25030, 4037, 11, 264, 11914, 430, 293, 8866, 1354, 449, 1054, 40, 1097, 539, 816, 863, 649, 1101, 842, 198, 258, 1690, 5627, 13, 1666, 433, 10800, 704, 1174, 279, 1160, 315, 2574, 430, 584, 5268, 539, 198, 998, 387, 374, 1790, 326, 389, 1414, 1109, 430, 315, 279, 2574, 584, 5268, 311, 293, 384, 13, 1442, 499, 198, 548, 264, 3771, 689, 308, 11, 430, 753, 264, 4502, 308, 3491, 5873, 430, 64468, 682, 1023, 198, 3833, 343, 919, 99563, 281, 47540, 1797, 11, 1070, 527, 220, 19, 11, 1049, 10082, 82, 304, 279, 1917, 198, 9210, 264, 1732, 449, 832, 10082, 294, 297, 288, 77, 1431, 617, 311, 1781, 922, 384, 865, 1512, 304, 198, 6519, 287, 13, 1666, 584, 22429, 28701, 11709, 2085, 1524, 7422, 198, 9274, 270, 991, 11, 289, 384, 527, 16039, 312, 453, 488, 4184, 311, 279, 80330, 315, 279, 198, 55977, 1054, 40, 49216, 2028, 5845, 311, 4600, 7257, 1972, 275, 379, 574, 2736, 3118, 304, 459, 737, 1147, 198, 9210, 19614, 369, 264, 3230, 37693, 11, 369, 3187, 11, 719, 1070, 574, 912, 198, 64589, 2665, 78, 7936, 6532, 13, 3277, 281, 56458, 323, 1023, 66591, 2668, 82, 198, 9210, 103226, 259, 304, 6908, 49028, 2586, 1203, 311, 31284, 449, 872, 272, 220, 3787, 2539, 198, 1073, 3691, 11, 220, 814, 17354, 1505, 259, 568, 832, 3230, 30010, 70, 2785, 430, 17623, 198, 998, 1124, 304, 279, 22798, 11884, 315, 12248, 3549, 555, 9214, 315, 198, 331, 5908, 13, 578, 802, 26636, 39935, 649, 11388, 279, 7351, 315, 24548, 198, 8154, 28917, 3892, 7693, 315, 12056, 304, 279, 12688, 323, 281, 9933, 198, 10872, 285, 989, 389, 1202, 37693, 13, 3206, 1132, 81776, 649, 1833, 459, 4839, 198, 81327, 84167, 93029, 311, 323, 505, 832, 19076, 304, 12550, 421, 39357, 814, 198, 21152, 291, 627, 3947, 753, 459, 23205, 11679, 68, 35019, 922, 1268, 12966, 8040, 198, 63257, 1651, 23202, 389, 11, 539, 369, 3230, 4595, 315, 3691, 323, 53397, 11, 719, 439, 64, 490, 107902, 584, 649, 220, 2543, 389, 323, 1022, 13, 578, 2574, 499, 3207, 8173, 304, 198, 69, 5171, 3357, 499, 323, 3412, 701, 6666, 11, 1418, 279, 2574, 499, 617, 198, 2201, 29387, 2800, 304, 12731, 701, 308, 14479, 560, 13, 578, 14638, 315, 45259, 32963, 198, 49201, 304, 1268, 272, 28605, 398, 264, 61726, 40401, 35871, 279, 259, 6729, 478, 345, 325, 336, 11559, 6348, 3833, 3721, 519, 31089, 13, 320, 79762, 9004, 11, 584, 527, 3309, 11, 574, 459, 384, 38345, 531, 304, 198, 66, 52384, 439, 305, 323, 1148, 3169, 315, 27531, 1855, 24767, 15609, 1174, 719, 568, 198, 97849, 1431, 1440, 430, 279, 9420, 436, 93054, 2212, 279, 8219, 1606, 430, 198, 4590, 315, 6677, 574, 29948, 304, 279, 1989, 315, 9977, 18468, 29275, 13461, 3582, 584, 4250, 11886, 220, 420, 23347, 315, 12798, 6666, 198, 3078, 355, 42438, 704, 11, 1070, 753, 912, 220, 10712, 430, 1054, 40, 863, 374, 304, 6900, 315, 2225, 627, 5159, 289, 333, 384, 323, 2911, 323, 50851, 527, 6302, 315, 5655, 198, 30712, 2802, 311, 757, 320, 1820, 3169, 315, 2802, 584, 2440, 439, 1054, 31153, 863, 340, 3556, 270, 3999, 527, 2860, 40721, 311, 7154, 8254, 7239, 1023, 1274, 198, 263, 279, 11841, 13, 9843, 6666, 374, 10968, 11, 20356, 11263, 13, 60780, 198, 455, 11, 856, 4538, 6122, 103446, 10456, 279, 10406, 58796, 19794, 2128, 323, 198, 71, 660, 270, 384, 9853, 12167, 47596, 662, 1115, 6244, 961, 315, 889, 568, 574, 11, 459, 198, 50998, 5255, 5597, 430, 568, 11054, 449, 627, 50344, 5255, 374, 279, 1455, 6913, 1608, 433, 287, 5507, 1057, 20663, 15575, 11, 323, 198, 275, 293, 8866, 1354, 449, 1054, 2727, 477, 539, 757, 2029, 469, 3427, 62849, 1855, 7565, 389, 505, 198, 30115, 1023, 1732, 3582, 28701, 11429, 922, 1054, 2727, 477, 539, 198, 2727, 2029, 386, 904, 1778, 11429, 617, 912, 1972, 7580, 3734, 311, 55414, 198, 1820, 37374, 13, 320, 2181, 753, 539, 439, 422, 58796, 7359, 527, 2731, 11, 47578, 11, 477, 810, 198, 9336, 12744, 1109, 47596, 7359, 13, 14968, 220, 994, 74982, 1766, 5678, 7366, 198, 998, 9853, 12167, 1174, 323, 813, 4191, 597, 2231, 1461, 304, 3345, 3729, 449, 279, 198, 43, 8476, 11, 433, 574, 264, 60588, 287, 272, 305, 853, 13, 72633, 1054, 1962, 757, 863, 1139, 1054, 2727, 89874, 4919, 387, 1633, 2653, 13, 38891, 11, 369, 3187, 11, 430, 499, 1047, 311, 8493, 264, 198, 3236, 3318, 369, 264, 5054, 4717, 499, 4070, 99733, 682, 701, 2324, 29275, 2170, 279, 37374, 68370, 300, 1534, 927, 892, 11, 279, 1054, 1605, 863, 19426, 198, 67, 59426, 6244, 279, 8197, 315, 3674, 38141, 323, 834, 55539, 627, 10438, 856, 2911, 1051, 9405, 11, 358, 574, 264, 13945, 11721, 37650, 198, 21837, 520, 264, 305, 64590, 2223, 304, 1561, 16228, 2391, 279, 10896, 274, 305, 371, 425, 198, 936, 2656, 555, 279, 23315, 5111, 304, 279, 220, 4468, 15, 82, 13, 7357, 1938, 2133, 311, 990, 345, 40, 1168, 37990, 304, 279, 1203, 315, 856, 1332, 294, 430, 279, 3778, 40260, 16410, 304, 198, 1820, 13147, 3130, 7111, 5304, 757, 439, 872, 38279, 1606, 358, 198, 32345, 2586, 505, 6890, 627, 2746, 584, 2559, 1203, 323, 2980, 279, 4459, 6945, 11, 1054, 40, 863, 51944, 198, 265, 2786, 2288, 1790, 323, 369, 513, 326, 18668, 8125, 13, 1226, 36192, 3345, 198, 2530, 4372, 1022, 505, 502, 24525, 311, 7937, 2362, 11, 8521, 19257, 2781, 2436, 5253, 1225, 606, 753, 3347, 374, 264, 53087, 272, 8492, 1191, 315, 11709, 922, 1148, 814, 198, 4908, 323, 48969, 11, 1268, 814, 11307, 326, 38683, 11, 323, 279, 19459, 814, 198, 74865, 802, 220, 801, 439, 61649, 11, 539, 311, 6420, 872, 8521, 21463, 11, 3070, 198, 19375, 11, 323, 1475, 2324, 19308, 60485, 3217, 2533, 7342, 627, 2675, 15058, 1431, 27367, 555, 1148, 7077, 311, 499, 2533, 7342, 13, 1472, 198, 52898, 559, 1469, 291, 293, 379, 1148, 499, 270, 22525, 922, 1884, 3621, 258, 29181, 13, 578, 198, 13546, 323, 1475, 2077, 433, 706, 3596, 1047, 374, 264, 13057, 10723, 9429, 2345, 198, 1820, 68370, 10949, 315, 1054, 40, 63750, 9210, 14264, 505, 279, 19595, 315, 37374, 220, 304, 1057, 198, 18643, 27007, 477, 82, 13, 5751, 5845, 311, 4600, 8903, 374, 8647, 369, 198, 73826, 264, 3823, 1694, 272, 459, 10491, 311, 2343, 6666, 311, 11, 323, 198, 11536, 289, 384, 2343, 6666, 311, 33151, 315, 2574, 11, 8903, 304, 1202, 653, 62503, 198, 2513, 2011, 387, 348, 12025, 398, 8294, 13, 11344, 33997, 2109, 417, 268, 259, 264, 13987, 198, 82190, 315, 1148, 8903, 706, 311, 220, 3085, 22416, 35174, 31135, 1603, 198, 355, 374, 27862, 627, 35, 384, 272, 602, 294, 602, 308, 342, 220, 259, 297, 220, 445, 384, 259, 220, 480, 297, 198, 1687, 4070, 293, 8517, 18702, 1148, 2643, 387, 2663, 279, 5933, 3925, 315, 198, 10378, 2476, 323, 433, 706, 3309, 603, 1690, 3062, 2574, 922, 1268, 279, 4200, 198, 265, 2786, 584, 4287, 439, 1972, 374, 3604, 4059, 27975, 13, 763, 279, 220, 3823, 198, 38824, 11, 8903, 374, 20968, 779, 430, 198, 791, 2561, 2038, 4536, 1431, 22798, 323, 53087, 627, 1687, 2733, 1949, 311, 4287, 477, 8007, 904, 13189, 315, 8903, 584, 198, 28150, 627, 1687, 6056, 311, 13454, 279, 1455, 11537, 11, 6220, 11, 323, 7655, 481, 198, 327, 69597, 627, 1687, 5766, 279, 1455, 27903, 11, 15234, 11, 323, 29395, 481, 198, 327, 69597, 627, 791, 17139, 11913, 315, 1148, 753, 1972, 374, 279, 37374, 11, 902, 374, 7701, 198, 30712, 323, 44010, 922, 1268, 584, 14532, 279, 1917, 627, 40, 4344, 539, 1618, 311, 16292, 430, 279, 37374, 374, 701, 9354, 11, 902, 1053, 198, 1395, 1120, 2500, 220, 37374, 19971, 13, 5659, 264, 21277, 51882, 11, 279, 37374, 285, 4017, 72, 7933, 13, 20636, 12146, 311, 5944, 1555, 2324, 449, 1054, 40, 863, 439, 701, 198, 3646, 32487, 22489, 11, 499, 617, 50494, 7378, 311, 4141, 345, 66, 3890, 11, 323, 11913, 701, 1367, 2781, 12242, 13, 3011, 753, 279, 6156, 220, 1005, 315, 198, 64589, 2136, 304, 1455, 1274, 18217, 82, 6439, 11, 323, 433, 753, 1093, 1701, 264, 8147, 198, 44211, 1120, 369, 14633, 13, 2057, 4017, 701, 4443, 8903, 89678, 499, 198, 1885, 505, 279, 24746, 4754, 430, 374, 279, 12474, 8352, 315, 198, 64589, 2136, 627, 1688, 1063, 1486, 1054, 40, 863, 51944, 704, 2288, 1790, 8903, 477, 5906, 325, 274, 279, 198, 15693, 2574, 430, 1436, 9407, 3021, 11, 30481, 11, 28697, 345, 438, 15740, 13, 220, 1226, 8493, 2288, 1790, 10723, 4907, 21760, 389, 198, 58174, 430, 527, 34446, 323, 220, 659, 29899, 91955, 13, 1442, 499, 4070, 18677, 264, 198 ]
0xBreath/holistic-books
Journal of Nutrition that algae-based DHA can boost levels of good cholesterol and cut levels of triglycerides. 11 Fishoil pills as a source of omega-3 fats are not recommended, as they can often become rancid and contaminated with toxins. How Does Salt Fit In with Beauty? Sodium, found in salt, is an element our bodies need to function properly. It helps to control our blood pressure and blood volume, as well as ensuring proper muscle and nerve function. The best beauty forms of salt to use are small amounts of high-quality sea salt, such as Celtic or Himalayan sea salt. These sea salts also have trace minerals and elements. Sea salts are obtained from the evaporation of saltwater bodies, rather than the heavy processing that produces table salt; this includes bleaching and diluting the salt after harvesting with anticaking agents and other chemicals. For these reasons, stick to sea salt in your cooking. But too much salt is definitely a beauty and health no-no. Excessive salt intake can increase the risk for heart disease, hypertension, high blood pressure, and kidney disease. It can also make your skin look dehydrated. Excessive sodium can also create “false fat,” making you look bloated and pounds heavier than you truly weigh. An average daily guideline is 1,000 to 1,500 milligrams (mg) of sodium per day or less. If you are at risk for a medical condition, such as those listed above, you can certainly omit salt from your cooking altogether. Most of us, accustomed to so many processed and restaurant foods that contain loads of sodium, are used to a very salty flavor. Shifting into eating more natural foods and preparing simpler food will help you become more sensitive to the taste of salt. It’s also a good idea to add sea salt to your food right before you eat it, so it tastes more salty without using more actual salt!PILLAR 2: External Nourishment Now that you know how to lay the foundation for your beauty with your diet, we are going to talk about the best forms for the outer care of your skin. This includes the safest and most effective skin-care products and ingredients as well as self-care practices that will help you grow strong nails; healthy, shiny hair; and clear, glowing skin. Incorporating superior inner and outer care will nourish your whole body from the outside in and let your natural beauty shine through to the highest degree possible. In this pillar we’ll cover the best—as well as the worst—ingredients and practices so you can allow your most beautiful self to be authentically reflected.SHIFT 6: Incorporate Natural Skin-Care Ingredients Your Amazing Skin Our largest organ, the skin, is a fascinating one. It is an elimination organ, meaning it helps dispel wastes from your body through sweat. Your skin receives roughly a third of all the blood that is circulated throughout the body. It makes sense that if the blood is congested, this is reflected in your skin. Your skin is the last organ to receive nutrition in the body, yet is among the first organs to show signs of an imbalance or deficiency. But skin does also work in the opposite way, absorbing what is applied to it on the outside. It is therefore critical to be strategic about putting the best ingredients on the surface of your skin to help repair and support its health from the outside in. This seems obvious, but there is a great deal of marketing hype to weed through to determine what works and what is merely an empty claim. It’s also critical to avoid the numerous toxic ingredients that can be absorbed and not only tax your skin but also enter your bloodstream and burden your liver. Your skin is also influenced by your emotions and mental state. Research shows that stress can cause visible aging at the cellular level, including a study published in the Proceedings of the National Academy of Sciences . 1 Elissa Epel, one of the researchers for this study, states, “This is the first time that psychological stress has been linked to a cellular indicator of aging in healthy people.” 2 Luckily, many of the techniques in this pillar will help relax your mind and body while nurturing your skin from the outside in. Healthy, smooth, and radiant skin is considered the holy grail of beauty. If you survey any woman (and most men, even though they might not discuss it as openly!), you will find that beautiful skin is at the very top of her beauty wish list. Well, the time has come for you to get your wish. By working with yourskin and incorporating ingredients into your routine that will help nourish your skin, you’ll create an optimal environment for your skin to grow, repair, and heal itself. The result will be skin that glows, reflecting your highest beauty. Natural vs. Chemical Ingredients Some may think that the expensive, scientifically created, cutting-edge products on the market are automatically the most effective choices out there, but this is not necessarily the case. The antioxidants found in natural plant ingredients are still widely considered to be among the most powerful skin-care ingredients, and this is consistently proven in research. As Richard Baxter, MD, of the University of Washington School of Medicine, states, “There is enough published work to convince me that the antioxidant botanicals will be the next big thing in skin care.” 3 They may be the “next big thing,” but they have also been around for thousands of years—much like ancient practices like yoga and meditation are tagged as “new age.” (Ironic and illogical, right?) Synthetic ingredients may have properties to help boost your skin, but some may tax your skin and even be toxic. 4 That toxicity can be absorbed right from your skin into your system. 5 As with your diet, the best approach to skin care is to understand the power of nature. Nature’s beauty is unparalleled, and if you live closer to nature in all aspects of your lifestyle, your natural beauty will increase. Choose nontoxic products that contain natural, plant-based ingredients. As long as they aren’t toxic, scientifically created ingredients, like concentrated, isolated peptides, that are aimed at a specific purpose such as minimizing the appearance of fine lines and wrinkles can work together with natural ingredients to create powerful combinations. Nature and science can most certainly work together in a balanced way
[ 17538, 5036, 44323, 18822, 332, 17462, 198, 64442, 197, 24823, 6043, 6108, 198, 35, 17455, 94036, 69342, 197, 43664, 44323, 3253, 1411, 197, 971, 273, 33282, 53577, 1470, 332, 197, 43664, 44323, 26665, 343, 68590, 3422, 627, 806, 198, 13017, 819, 74913, 3303, 3385, 61551, 11575, 48518, 44323, 197, 33796, 12, 18, 1186, 1900, 197, 548, 98366, 17643, 36971, 11, 61551, 197, 20670, 94036, 197, 61917, 198, 17106, 638, 7145, 1149, 307, 53577, 93491, 8778, 660, 48048, 32809, 87, 1354, 627, 4438, 197, 22186, 1602, 48418, 13017, 275, 71267, 48048, 197, 94909, 5380, 50, 47876, 11, 59202, 17886, 1942, 3223, 11, 20501, 80557, 44807, 197, 414, 2282, 10233, 197, 17483, 32809, 7679, 197, 81768, 398, 13, 62635, 198, 8823, 82, 32809, 83886, 197, 414, 2282, 4659, 197, 47074, 53577, 2282, 4659, 5306, 4765, 11, 61551, 6831, 616, 61551, 197, 729, 1711, 198, 81768, 2157, 355, 9326, 53577, 197, 1215, 588, 7679, 13, 33026, 93510, 74242, 59051, 197, 10008, 44323, 1942, 3223, 32809, 42919, 197, 548, 198, 9181, 197, 6173, 82, 44323, 9793, 1108, 22867, 197, 37541, 1942, 3223, 11, 1942, 1412, 61551, 6391, 3903, 292, 82266, 13595, 2931, 44957, 197, 37541, 1942, 3223, 627, 9673, 197, 37541, 1942, 278, 2641, 197, 19171, 9793, 525, 66158, 26388, 17822, 53577, 197, 22138, 13, 197, 60261, 1942, 278, 2641, 197, 548, 64453, 83, 2692, 198, 1527, 33188, 75937, 96649, 44323, 1942, 3223, 13284, 2282, 10233, 11, 7145, 1894, 197, 54895, 33188, 197, 89945, 197, 21315, 64442, 198, 8723, 1634, 27579, 1942, 3223, 26, 2090, 197, 14866, 197, 901, 12092, 53577, 2765, 321, 10831, 33188, 1942, 3223, 197, 10924, 9793, 277, 7164, 287, 198, 4291, 197, 8322, 1802, 197, 55975, 53577, 197, 1605, 197, 32056, 82, 13, 197, 2520, 197, 45010, 17643, 99949, 11, 18895, 875, 32809, 197, 37541, 1942, 3223, 198, 258, 14862, 414, 197, 1030, 10979, 627, 4071, 32809, 78, 2157, 1412, 1942, 3223, 20501, 7604, 7627, 11575, 74242, 59051, 53577, 197, 12393, 73204, 29466, 13, 197, 849, 87728, 1942, 3223, 198, 396, 731, 94036, 17886, 20542, 33188, 7145, 3267, 2066, 1602, 18207, 2765, 56407, 11, 9793, 1100, 531, 2711, 11, 9793, 1108, 2282, 4659, 197, 47074, 345, 438, 16868, 307, 3520, 2765, 56407, 13, 62635, 94036, 197, 19171, 78538, 14862, 414, 1942, 8148, 197, 7349, 59451, 26233, 660, 627, 849, 87728, 1942, 47876, 94036, 197, 19171, 40363, 197, 2118, 3934, 1186, 266, 2476, 2157, 1802, 197, 9514, 197, 7349, 2282, 385, 660, 53577, 198, 79, 3171, 197, 383, 31748, 197, 54895, 197, 9514, 26665, 3988, 197, 57740, 627, 2127, 197, 17645, 2765, 5179, 3253, 2480, 4939, 20501, 197, 16, 11, 931, 32809, 197, 16, 11, 2636, 2157, 484, 84209, 197, 1278, 70, 8, 44323, 1942, 47876, 197, 716, 198, 1316, 82266, 197, 1752, 13, 52792, 197, 9514, 197, 548, 36547, 7145, 3267, 2066, 11575, 197, 69216, 197, 9233, 11, 1942, 1412, 61551, 197, 54719, 14779, 291, 197, 49532, 345, 9514, 94036, 1470, 7770, 398, 197, 79068, 1942, 3223, 43827, 14862, 414, 197, 1030, 10979, 70671, 998, 3522, 13, 9391, 537, 44323, 71275, 345, 4575, 50786, 32809, 197, 708, 197, 35676, 197, 35122, 53577, 197, 34326, 1602, 96420, 64442, 197, 53195, 197, 33785, 44323, 198, 82, 47876, 11, 197, 548, 197, 2656, 32809, 11575, 197, 1225, 1942, 10231, 1186, 75, 3372, 13, 197, 2059, 18148, 2129, 78, 7883, 1113, 2157, 461, 9215, 4688, 197, 96420, 198, 438, 41446, 45252, 1942, 6517, 261, 197, 14239, 6831, 484, 88740, 197, 9514, 2282, 52521, 2157, 461, 1942, 19245, 32809, 33188, 3324, 5642, 44323, 198, 43326, 13, 62635, 753, 197, 19171, 11575, 3253, 1411, 197, 42877, 32809, 13008, 197, 37541, 1942, 3223, 32809, 14862, 414, 197, 14239, 49021, 64334, 197, 9514, 7883, 266, 24263, 11, 197, 708, 24263, 198, 83, 28006, 2157, 461, 1942, 10231, 197, 30096, 27287, 2157, 461, 89914, 1942, 3223, 0, 47, 9410, 946, 197, 17, 512, 27002, 18822, 414, 16409, 198, 7184, 64442, 197, 9514, 16868, 3409, 197, 5269, 32809, 197, 6789, 33188, 1186, 4159, 2066, 14862, 414, 74242, 59051, 48048, 14862, 414, 2765, 3978, 345, 906, 197, 548, 31780, 287, 32809, 3324, 1727, 197, 9274, 33188, 93510, 197, 10008, 2066, 33188, 197, 2743, 1470, 548, 44323, 14862, 414, 1942, 8148, 13, 41065, 198, 14866, 33188, 1942, 2642, 478, 53577, 2157, 537, 7883, 40784, 1942, 8148, 41206, 197, 10354, 53577, 197, 39220, 61551, 6831, 616, 198, 300, 5311, 41206, 26736, 90290, 64442, 6831, 484, 88740, 197, 9514, 3253, 654, 197, 4620, 9215, 6341, 26, 197, 38128, 11, 37296, 6577, 9793, 1334, 280, 438, 41508, 11, 9123, 24060, 1942, 8148, 13, 71267, 6133, 4406, 1113, 12750, 2521, 197, 4481, 53577, 197, 2743, 1470, 548, 6831, 484, 198, 77, 414, 819, 14862, 414, 197, 67733, 36502, 43827, 33188, 14294, 3002, 17886, 53577, 10428, 14862, 414, 9215, 4688, 74242, 59051, 197, 31338, 198, 20322, 32809, 33188, 9793, 7656, 197, 42127, 197, 10236, 13, 71267, 2090, 3303, 484, 277, 197, 906, 4805, 197, 3773, 33188, 93510, 60654, 6831, 616, 198, 300, 33188, 6831, 66396, 2345, 39220, 53577, 26736, 90290, 197, 708, 197, 9514, 94036, 197, 7331, 14862, 414, 2157, 537, 74242, 35777, 5311, 198, 998, 74242, 79111, 306, 2740, 60604, 2258, 45208, 14627, 197, 21, 512, 644, 6133, 61721, 1602, 55381, 7721, 8148, 7813, 548, 198, 46847, 198, 7927, 197, 66173, 7721, 8148, 198, 8140, 8986, 33481, 197, 8629, 11, 33188, 1942, 8148, 11, 20501, 11575, 1186, 5171, 16252, 197, 606, 13, 62635, 20501, 80557, 197, 40895, 2617, 197, 8629, 345, 57865, 24263, 88740, 82, 2765, 13391, 301, 6831, 28006, 43827, 14862, 414, 36502, 197, 20322, 1942, 906, 266, 13, 197, 7927, 1942, 8148, 198, 54487, 1924, 197, 1458, 398, 11575, 197, 32827, 44323, 52060, 33188, 2282, 4659, 64442, 20501, 1470, 2496, 7913, 197, 20322, 412, 33188, 36502, 627, 2181, 2157, 2094, 1942, 1137, 64442, 748, 33188, 2282, 4659, 20501, 38303, 7114, 291, 11, 2090, 20501, 60604, 2258, 17886, 14862, 414, 1942, 8148, 13, 197, 7927, 198, 37282, 20501, 33188, 34196, 197, 8629, 32809, 17643, 8402, 9215, 332, 17462, 17886, 33188, 36502, 11, 14862, 295, 20501, 197, 77405, 33188, 43290, 198, 1813, 598, 32809, 33827, 70154, 82, 44323, 80557, 197, 21495, 5085, 82266, 7604, 10603, 627, 4071, 1942, 8148, 2765, 7217, 197, 19171, 98138, 17886, 33188, 40803, 13921, 197, 3195, 11, 197, 3518, 269, 7278, 197, 12840, 20501, 70998, 3523, 32809, 24263, 198, 263, 33188, 14294, 3002, 13, 62635, 20501, 197, 19041, 1348, 1470, 14849, 32809, 74242, 11609, 90467, 197, 9274, 46162, 1303, 33188, 93510, 198, 39220, 25653, 33188, 1942, 10730, 44323, 14862, 414, 1942, 8148, 32809, 88740, 74831, 1334, 53577, 1942, 2870, 197, 1220, 197, 12393, 198, 1527, 33188, 14294, 3002, 17886, 13, 41065, 85786, 12116, 64453, 2528, 11, 2282, 332, 197, 19041, 20501, 11575, 3253, 1244, 197, 30739, 44323, 2157, 847, 11880, 198, 71, 500, 32809, 197, 86427, 197, 20322, 32809, 2765, 25296, 197, 12840, 197, 19033, 53577, 197, 12840, 20501, 197, 1195, 989, 80557, 197, 3274, 198, 8017, 13, 62635, 753, 197, 19171, 1470, 14849, 32809, 197, 48956, 33188, 23239, 261, 788, 32809, 14668, 197, 39220, 64442, 94036, 74242, 198, 3518, 269, 2788, 53577, 98366, 197, 3323, 3324, 710, 14862, 414, 1942, 8148, 2282, 332, 197, 19171, 197, 1992, 14862, 414, 2282, 4659, 4116, 53577, 198, 11490, 5294, 14862, 414, 1602, 75, 1553, 627, 7927, 1942, 8148, 20501, 197, 19171, 17886, 27256, 5886, 197, 1729, 14862, 414, 67304, 41356, 53577, 197, 93221, 25277, 13, 197, 28528, 198, 60556, 64442, 18895, 676, 94036, 197, 1593, 197, 12887, 197, 4210, 36547, 33188, 47087, 1299, 54843, 11, 197, 16564, 11575, 18895, 18339, 198, 33966, 17886, 33188, 1602, 85438, 826, 44323, 33188, 18822, 1697, 197, 11916, 329, 4625, 44323, 197, 3407, 12242, 198, 627, 16, 18108, 6719, 22144, 197, 23176, 301, 11, 197, 606, 198, 1073, 33188, 17643, 1874, 388, 2066, 2090, 18895, 18339, 11, 18895, 988, 11, 197, 31378, 20501, 33188, 43290, 22724, 64442, 36109, 5759, 5848, 198, 95290, 64355, 74242, 268, 197, 44233, 32809, 11575, 47087, 1299, 197, 57251, 44323, 197, 4210, 17886, 197, 38128, 197, 16455, 49216, 17, 198, 96850, 11, 197, 35676, 44323, 33188, 197, 26522, 8467, 17886, 2090, 3303, 484, 277, 6831, 484, 88740, 197, 3833, 710, 14862, 414, 2157, 485, 53577, 198, 2664, 5329, 9215, 5757, 1711, 14862, 414, 1942, 8148, 43827, 33188, 14294, 3002, 17886, 627, 97213, 11, 73123, 6627, 11, 53577, 7145, 2836, 519, 1942, 8148, 20501, 197, 25742, 291, 33188, 9793, 5849, 91159, 607, 44323, 74242, 59051, 13, 52792, 198, 9514, 1942, 39378, 197, 3852, 6831, 7053, 197, 61011, 2157, 537, 2157, 268, 11, 7883, 1055, 197, 4636, 197, 20670, 2157, 492, 98366, 2765, 3510, 1892, 24263, 61551, 198, 2569, 398, 49743, 197, 9514, 6831, 484, 81703, 64442, 74242, 35777, 1942, 8148, 20501, 36547, 33188, 197, 1225, 43218, 44323, 197, 1964, 74242, 59051, 6831, 819, 198, 1638, 13, 197, 11649, 11, 33188, 22724, 64355, 1470, 638, 2066, 197, 9514, 32809, 10582, 14862, 414, 6831, 819, 13, 197, 1383, 197, 21837, 48048, 14862, 2530, 8148, 53577, 197, 2910, 39382, 1113, 197, 39220, 2129, 78, 14862, 414, 7145, 14492, 64442, 6831, 484, 88740, 9215, 414, 819, 198, 22479, 1942, 8148, 11, 197, 9514, 4805, 40363, 80557, 65938, 2931, 197, 24175, 2066, 14862, 414, 1942, 8148, 32809, 3253, 654, 11, 74831, 1334, 345, 438, 197, 383, 278, 24263, 726, 13, 33026, 9753, 6831, 484, 74242, 1942, 8148, 64442, 9123, 4336, 11, 197, 36013, 287, 14862, 414, 9793, 7656, 74242, 59051, 627, 55381, 5306, 82, 13, 197, 64938, 950, 197, 46847, 198, 8538, 2157, 352, 197, 27963, 64442, 33188, 49658, 4114, 11, 1942, 12575, 1104, 750, 197, 7266, 11, 1470, 75081, 48448, 197, 10354, 198, 263, 33188, 2157, 55660, 197, 548, 197, 28172, 7167, 33188, 2157, 537, 7883, 40784, 197, 25825, 14294, 197, 19041, 11, 2282, 332, 2090, 20501, 198, 1962, 9215, 74753, 33188, 2789, 13, 33026, 197, 519, 42651, 1821, 59202, 17886, 9215, 4688, 197, 21494, 197, 39220, 197, 548, 198, 44466, 6831, 307, 989, 197, 25742, 291, 32809, 74242, 197, 77405, 33188, 2157, 537, 3303, 1223, 1285, 1942, 8148, 41206, 197, 39220, 345, 438, 2090, 20501, 197, 6387, 380, 4501, 197, 782, 1055, 17886, 17643, 1874, 627, 2170, 1602, 42315, 13083, 73639, 11, 95697, 11, 44323, 33188, 197, 31272, 44323, 17749, 32799, 1602, 33849, 44323, 198, 13613, 55103, 11, 18895, 988, 11, 197, 35816, 20501, 82948, 1409, 3303, 11931, 98138, 32809, 197, 12296, 1736, 50394, 64442, 33188, 198, 519, 42651, 519, 2282, 354, 45983, 82, 6831, 484, 74242, 33188, 29244, 2282, 343, 197, 1626, 17886, 1942, 8148, 1470, 548, 49216, 18, 198, 197, 7009, 2157, 352, 74242, 33188, 198, 2118, 3684, 2282, 343, 197, 1626, 2476, 2282, 332, 197, 20670, 9793, 525, 197, 19171, 74242, 268, 197, 20019, 2066, 71579, 40137, 44323, 197, 42820, 2345, 59178, 198, 4908, 197, 1149, 1188, 26736, 90290, 197, 4908, 14862, 14361, 53577, 197, 2106, 7709, 197, 548, 61539, 3640, 61551, 197, 2118, 943, 197, 425, 2029, 197, 9149, 8535, 198, 438, 55696, 31356, 11, 49021, 10380, 7721, 1910, 18015, 197, 39220, 2157, 352, 9793, 525, 88028, 32809, 88740, 69342, 198, 22479, 1942, 8148, 11, 2282, 332, 1942, 638, 2157, 352, 3324, 710, 14862, 414, 1942, 8148, 53577, 7883, 1055, 74242, 32809, 14668, 627, 19, 198, 197, 4897, 32809, 14668, 488, 94036, 74242, 198, 3518, 269, 2788, 49021, 43827, 14862, 414, 1942, 8148, 2129, 78, 14862, 414, 41393, 627, 20, 198, 2170, 48048, 14862, 414, 2765, 3978, 11, 33188, 93510, 197, 16082, 613, 32809, 1942, 8148, 1470, 548, 20501, 32809, 197, 8154, 2752, 33188, 3303, 1223, 198, 1073, 9215, 1598, 13, 18822, 1598, 753, 74242, 59051, 20501, 21113, 68901, 11, 53577, 748, 197, 9514, 8986, 535, 1470, 70315, 32809, 9215, 1598, 17886, 52060, 198, 300, 8132, 44323, 14862, 414, 8986, 16886, 11, 14862, 414, 9215, 4688, 74242, 59051, 6831, 484, 17886, 20542, 13, 197, 25017, 9215, 546, 82329, 198, 10354, 64442, 197, 53195, 9215, 4688, 11, 197, 21494, 6108, 197, 39220, 13, 197, 2170, 17972, 61551, 197, 20670, 197, 9329, 1431, 198, 998, 14668, 11, 1942, 12575, 1104, 750, 197, 7266, 197, 39220, 11, 197, 4908, 38303, 1189, 55373, 11, 20501, 81619, 197, 375, 74489, 11, 64442, 198, 548, 197, 2706, 291, 36547, 11575, 1942, 15934, 3303, 30349, 1942, 1412, 61551, 26388, 318, 4954, 33188, 70998, 13322, 44323, 1186, 483, 79490, 198, 438, 6831, 35465, 645, 94036, 98138, 32809, 3522, 48048, 9215, 4688, 197, 39220, 32809, 40363, 3303, 1223, 1285, 198, 884, 74729, 13, 18822, 1598, 53577, 31028, 1873, 94036, 2157, 537, 1470, 7770, 398, 98138, 32809, 3522, 17886, 11575, 198, 59502, 197, 3195 ]
0xBreath/holistic-books
said, “Remember back in the seventies, Wayne, when you used to tell me and my friends that if we did what we loved doing, money would literally fly in the windows?” Joanna was laughing as she continued, “We used to laugh and tell you that was easy for you to say. It was flying in your windows from the popularity of your best- selling books, but we were conv inced that we had to keep flying to keep the money coming in! “I don’t think I realized then how sincerely you were speaking from a self-knowledge,” she said more seriously. “From your discovery for yourself of the rewards of doing what you truly loved doing. These past few months, workin g on this book and not flying at all,” she continued hesitantly, “I’ve gradually identified my exhilarated feeling as what you described then as ‘doing what you love.’” She sounded determined as she added, “It has dawned on me that the difference between being a flight attendant, with those guaranteed benefits, and losing myself pleasurably indoing what I love doing is a difference in a way-of-being-in-life that simply makes flying no longer an option for me.” I wonde red what had caused the breakthrough as she excitedly continued, “This morning I was happily immersed in thoughts and books and your words and ideas, working on the manuscript with a cup of hot tea next to my typewriter. As I was staring at the tiny new buds on the lilac bush outside my window, I saw the mailman drive up. And he was delivering my third large check from you!” she said triumphantly. “For doing what I love doing! When I got back to my typewriter, it really hit me. Here I am, reveling in the awareness that it is possible to feel this good about work, when the money appears at my window! I didn’ t even have to go out and pick up my check!” I chuckl ed, as she explained, “It seemed to me exactly what you were describing years ago, and here it was happening to me. I realized,” she said in a steady voice, “there is no question about my going back to work as a flight attendant. Actually, the money only confirms the rightness of doing what I enjoy.” The words “You’ll see it when you believe it” drifted through my thoughts as Joanna concluded, “I feel such an inner sense of joy at honoring and enco uraging this part of me, rather than listening exclusively to the part of myself that logically dictated all the advantages of working for the airline. ‘You’ll see it when you believe it’ are mere words in comparison to the feeling!” PUTTING IT INT O PRACTICE It does not matter what your occupation is or even if you have one. It does not relate exclusively to your employment. Whoever you are, wherever you live, whatever your life circums tance, you are doing something every day. Those days can be experiences of abundance or scarcity. The ideas below may help you to begin doing what you love. The actual implementation is, of course, up to you. 1. Reexamine your resistance to doing what you love. I was going to call this “Take the risk!”—but I truly do not believe it is necessarily risky to begin doing what you love. If you label it a risk, it means that you must somehow muster up the courage tomake a change. But as you beco me more awakened, you will see that the risks are nothing more than thoughts—thoughts which you have convinced yourself are impossible to implement. Instead of thinking “risk,” which has scarcity built into it, think: “It will be absolutely great to be doing what I love, and I know that whatever I need to handle my life affairs will come into my life. I know it!” Stop focusing on all that will be missing, unless that is what you want to expand in your life. Your resistance to doing what you love is based not on the world of abundance and unlimited opportunity, but on a belief that work and play are separate parts of your humanity. The belief is that work is painful and entails suffering and that play is fun. But it does not have to be that way. Imagine yourself doing exactly what you love doing. Composing, drawing, engineering, being a florist, being a beautician, having your days to be with your children as a homemaker— the list is endless. Imagine what gives you the most pleasure and makes you feel purposeful. What is it that when you finish doing it, you feel immeasurably fulfilled, and while you are doing it, time just seems to be nonexistent? Invite that into your consciousness, and then proceed to follow your bliss. Know that you are not stuck where you are unless you decide to be. Know that if you use your mental energy to see yourse lf spending your days doing what you truly love, and if you keep that thought uppermost in your mind, that is what will expand for you. It has to. You were very likely taught that you choose your career in the early part of your life, and then you live out your life doing what you were trained to do. But is it sensible to continue doing something that someone eighteen or twenty years old chose years ago? Would you go to an eighteen-year -old today for vocational counseling? Continuing to do regularly what you dislike is going to expand scarcity in your life. You will never escape from the trap unless you are willing to shift the internal focus of your thoughts to what you love doing. Put that thought in your mind and make it the central feature of your thoughts, even if yourefuse to make the move today. Stay with the thought. The more you focus on it, the more it will expand. Virtually everyo ne I have ever met who has gone on to live the kind of abundan t life I am discussing here has been willing to do what it takes to make it happen. They all quit jobs that were not personally fulfilling and pursued their dreams. There is no scarcity of opportunity to make a living at what you love, there is only a scarcity of resolve to make it happen. Whatever you love doing more than anything else has built within it an opportunity to make a living at it, even though you may not believe it. Your fears of doing what you truly love are based on a belief that you are going to go broke and be unable to pay your bills and meet your family responsibilities. Not so! Those who love you will support you in every way if you take the opportunity to pursue your dreams. If you have always paid your bills, why would you suddenly becom e the kind of person who does not? If your entire history speaks to being respons ible, why would you ever consult an imaginary fear-based history to make your real-life decisions? Moreover, you may find that many of your extraordinary expenses are simply the result of a lifestyle in which you have been doing what you loathe. Simplify your life and you may find that you reduce your expenditures and obligations considerably. If you truly want to live out in the wilderness, or travel across the country, or open up a small business in another part of the world, you very likely can make it happen. I have talked with numerous executives who made the decision to alter their stress-filled lives and begin to slow down and “smell the roses” and still pursue a dream of doing what they really loved. Interestingly, in many cases it took a near brush with death to bring this change about. Your fears of doing what you love are mostly rooted in unenlightened conditioning. All of those fears can be recognized as nothin g more than fearful “thoughts” which you can change. 2. If you refuse to change what you do, practice loving it each day. This little Zen proverb sums up my message in this section:Before enlightenment chopping wood carrying water After enlightenment chopping wood carrying water. Enlightenment has very little to do with your daily activities and quite a lot to do with how you view those activities. You are still going to chop wood and carry water in some fashion, only the awakened person is no longer going to curse the wood and the water, or even his own lot in life. Whatever you are doing now can beco me a labor of love if you are willing to make it that way. You do not have to hate your work or anything that you are doing. Hate is a choice that comes from having hateful thoughts. Hate is not caused by having to change a dirty diaper twenty times a day, or clean toilets, or live in a prison cell, or collect garbage, or sort out accounting forms, or attend committee meetings all day in which nothing is accomplished. The circumstances are irrelevan t. The loathing exists inside of you, not in the external world. If you decide to continue in your present activity, shift your attitude toward that activity and allow abundance into your life. You can perform whatever tasks are required of you with an entirely different perspective. Joanna, my editor and literary specialist extraordinaire, previously a flight attendant, did precisely that while she contin ued to fly. She worked on her attitude while
[ 1071, 11, 1054, 29690, 1203, 304, 279, 22084, 552, 345, 36154, 818, 11, 994, 499, 1511, 311, 3371, 757, 323, 856, 4885, 430, 422, 584, 1550, 1148, 584, 198, 385, 2111, 3815, 11, 3300, 1053, 16280, 11722, 304, 279, 11276, 12671, 91162, 574, 198, 4355, 7595, 287, 439, 1364, 8738, 11, 1054, 1687, 1511, 311, 12835, 323, 3371, 499, 430, 574, 4228, 369, 198, 9514, 311, 2019, 13, 1102, 574, 16706, 304, 701, 11276, 505, 279, 23354, 315, 701, 1888, 7058, 38837, 6603, 11, 719, 584, 1051, 5804, 304, 2041, 430, 584, 1047, 311, 2567, 16706, 311, 2567, 279, 198, 29359, 5108, 304, 4999, 10378, 1541, 1431, 1781, 358, 15393, 1243, 1268, 59383, 499, 1051, 12365, 505, 264, 198, 726, 12934, 52286, 2476, 1364, 1071, 810, 14243, 662, 1054, 3915, 701, 18841, 369, 198, 22479, 726, 315, 279, 21845, 315, 3815, 220, 1148, 499, 9615, 10456, 3815, 13, 4314, 3347, 2478, 198, 50814, 11, 990, 258, 342, 389, 420, 2363, 323, 539, 16706, 520, 682, 2476, 1364, 8738, 198, 17082, 275, 18007, 1174, 1054, 40, 4070, 27115, 11054, 856, 91826, 660, 8430, 439, 1148, 499, 198, 5919, 17890, 1243, 439, 3451, 45359, 1148, 499, 3021, 14639, 863, 3005, 35408, 11075, 439, 1364, 198, 17249, 11, 1054, 2181, 706, 39493, 291, 389, 757, 430, 279, 6811, 1990, 1694, 264, 11213, 198, 1617, 20995, 11, 449, 1884, 19883, 7720, 11, 323, 13490, 7182, 88800, 324, 2915, 42100, 287, 1148, 358, 3021, 3815, 374, 264, 6811, 304, 264, 1648, 8838, 33851, 3502, 26928, 220, 430, 5042, 198, 80785, 16706, 912, 5129, 459, 3072, 369, 757, 49216, 40, 2834, 451, 2579, 1148, 1047, 9057, 279, 42445, 439, 1364, 12304, 398, 8738, 345, 31378, 6693, 358, 574, 37875, 78308, 304, 11555, 323, 6603, 323, 701, 198, 5880, 323, 6848, 1174, 3318, 389, 279, 47913, 449, 264, 10747, 315, 4106, 15600, 1828, 311, 198, 2465, 3666, 73580, 662, 1666, 358, 574, 37874, 520, 279, 13987, 502, 68543, 389, 279, 62471, 582, 30773, 198, 68090, 856, 3321, 1174, 358, 5602, 279, 8232, 1543, 6678, 709, 13, 1628, 568, 574, 24944, 856, 198, 32827, 3544, 1817, 220, 505, 499, 18319, 1364, 1071, 38586, 18007, 662, 1054, 2520, 3815, 1148, 358, 3021, 198, 45359, 0, 220, 3277, 358, 2751, 1203, 311, 856, 3666, 73580, 1174, 433, 2216, 4295, 757, 13, 5810, 358, 1097, 345, 265, 899, 287, 304, 279, 17985, 430, 433, 374, 3284, 311, 2733, 420, 1695, 922, 990, 345, 9493, 279, 3300, 8111, 520, 856, 3321, 0, 358, 3287, 529, 259, 1524, 617, 311, 733, 704, 323, 198, 30345, 709, 856, 1817, 18319, 198, 40, 43560, 75, 1608, 11, 439, 1364, 11497, 11, 1054, 2181, 9508, 311, 757, 7041, 1148, 499, 1051, 198, 5919, 44631, 1667, 220, 4227, 11, 323, 1618, 433, 574, 12765, 311, 757, 13, 358, 15393, 2476, 1364, 1071, 198, 258, 264, 24981, 7899, 11, 1054, 19041, 374, 912, 3488, 922, 856, 2133, 1203, 311, 990, 439, 264, 198, 39490, 65022, 13, 34863, 1174, 279, 3300, 1193, 43496, 279, 1314, 2136, 315, 3815, 198, 12840, 358, 4774, 662, 89874, 791, 4339, 1054, 2675, 4805, 1518, 433, 994, 499, 4510, 433, 863, 92662, 1555, 856, 198, 61665, 82, 439, 91162, 20536, 11, 1054, 40, 2733, 1778, 459, 9358, 5647, 315, 16267, 520, 79025, 198, 438, 665, 1030, 4433, 4210, 420, 961, 315, 757, 11, 4856, 1109, 14624, 24121, 311, 279, 961, 198, 1073, 7182, 430, 74145, 81498, 682, 279, 22934, 315, 3318, 369, 279, 198, 1334, 1074, 13, 3451, 2675, 4805, 1518, 433, 994, 499, 4510, 433, 529, 527, 17983, 4339, 304, 12593, 311, 198, 1820, 8430, 18319, 198, 720, 6353, 26098, 8871, 220, 9403, 507, 393, 51511, 5604, 27907, 2181, 1587, 539, 5030, 1148, 701, 30747, 374, 477, 1524, 422, 499, 617, 832, 13, 1102, 1587, 198, 1962, 29243, 24121, 311, 701, 14740, 13, 91395, 499, 527, 11, 28578, 499, 198, 25859, 11, 8996, 701, 2324, 4319, 6370, 259, 685, 11, 499, 527, 3815, 2555, 1475, 1938, 627, 23025, 2919, 649, 387, 11704, 315, 37492, 477, 82484, 662, 578, 6848, 3770, 198, 18864, 1520, 499, 311, 3240, 3815, 1148, 499, 3021, 13, 578, 5150, 8292, 374, 345, 1073, 3388, 11, 709, 311, 499, 627, 16, 13, 1050, 327, 20588, 701, 13957, 311, 3815, 1148, 499, 3021, 13, 358, 574, 2133, 198, 998, 1650, 420, 1054, 18293, 279, 5326, 18319, 2345, 8248, 358, 9615, 656, 539, 4510, 433, 374, 198, 77, 74753, 41273, 220, 311, 3240, 3815, 220, 1148, 499, 3021, 13, 1442, 499, 2440, 433, 264, 198, 82043, 11, 433, 3445, 430, 499, 2011, 17354, 84750, 709, 279, 25775, 311, 7072, 264, 2349, 13, 2030, 439, 499, 387, 1030, 757, 810, 90347, 11, 499, 690, 1518, 198, 9210, 279, 15635, 527, 4400, 810, 1109, 11555, 2345, 61665, 82, 902, 198, 9514, 617, 22954, 6261, 527, 12266, 311, 4305, 13, 12361, 198, 1073, 7422, 1054, 82043, 2476, 902, 706, 82484, 5918, 1139, 433, 11, 1781, 25, 1054, 2181, 690, 198, 1395, 11112, 2294, 311, 387, 3815, 1148, 358, 3021, 11, 323, 358, 1440, 430, 198, 69386, 358, 1205, 311, 3790, 856, 2324, 22747, 690, 2586, 1139, 856, 2324, 13, 358, 198, 33134, 433, 18319, 14549, 21760, 389, 682, 430, 690, 387, 7554, 11, 7389, 430, 374, 198, 12840, 499, 1390, 311, 9407, 304, 701, 2324, 627, 7927, 13957, 311, 3815, 1148, 499, 3021, 374, 3196, 539, 389, 279, 198, 14957, 315, 37492, 323, 27862, 6776, 1174, 719, 389, 264, 16801, 198, 9210, 990, 323, 1514, 527, 8821, 5596, 315, 701, 22706, 662, 578, 16801, 198, 285, 430, 990, 374, 26175, 323, 71204, 16066, 323, 430, 1514, 374, 2523, 627, 4071, 433, 1587, 539, 617, 311, 387, 430, 1648, 13, 38891, 6261, 3815, 198, 327, 33839, 1148, 499, 3021, 3815, 13, 1219, 8478, 11, 13633, 11, 15009, 345, 35214, 264, 70240, 380, 11, 1694, 264, 5017, 12734, 11, 3515, 701, 2919, 311, 387, 449, 198, 22479, 2911, 439, 264, 5105, 59775, 2345, 279, 1160, 374, 26762, 13, 38891, 1148, 198, 70, 1924, 499, 279, 1455, 17069, 323, 3727, 499, 2733, 7580, 1285, 13, 3639, 198, 285, 433, 430, 994, 499, 6381, 3815, 433, 11, 499, 2733, 737, 2727, 300, 324, 2915, 198, 1285, 28611, 11, 323, 1418, 499, 527, 3815, 433, 11, 892, 1120, 5084, 311, 387, 198, 6414, 65185, 30, 86023, 430, 1139, 701, 25917, 11, 323, 1243, 10570, 198, 998, 1833, 701, 59045, 627, 39512, 430, 499, 527, 539, 16075, 1405, 499, 527, 7389, 499, 10491, 198, 998, 387, 13, 14521, 430, 422, 499, 1005, 701, 10723, 4907, 311, 1518, 701, 325, 59180, 198, 2203, 2518, 701, 2919, 3815, 1148, 220, 499, 9615, 3021, 11, 323, 422, 499, 2567, 198, 9210, 3463, 8582, 3646, 304, 701, 4059, 11, 430, 374, 1148, 690, 9407, 369, 198, 9514, 13, 1102, 706, 311, 627, 2675, 1051, 1633, 4461, 15972, 430, 499, 5268, 701, 7076, 304, 279, 198, 22928, 961, 315, 701, 2324, 11, 323, 1243, 499, 3974, 704, 701, 2324, 3815, 1148, 198, 9514, 1051, 16572, 311, 656, 13, 2030, 374, 433, 38761, 311, 3136, 3815, 198, 34431, 430, 4423, 63134, 477, 17510, 1667, 2362, 14896, 1667, 198, 6438, 30, 19418, 499, 733, 311, 459, 63134, 4771, 482, 820, 3432, 369, 89486, 198, 66, 94741, 287, 30, 82117, 311, 656, 15870, 1148, 499, 48969, 374, 2133, 198, 998, 9407, 82484, 304, 701, 2324, 13, 1472, 690, 2646, 12731, 505, 279, 198, 57014, 7389, 499, 527, 10032, 311, 6541, 279, 5419, 5357, 315, 701, 198, 61665, 82, 311, 1148, 499, 3021, 3815, 13, 10435, 430, 3463, 304, 701, 4059, 198, 438, 1304, 433, 279, 8792, 4668, 315, 701, 11555, 11, 1524, 422, 499, 1116, 817, 311, 1304, 279, 3351, 3432, 662, 29837, 449, 279, 3463, 13, 578, 810, 198, 9514, 5357, 389, 433, 11, 279, 810, 433, 690, 9407, 627, 53, 2154, 1870, 1475, 78, 841, 358, 617, 3596, 2322, 889, 706, 8208, 389, 311, 3974, 279, 198, 15674, 315, 23325, 276, 259, 2324, 358, 1097, 25394, 1618, 706, 1027, 10032, 311, 656, 198, 12840, 433, 5097, 311, 1304, 433, 3621, 13, 2435, 682, 17257, 7032, 430, 1051, 539, 198, 9164, 750, 50698, 323, 46531, 872, 19226, 13, 2684, 374, 912, 198, 2445, 8362, 488, 315, 6776, 311, 1304, 264, 5496, 520, 1148, 499, 3021, 11, 1070, 374, 198, 3323, 264, 82484, 315, 9006, 311, 1304, 433, 3621, 662, 33739, 499, 3021, 198, 45359, 810, 1109, 4205, 775, 706, 5918, 2949, 433, 459, 6776, 311, 198, 7072, 264, 5496, 520, 433, 11, 1524, 3582, 499, 1253, 539, 4510, 433, 13, 4718, 24087, 198, 1073, 3815, 1148, 499, 9615, 3021, 527, 3196, 389, 264, 16801, 430, 499, 527, 198, 9738, 311, 733, 14760, 323, 387, 12153, 311, 2343, 701, 19123, 323, 3449, 701, 198, 19521, 28423, 13, 2876, 779, 0, 13266, 889, 3021, 499, 690, 1862, 198, 9514, 304, 1475, 1648, 422, 499, 1935, 279, 6776, 311, 23564, 701, 198, 57291, 82, 13, 1442, 499, 617, 2744, 7318, 701, 19123, 11, 3249, 1053, 499, 198, 82, 44806, 387, 884, 384, 279, 3169, 315, 1732, 889, 1587, 539, 30, 1442, 701, 4553, 198, 19375, 21881, 311, 1694, 4294, 220, 1260, 11, 3249, 1053, 499, 3596, 8666, 198, 276, 51052, 8850, 6108, 3925, 311, 1304, 701, 1972, 26928, 11429, 5380, 58276, 1174, 499, 1253, 1505, 430, 1690, 315, 701, 24674, 198, 93310, 527, 5042, 279, 1121, 315, 264, 19433, 304, 902, 499, 617, 198, 82850, 3815, 1148, 499, 781, 70036, 627, 50, 71306, 701, 2324, 323, 499, 1253, 1505, 430, 499, 8108, 701, 198, 327, 3825, 42204, 323, 30255, 33452, 662, 1442, 499, 9615, 1390, 311, 198, 25859, 704, 304, 279, 49362, 11, 477, 5944, 4028, 279, 3224, 1174, 477, 1825, 709, 198, 64, 2678, 2626, 304, 2500, 961, 315, 279, 1917, 11, 499, 1633, 4461, 649, 198, 7072, 433, 3621, 13, 358, 617, 15243, 220, 449, 12387, 29509, 889, 198, 28010, 279, 5597, 311, 11857, 872, 8631, 44518, 6439, 323, 3240, 311, 198, 36311, 1523, 323, 1054, 3647, 616, 279, 61741, 863, 323, 2103, 23564, 264, 8063, 315, 198, 45359, 1148, 814, 2216, 10456, 13, 58603, 1174, 304, 1690, 5157, 433, 3952, 198, 64, 3221, 15998, 449, 4648, 311, 4546, 220, 420, 2349, 922, 13, 4718, 24087, 315, 198, 45359, 1148, 499, 3021, 527, 10213, 41976, 304, 653, 268, 4238, 6901, 198, 9233, 287, 13, 2052, 315, 1884, 24087, 649, 387, 15324, 439, 912, 64771, 342, 198, 6518, 1109, 63757, 1054, 61665, 82, 863, 902, 499, 649, 2349, 627, 17, 13, 1442, 499, 26122, 311, 2349, 1148, 499, 656, 11, 6725, 21955, 433, 1855, 198, 1316, 13, 1115, 2697, 32889, 79538, 37498, 709, 856, 1984, 304, 420, 3857, 25, 10438, 81869, 198, 331, 7153, 7732, 198, 7063, 28609, 3090, 198, 6153, 81869, 198, 331, 7153, 7732, 198, 7063, 28609, 3090, 16853, 1737, 4238, 53061, 706, 1633, 2697, 311, 656, 449, 701, 7446, 7640, 323, 198, 84270, 264, 2763, 311, 656, 449, 1268, 499, 1684, 1884, 7640, 13, 1472, 527, 2103, 198, 9738, 311, 48094, 7732, 323, 6920, 3090, 304, 1063, 11401, 11, 1193, 279, 198, 675, 3448, 291, 1732, 374, 912, 5129, 2133, 311, 41100, 279, 7732, 323, 279, 198, 13284, 1174, 477, 1524, 813, 1866, 2763, 304, 2324, 13, 33739, 499, 527, 3815, 1457, 198, 4919, 387, 1030, 757, 264, 9511, 315, 3021, 422, 499, 527, 10032, 311, 1304, 433, 430, 1648, 627, 2675, 656, 539, 617, 311, 12491, 701, 990, 477, 4205, 430, 499, 527, 3815, 627, 39, 349, 374, 264, 5873, 430, 4131, 505, 3515, 76815, 11555, 13, 66912, 374, 198, 1962, 9057, 555, 3515, 311, 2349, 264, 19108, 76853, 17510, 3115, 264, 1938, 345, 269, 4335, 63287, 11, 477, 3974, 304, 264, 9527, 2849, 11, 477, 6667, 26964, 11, 477, 3460, 198, 412, 24043, 7739, 11, 477, 9604, 220, 13093, 16659, 682, 1938, 304, 198, 8370, 4400, 374, 27332, 13, 578, 13463, 527, 25912, 3532, 276, 259, 627, 791, 781, 44661, 6866, 4871, 315, 499, 11, 539, 304, 279, 9434, 1917, 627, 2746, 499, 10491, 311, 3136, 304, 701, 3118, 5820, 1174, 6541, 701, 198, 1617, 3993, 9017, 430, 5820, 323, 2187, 37492, 1139, 701, 2324, 627, 2675, 649, 2804, 8996, 9256, 527, 2631, 315, 499, 449, 459, 198, 306, 556, 398, 2204, 13356, 13, 91162, 11, 856, 6576, 323, 32465, 198, 15495, 380, 5066, 541, 68976, 11, 8767, 264, 11213, 65022, 11, 1550, 198, 10872, 285, 989, 430, 1418, 1364, 2018, 577, 291, 311, 11722, 13, 3005, 6575, 389, 1077, 198, 1617, 3993, 1418 ]
0xBreath/holistic-books
and human urin~. The urine of cow, camel and goat may cure some of the diseases of the human body. As the diet of the human beings and the domestic animals is more or less similar as it is vegetarian, their urine contains similar properties. Consequenly, their urine is useful i.• certain conditions. I am sure, if Shri Bapalalbhai had used the t;J. T.-5 29 i I I ~ ~ i i 30 : AUTO~URINE THERAPY urine of the mare herself in the above case, healing would have been faster. But it must not have been possible to obtain its own urine instantly. Consequently, he used whatever urine was available. A number of Vaidyas do under statnd the utility of human urine but they dare not overcome the nausea against it prevalent in society. They hesitate to use 1t openly. Many of them are not aware that this utility is confined to ::t.;to-urine only. But how can the utiltity of auto­ urine in the case o( animals be ascertained? The fact could be · known only if the anim~ls can describe their experience themselves! The poor dumb anin,als when sick, abjure food and cure themselves by licking their own urine. I have said nowhere that urine of animals of human beings is useful to others. It is the fundamental principle of urine therapy that only the patient's own urine, i.e., auto-urine must be used. The urine of another person, however healthy he or she may be, is forbidden. It should not be given at least for drinking. The same rule applies in the case of animals also. After this clarfication, it must be perfectly clear that urine in general is not a medicine for all diseases; but auto-urine alone is so useful. It is a sure cure for all types of illness. The urine of very person contains such properties as are useful to himself only and to none else. On ihe contrary, it may prove harmful to others. There is every danger of infection and the patient may catch a di~ease from the other person through his urine. Consequently, only auto-urine is useful to a patient, and the use of the same is scientific. After the above discussion, can a question be raised whether urine can be held as the only medicine for many diseases? As a niatter of fact, the property of urine vary with every individual. So there arc as many medicines as the number of living being as. auto-urine differs from person to person. Every being has got his cure ready within him in the form of urine. This cure and its method of application have long been forgotten. We have to revive it by new experiments on patients. The Vaidyas and doctors who regard restoration of the health of the patient as their sublime duty, can undertake it and serve humanity thereby. THE METHOD OF URINE THERAPY : 31 -t facts have been clearly stated, I. In conclusion, when all relevan d that no false propaganda . h t" make an appeal to all concerne WIS ·' h be made against this instant t erapy. CHAPTER X THE METHOD OF URINE THERAPY -the importance of urine I dQ not want to dwell any ~ore on mentation to remove the therapy. I have tried my best ~ _ar~~e minds of the people.The Prejudice against it, so deep-seate m. d from the actual practice. f. well be recogn1ze real ment o unne can. s detailed in the following pages. I am of the method and expenment. d. world be rooted out after · · and preJU 1ces sure that stong superstitions dreds of arguments are insignificant their thorough perusal. Hun ·n his book The Water of f · ence Armstrong'' before a pinch o expen.. f h treatment of different disease. I Life, gives a detailed ac~ount o r:s:nt book in a separate section. In have summarized them m the p. ces and those of others. I. e my own expenen,. f II addition, I have a ~0 g1v. method of urine treatment m u In this chapter, I WISh to dlscu~s an. ccordance with his physical details. A patient can apply t em m a conditions. The four methods of urine treatment are: (1) massaging with urine, (2) drinking urine, (3) fasting by taking only urine and water, d" ed parts of the body. (4) putting urine packs on lseas d. • The treatment of all ISeases (1) The Method of Mas_sage ·bo.l cuts wounds, blisters, II. · flammat1on 1 s,'· h 1 excpet swe mg, m.. h' h bbing of urine on thew o e hould begm Wit t e ru "h fire-burns, etc., s ·ff. Shivambu-Kalpa prescn es a I. e is more e ectlve.. be body. Sta e unn.. hours but Armstrong prefers 1t to urine perseved for thirty-SIX 32 : AUTO-URINE THERAPY even five or seven days old. In m... Urine when preserved forfive o; VIew too, this IS more useful. concentrated. Its odour is intensified ~even. d~ys gets. ammonia ammonia, it enters into human bod a so _with ItS benefits. Due to normal person needs ei h Y quickly and abundantly. A should be perservedg _tor ten ounces of urine for daily rubbing. It m seven big b ttl ~ consecutively. The mouths of th bo 1 ° es or seven days away insects. Urine itself. e. ~ e~ should be corked to keep IS a germ1c1de There ·. germs being produced in it. The b 1 · IS no possibility of order -of days for the facilit f ott es should be arranged in the should be wide enough to y o_ use. The -mouths of the bottles bottles should be cleaned a~~s~~~~ne d~rectly into them. The empty . heated br ruiJbing, particularl i _again the sa~e day. It should ae into a cup and rubbed on h:,f ~h Wl~t~. Half of It should b8 f)oured head ur with the wa·1st The. e 0 Y· One may begin with the · unne remai · · h thrown away as it becomes d"rt. nmg In t e cup should be the other half of the bottle s~du/~ ~e course ~f rubbing. Thereafter other halfofthe body should be rubb eloured_ Into the cup and the a.1eavy· hand The m e · Rubbmg should not be with I. ovements of the hand sh ld be I Peasant. In no way should rubbin. ou ight and patient. The hands should I g be _pamful or unpleasant to the -a ways move m the d" · i.e. from the head it should be d lrect1on of the heart, be upwards. It can be d ownward and from the feet it should one once or twice d convenience. If done once onl th. a ay according to hours and ·f d · y, e duration should be about two 1 one tw1ce, each seatin · · half hours. There should be g ~ay cont1nue for one and a and neck. In case of two hmore, rubbbb~ng on t#e. ~Wies, head, face . ours ru mg fifteen. g1ven to each sole and th"rty.'mmutes may be . One may use another pe;son~mu!es each to head, _face and neck. urine is insufficient in ua. unne only for rubbmg if his own the beneficial results ~e ~~~bielf :~.treatment begins with rubbing, for four or five days the h t WI m a week. After the application out and the patient ~ay fee~\ ~:cumulated in the body may come heat eruptions. There is noth~ c mg~ sensation with or without small mg to ear about these signs. No other THE METHOD OF URINE THERAPY: 33 treatment should be adopted out of embarrassment. The eruptions may be r'ubbed with some pressure. When urine penetrates into the body through rubbing, minor ailments disappear automatically. Ringworm, itch, eczema and other skin disases disappear within a fortnight. An important instruction about rubbing is that no bath should be taken within two hours of the rubbing and no soap should be applied during the bath. In case of serious and chronic diseases, the body is generally poisoned by doses of strong medicines or injections and so a fast on urine and water is essential. The patient according to his condition and constitution may use cold or lukewarm water for bath. Armstrong lays great
[ 323, 3823, 4433, 258, 93, 13, 720, 791, 40335, 315, 19923, 11, 50252, 323, 54392, 1253, 27208, 1063, 315, 279, 720, 67, 1082, 2315, 315, 279, 3823, 2547, 13, 1666, 279, 10173, 315, 279, 3823, 23837, 323, 720, 1820, 13018, 10099, 374, 810, 477, 2753, 4528, 439, 433, 374, 46482, 11, 872, 720, 324, 483, 5727, 4528, 6012, 13, 1221, 6741, 268, 398, 11, 872, 40335, 374, 5505, 720, 72, 98566, 3738, 4787, 662, 358, 1097, 2771, 11, 422, 1443, 462, 426, 391, 278, 278, 65, 26279, 1047, 1511, 279, 720, 83, 26, 41, 13, 350, 12898, 20, 220, 1682, 602, 358, 358, 720, 93, 720, 93, 602, 602, 220, 966, 551, 36440, 93, 1539, 4069, 350, 3087, 2599, 56, 720, 324, 483, 315, 279, 55318, 11937, 304, 279, 3485, 1162, 11, 21730, 1053, 617, 720, 82850, 10819, 13, 2030, 433, 2011, 539, 617, 1027, 3284, 311, 6994, 1202, 1866, 720, 324, 483, 22571, 13, 53123, 11, 568, 1511, 8996, 40335, 574, 2561, 13, 720, 32, 1396, 315, 650, 3864, 82553, 656, 1234, 2863, 303, 279, 15919, 315, 3823, 40335, 719, 720, 20670, 33304, 539, 23075, 279, 61880, 2403, 433, 46941, 304, 8396, 13, 720, 7009, 39666, 311, 1005, 220, 16, 83, 30447, 13, 9176, 315, 1124, 527, 539, 8010, 430, 420, 720, 32000, 374, 45408, 311, 3588, 83, 16016, 998, 12, 324, 483, 1193, 13, 2030, 1268, 649, 279, 4186, 83, 488, 315, 3313, 5879, 198, 324, 483, 304, 279, 1162, 297, 7, 10099, 387, 439, 12525, 2692, 949, 578, 2144, 1436, 387, 720, 14260, 3967, 1193, 422, 279, 4039, 93, 4835, 649, 7664, 872, 3217, 5694, 0, 720, 791, 8009, 30355, 459, 258, 11, 1147, 994, 14363, 11, 671, 53402, 3691, 323, 27208, 5694, 720, 1729, 67231, 872, 1866, 40335, 13, 358, 617, 1071, 28211, 430, 40335, 315, 10099, 720, 1073, 3823, 23837, 374, 5505, 311, 3885, 13, 1102, 374, 279, 16188, 17966, 315, 720, 324, 483, 15419, 430, 1193, 279, 8893, 596, 1866, 40335, 11, 602, 1770, 2637, 3313, 12, 324, 483, 2011, 720, 1395, 1511, 13, 578, 40335, 315, 2500, 1732, 11, 4869, 9498, 568, 477, 1364, 720, 18864, 387, 11, 374, 37913, 13, 1102, 1288, 539, 387, 2728, 520, 3325, 369, 16558, 13, 720, 791, 1890, 6037, 17208, 304, 279, 1162, 315, 10099, 1101, 13, 720, 6153, 420, 20064, 69, 20901, 11, 433, 2011, 387, 14268, 2867, 430, 40335, 304, 720, 25615, 374, 539, 264, 16088, 369, 682, 19338, 26, 719, 3313, 12, 324, 483, 7636, 374, 779, 720, 817, 1285, 13, 1102, 374, 264, 2771, 27208, 369, 682, 4595, 315, 17563, 13, 578, 40335, 315, 1633, 720, 9164, 5727, 1778, 6012, 439, 527, 5505, 311, 5678, 1193, 323, 311, 720, 6836, 775, 13, 1952, 602, 383, 26102, 11, 433, 1253, 12391, 28856, 311, 3885, 13, 2684, 374, 720, 30115, 8137, 315, 19405, 323, 279, 8893, 1253, 2339, 264, 1891, 93, 47714, 505, 720, 1820, 1023, 1732, 1555, 813, 40335, 13, 53123, 11, 1193, 3313, 12, 324, 483, 374, 720, 817, 1285, 311, 264, 8893, 11, 323, 279, 1005, 315, 279, 1890, 374, 12624, 13, 720, 6153, 279, 3485, 10430, 11, 649, 264, 3488, 387, 9408, 3508, 720, 324, 483, 649, 387, 5762, 439, 279, 1193, 16088, 369, 1690, 19338, 949, 1666, 264, 720, 7907, 1683, 315, 2144, 11, 279, 3424, 315, 40335, 13592, 449, 1475, 3927, 13, 2100, 720, 19041, 15952, 439, 1690, 39653, 439, 279, 1396, 315, 5496, 1694, 439, 13, 720, 3989, 12, 324, 483, 44642, 505, 1732, 311, 1732, 13, 7357, 1694, 706, 2751, 813, 27208, 720, 2359, 2949, 1461, 304, 279, 1376, 315, 40335, 13, 1115, 27208, 323, 1202, 1749, 315, 720, 5242, 617, 1317, 1027, 25565, 13, 1226, 617, 311, 59816, 433, 555, 502, 720, 327, 50732, 389, 6978, 13, 578, 650, 3864, 82553, 323, 16410, 889, 5363, 720, 4014, 7769, 315, 279, 2890, 315, 279, 8893, 439, 872, 71246, 14523, 11, 649, 720, 1263, 531, 731, 433, 323, 8854, 22706, 28592, 13, 3247, 33497, 3083, 35514, 4069, 350, 3087, 2599, 56, 551, 220, 2148, 720, 2442, 13363, 617, 1027, 9539, 11224, 11, 358, 662, 720, 644, 17102, 11, 994, 682, 79415, 276, 294, 430, 912, 905, 30617, 720, 13, 305, 259, 1, 1304, 459, 14638, 311, 682, 3613, 68495, 468, 1669, 9787, 6, 305, 720, 1395, 1903, 2403, 420, 9888, 259, 2781, 9864, 13, 720, 88539, 1630, 720, 17673, 33497, 3083, 35514, 4069, 350, 3087, 2599, 56, 720, 10826, 12939, 315, 40335, 720, 40, 294, 48, 539, 1390, 311, 44935, 904, 4056, 461, 389, 11540, 367, 311, 4148, 279, 720, 46755, 13, 358, 617, 6818, 856, 1888, 4056, 721, 277, 5940, 68, 20663, 315, 279, 1274, 11829, 720, 4808, 18631, 560, 2403, 433, 11, 779, 5655, 7962, 349, 296, 662, 294, 505, 279, 5150, 6725, 662, 282, 662, 1664, 387, 5952, 16, 3059, 720, 8110, 11540, 297, 653, 818, 649, 662, 274, 11944, 304, 279, 2768, 6959, 13, 358, 1097, 720, 1073, 279, 1749, 323, 1367, 53061, 662, 294, 13, 1917, 387, 41976, 704, 1306, 9787, 9787, 323, 864, 41, 52, 220, 16, 1634, 2771, 430, 357, 647, 94705, 6055, 294, 54469, 315, 6105, 527, 73521, 720, 50828, 17879, 824, 36514, 13, 14834, 9787, 77, 813, 2363, 578, 10164, 315, 282, 9787, 665, 346, 45966, 364, 364, 1603, 264, 50346, 297, 1367, 268, 5354, 282, 305, 6514, 315, 2204, 8624, 13, 358, 720, 26833, 11, 6835, 264, 11944, 1645, 93, 632, 297, 436, 14835, 25, 406, 2363, 304, 264, 8821, 3857, 13, 763, 720, 19553, 69729, 1124, 296, 279, 281, 662, 27750, 323, 1884, 315, 3885, 13, 720, 40, 662, 384, 856, 1866, 1367, 34470, 1174, 662, 282, 8105, 5369, 11, 358, 617, 264, 4056, 15, 342, 16, 85, 662, 1749, 315, 40335, 6514, 296, 577, 720, 644, 420, 12735, 11, 358, 468, 1669, 71, 311, 28613, 2445, 84, 93, 82, 459, 13, 12810, 541, 685, 449, 813, 7106, 720, 15216, 13, 362, 8893, 649, 3881, 259, 991, 296, 264, 720, 16902, 13, 720, 791, 3116, 5528, 315, 40335, 6514, 527, 25, 720, 7, 16, 8, 3148, 4210, 449, 40335, 11, 720, 7, 17, 8, 16558, 40335, 11, 720, 7, 18, 8, 54560, 555, 4737, 1193, 40335, 323, 3090, 11, 720, 67, 1, 1608, 5596, 315, 279, 2547, 13, 320, 19, 8, 10917, 40335, 31406, 389, 326, 325, 300, 294, 13, 720, 6806, 578, 6514, 315, 682, 358, 1542, 2315, 720, 7, 16, 8, 578, 6872, 315, 20459, 646, 425, 9787, 754, 929, 15455, 34254, 11, 1529, 9487, 11, 720, 5660, 13, 9787, 74599, 8637, 16, 263, 220, 16, 274, 11, 364, 9787, 305, 220, 16, 3521, 7005, 10769, 14060, 11, 296, 662, 662, 305, 6, 305, 293, 7278, 315, 40335, 389, 279, 86, 297, 384, 305, 619, 2197, 76, 72959, 259, 384, 11369, 330, 71, 4027, 1481, 399, 82, 11, 5099, 2637, 274, 9787, 544, 662, 90913, 3042, 84, 16222, 278, 6733, 1685, 14606, 1560, 264, 358, 662, 384, 374, 810, 384, 384, 12654, 588, 13, 662, 387, 2547, 13, 60920, 384, 17380, 662, 662, 4207, 719, 45966, 55064, 220, 16, 83, 311, 40335, 55250, 2111, 369, 27219, 6354, 5511, 220, 843, 551, 36440, 12, 1539, 4069, 350, 3087, 2599, 56, 720, 17206, 4330, 477, 8254, 2919, 2362, 13, 763, 296, 662, 662, 662, 720, 52, 40101, 994, 34683, 369, 53770, 297, 26, 30768, 365, 2288, 11, 420, 3507, 810, 5505, 13, 720, 444, 1189, 55373, 13, 11699, 11018, 414, 374, 79849, 4056, 17206, 13, 294, 93, 1065, 5334, 13, 92003, 720, 309, 1677, 689, 11, 433, 29933, 1139, 3823, 30111, 264, 779, 721, 4291, 1102, 50, 7720, 13, 24586, 311, 720, 8416, 1732, 3966, 30529, 305, 816, 6288, 323, 23325, 18007, 13, 362, 720, 5562, 387, 7565, 2841, 70, 721, 11222, 5899, 49138, 315, 40335, 369, 7446, 57035, 13, 1102, 720, 76, 8254, 2466, 293, 55032, 4056, 20503, 332, 3210, 13, 578, 65609, 315, 270, 712, 220, 16, 37386, 1560, 477, 8254, 2919, 720, 14075, 41911, 13, 17229, 483, 5196, 662, 384, 662, 4056, 384, 93, 1288, 387, 90424, 291, 311, 2567, 720, 1669, 264, 82986, 16, 66, 16, 451, 2684, 9787, 662, 17684, 1026, 1694, 9124, 304, 433, 13, 578, 293, 220, 16, 9787, 3507, 912, 13336, 315, 720, 1382, 482, 1073, 2919, 369, 279, 17028, 282, 54022, 1560, 1288, 387, 28902, 304, 279, 720, 5562, 387, 7029, 3403, 311, 379, 297, 62, 1005, 13, 578, 482, 33780, 82, 315, 279, 27474, 720, 65, 1751, 645, 1288, 387, 28822, 264, 5940, 82, 10526, 818, 294, 93, 2921, 398, 1139, 1124, 13, 578, 4384, 720, 13, 32813, 1437, 436, 2005, 41, 7278, 11, 4040, 75, 602, 721, 33871, 279, 829, 93, 68, 1938, 13, 1102, 1288, 42956, 720, 18614, 264, 10747, 323, 67854, 389, 305, 42339, 69, 4056, 71, 468, 75, 93, 83, 93, 13, 26924, 315, 1102, 1288, 293, 23, 282, 8, 21020, 720, 2025, 4433, 449, 279, 10667, 14260, 16, 267, 578, 662, 384, 220, 15, 816, 14260, 3861, 1253, 3240, 449, 279, 9787, 653, 818, 1323, 2192, 9787, 9787, 305, 15338, 3201, 439, 433, 9221, 294, 1, 3423, 662, 308, 12591, 763, 259, 384, 10747, 1288, 387, 720, 1820, 1023, 4376, 315, 279, 16893, 274, 93, 1072, 54896, 4056, 68, 3388, 4056, 69, 57035, 13, 2684, 10924, 720, 1605, 15104, 831, 69, 1820, 2547, 1288, 387, 10485, 65, 658, 21020, 62, 32745, 279, 10747, 323, 279, 720, 64, 662, 16, 68, 5781, 14260, 1450, 578, 296, 384, 9787, 13134, 65, 12591, 1288, 539, 387, 449, 720, 40, 662, 297, 12760, 315, 279, 1450, 559, 27221, 387, 358, 5250, 15969, 13, 763, 912, 1648, 1288, 10485, 7006, 662, 6033, 220, 492, 323, 720, 23557, 13, 578, 6206, 1288, 358, 342, 387, 721, 79, 309, 1285, 477, 47989, 311, 279, 482, 64, 5627, 3351, 296, 279, 294, 1, 9787, 602, 1770, 13, 505, 279, 2010, 433, 1288, 387, 294, 326, 2921, 16, 263, 315, 279, 4851, 11, 720, 1395, 45054, 13, 1102, 649, 387, 294, 1866, 1637, 323, 505, 279, 7693, 433, 1288, 720, 606, 3131, 477, 11157, 294, 19679, 13, 1442, 2884, 3131, 389, 75, 270, 662, 264, 19432, 4184, 311, 720, 31482, 323, 9787, 69, 294, 9787, 379, 11, 384, 8250, 1288, 387, 922, 1403, 220, 16, 832, 4483, 16, 346, 11, 1855, 10954, 258, 9787, 9787, 720, 38106, 4207, 662, 2684, 1288, 387, 342, 4056, 352, 687, 16, 77, 361, 369, 832, 323, 264, 720, 438, 13272, 13, 763, 1162, 315, 1403, 305, 6518, 11, 10485, 54251, 93, 983, 389, 259, 2, 68, 13, 4056, 54, 552, 11, 2010, 11, 3663, 720, 13, 11604, 11369, 14060, 37755, 662, 342, 16, 1055, 311, 1855, 13612, 323, 270, 1, 81, 1919, 662, 364, 9653, 2142, 1253, 387, 720, 13, 3861, 1253, 1005, 2500, 1069, 26, 942, 93, 15479, 0, 288, 1855, 311, 2010, 11, 721, 1594, 323, 13272, 13, 720, 324, 483, 374, 39413, 304, 46659, 662, 653, 818, 1193, 369, 10485, 65, 12591, 422, 813, 1866, 720, 1820, 24629, 3135, 4056, 68, 4056, 5940, 8385, 491, 551, 93, 13, 83, 35320, 12302, 449, 57035, 11, 720, 2000, 3116, 477, 4330, 2919, 279, 305, 259, 43023, 296, 264, 2046, 13, 4740, 279, 3851, 720, 412, 323, 279, 8893, 4056, 352, 11307, 93, 59, 4056, 25, 60353, 7913, 304, 279, 2547, 1253, 2586, 720, 20559, 61354, 1324, 13, 2684, 374, 912, 339, 93, 272, 14060, 93, 37392, 449, 477, 2085, 2678, 720, 12591, 311, 2487, 922, 1521, 12195, 13, 2360, 1023, 3247, 33497, 3083, 35514, 4069, 350, 3087, 2599, 56, 25, 220, 1644, 720, 83, 35320, 1288, 387, 18306, 704, 315, 60030, 13, 578, 61354, 1324, 720, 18864, 387, 436, 6, 392, 2788, 449, 1063, 7410, 13, 3277, 40335, 44805, 988, 1139, 279, 720, 2664, 1555, 57035, 11, 9099, 82907, 32153, 9651, 13, 720, 44566, 56741, 11, 95856, 11, 12208, 89, 9355, 323, 1023, 6930, 834, 2315, 32153, 2949, 264, 720, 4057, 9471, 13, 1556, 3062, 7754, 922, 57035, 374, 430, 912, 9061, 720, 5562, 387, 4529, 2949, 1403, 4207, 315, 279, 57035, 323, 912, 27883, 1288, 720, 1395, 9435, 2391, 279, 9061, 13, 763, 1162, 315, 6129, 323, 21249, 19338, 11, 720, 1820, 2547, 374, 8965, 71598, 555, 35130, 315, 3831, 39653, 477, 720, 258, 25593, 323, 779, 264, 5043, 389, 40335, 323, 3090, 374, 7718, 13, 578, 8893, 720, 74946, 311, 813, 3044, 323, 16812, 1253, 1005, 9439, 477, 720, 102847, 365, 2227, 3090, 369, 9061, 13, 720, 34013, 4620, 57622, 2294 ]
0xBreath/holistic-books
ifferent results from the seeds they sow. It’s disillusioning that evil deeds go unpunished and virtue is overlooked, that bad things happen to good people all the time. The Vedic rishis did not mark this down to the vagaries of a whimsical Providence. Karma is unpredictable, they said, for the same reasons that consciousness is unpredictable: Creativity is innate. Uncertainty allows new forms to emerge.The unknown contains infinite possibilities, of which only a fraction appear in the known world. Nature is change and stability at the same time. These are the basic tenets of Karma, and what’s most fascinating is that we are held together not by inexorable mechanics but by a deep commitment to uncertainty and the creative leaps that result from that. Reincarnation is how consciousness becomes new even as it uses materials that can never be created or destroyed. That is the wonder of it. Infinite change and infinite stability coexist—this is also the mystery we have to solve before reincarnation can be fully understood. Karma on the Brain Karma may turn out to be the key to understanding the brain itself. Neurologists are puzzled over what they call “the binding effect,” a mysterious force that pulls different areas of the brain together. Recent advances in brain imaging show that it takes several regions of the brain to cooperate in any thought, feeling, or sensation. Say you walk into a room, recognize your mother, and ask her if she remembers the recipe for the birthday cake she made for your tenth birthday. Your brain isn’t jumping from one area that recognizes who she is to another that wants to ask a question to a third that remembers your past birthdays. The whole brain assigns these tasks to several areas all at once, and the mystery is how this happens. If the brain had a high-speed telephone system to send messages whizzing from place to place, the binding effect would be explained as a series of sequential commands. But neurons act simultaneously. Point A and point B light up at the same time, leaving no interval for a back-and-forth signal. Moreover, the brain is capable of infinite combinations that have little or no relationship with one another. Every thought, then, is an activity of the whole brain. Even though a CAT scan might be able to visualize the exact clump of neurons in the brain where a murderous thought arises in a criminal mind and to a kindly thought in a saintly mind, it’s the whole brain that differentiates a criminal from a saint. It takes an entire brain to oversee all the traffic that coordinates a hundred billion independent neurons, making sure that they all tie in to an infinite, teeming conversation. If I want to perform an act of kindness, my brain might provide me with a simple thought, such as, I should donate to disaster relief . This single thought requires the following: A moral sense of right and wrong Memories of what it’s like to be helpless and victimizedEmpathy with fellow sufferers A feeling of compassion A sense of duty to society These interlocked elements reside in various parts of the brain and represent unique patterns of activity. At the same time, at a deeper level my brain has to remain aware of who I am, my history of kind and unkind acts, my unconscious guilt, my awareness of role models who were also kind, etc. What’s truly amazing is that the brain knows how to mesh all these ingredients instantly. It doesn’t go to the wrong memory or feeling. It doesn’t forget who I am, or provide me with bizarre distractions, unless I am mentally ill, in which case I could become completely untethered. In my inability to recognize that my thoughts are actually my own, I might think God is ordering me to give money to disaster relief. I may be aware only of a single thought, yet what my brain does in support of that thought spans a much larger extent. (Neurologists estimate that a person is aware of about 2,000 bits of information per minute being processed by the brain. This sounds impressive, but outside our awareness the brain is actually processing 400 billion bits of information per minute. Miraculously, it remains in control of each one and filters out all but the tiny fraction that we require to be in the world and follow our train of thought and desire.) I’ve gone into some detail here because if it takes the whole brain to produce one thought, it also takes the whole universe to perform a single action. Like a neuron, electrons and atoms seem to be independent, yet a change of electron spin at one extreme of the universe will be mirrored, instantly and without sending signals, by a paired electron billions of light years away. So the “binding effect” is cosmic as well as personal; it exists “in here” and “out there.” The net result is that you are an activity of the whole universe, an insight that sounds abstract, but just as a single thought requires your brain to perform a huge number of unseen calculations, so Karma performs unseen calculations to produce you. As we now can prove, change and stability coexist in the brain; without both it couldn’t operate. When you remember an old birthday, you can call it “my” thought, but you feel no personal connection to synapses and dendrites or the firestorm of signals passing over them. Brain cells work by totally predictable means involving exchanges of electrical charges between sodium and potassium atoms and simple oscillations between positive and negative electrical impulses. Somehow that mechanical stability produces free, creative, unpredictable thought forms. The rishis asserted the same about Karma. It is infinitely flexible and infinitely inflexible depending on how you look at it. Unknown forces are freeto reshape you without your knowledge. They do it all the time, since none of us has the slightest awareness of how our brains move from thought A to thought B. Neurology is witness to the event, but that’s far from knowing the how or why. Two people can say the word “apple,” and their brains will exhibit the same pattern of activity. This pattern, however perfectly mapped, has no predictive value in telling us the next word each person will speak— event B could be any word, sound, or gesture, perhaps just silence. This opens the question of how much choice we exercise over our next lifetime. It’s not useful simply to say that Karma is flexible and inflexible at the same time. In fact, the coexistence of opposites is a
[ 18780, 56597, 43827, 33188, 85786, 6910, 197, 20670, 1942, 363, 13, 62635, 753, 35697, 82262, 287, 198, 9210, 197, 59967, 59451, 6910, 31780, 21113, 66007, 3384, 53577, 5306, 2154, 361, 20501, 197, 2017, 7349, 291, 11, 1602, 9210, 198, 2282, 329, 197, 58174, 9793, 64860, 198, 998, 3253, 1411, 197, 16455, 52060, 33188, 22724, 13, 33026, 17904, 34383, 7145, 819, 285, 2765, 307, 98366, 2157, 847, 2090, 2765, 785, 32809, 33188, 198, 85, 351, 5548, 44323, 11575, 197, 1336, 5861, 950, 197, 1360, 28580, 13, 40440, 20306, 20501, 21113, 35798, 481, 11, 197, 20670, 1942, 3864, 11, 2066, 33188, 198, 25030, 17643, 99949, 64442, 38303, 23995, 2136, 20501, 21113, 35798, 481, 512, 31844, 1968, 20501, 197, 6258, 349, 627, 64818, 81246, 52060, 4336, 8808, 197, 10008, 32809, 67304, 10286, 11829, 197, 16476, 197, 13676, 17886, 26806, 197, 9007, 13757, 11, 44323, 197, 8370, 197, 3323, 11575, 1186, 16597, 197, 41866, 198, 258, 33188, 197, 5391, 77608, 627, 79519, 20501, 69480, 53577, 18895, 2968, 36547, 33188, 1942, 373, 22724, 627, 9673, 197, 548, 33188, 2282, 6099, 197, 2002, 1441, 44323, 40440, 20306, 11, 53577, 197, 12840, 753, 2157, 537, 1186, 5171, 16252, 20501, 64442, 198, 906, 197, 548, 9793, 789, 32809, 3522, 98366, 197, 1729, 17886, 327, 25745, 2157, 112939, 1233, 2282, 332, 197, 1729, 11575, 197, 33980, 197, 17869, 479, 198, 998, 197, 1371, 81246, 53577, 33188, 197, 52817, 197, 273, 2690, 64442, 9753, 43827, 64442, 627, 697, 2910, 55149, 20501, 197, 5269, 38303, 23995, 2136, 2282, 762, 20969, 8808, 7883, 1055, 61551, 24263, 197, 4881, 198, 78672, 64442, 94036, 197, 37593, 74242, 197, 7266, 82266, 197, 15886, 291, 13, 197, 4897, 20501, 33188, 6831, 14518, 44323, 24263, 627, 644, 26806, 69480, 53577, 17886, 26806, 18895, 2968, 197, 1030, 29675, 2345, 576, 20501, 197, 19171, 33188, 2157, 96357, 197, 906, 9793, 525, 198, 998, 1942, 4035, 64334, 17643, 2910, 55149, 94036, 74242, 1186, 22732, 197, 8154, 52784, 627, 42, 20306, 25653, 33188, 197, 66177, 198, 42, 20306, 2157, 352, 197, 413, 14294, 32809, 74242, 33188, 24555, 32809, 197, 8154, 10276, 33188, 197, 54160, 24263, 726, 627, 8989, 2868, 848, 1705, 197, 548, 3303, 9065, 839, 197, 2017, 197, 12840, 197, 20670, 68388, 197, 2118, 1820, 2282, 4049, 89170, 2476, 11575, 198, 76, 97499, 2066, 346, 64442, 3303, 71523, 2765, 18780, 197, 33637, 44323, 33188, 197, 54160, 32809, 3522, 13, 197, 26198, 198, 14625, 3095, 17886, 197, 54160, 55992, 4210, 33827, 64442, 24263, 3324, 2094, 85786, 17998, 38113, 919, 44323, 33188, 197, 54160, 32809, 198, 1030, 86299, 17886, 197, 3852, 197, 61665, 11, 1186, 68, 20659, 11, 82266, 1942, 42725, 13, 7721, 352, 197, 9514, 6831, 1727, 2129, 78, 11575, 197, 3039, 345, 34551, 553, 14862, 414, 2157, 1605, 11, 53577, 197, 1091, 197, 1964, 748, 1942, 383, 197, 1864, 7207, 33188, 197, 26273, 2066, 33188, 198, 52365, 1470, 731, 1942, 383, 2157, 1037, 2066, 14862, 414, 3324, 21341, 2282, 20546, 13, 197, 7927, 197, 54160, 20501, 77, 1431, 12710, 55432, 43827, 198, 606, 96168, 64442, 197, 34551, 4861, 197, 14965, 1942, 383, 20501, 32809, 1602, 43063, 198, 64442, 6831, 1821, 32809, 197, 1091, 11575, 197, 7998, 32809, 198, 64, 197, 32827, 64442, 197, 1864, 7207, 14862, 414, 3303, 561, 2282, 4914, 14097, 13, 33026, 197, 67733, 197, 54160, 197, 7128, 82, 197, 45010, 198, 25792, 32809, 85786, 17998, 197, 33637, 52060, 36547, 197, 13486, 11, 53577, 33188, 2157, 96357, 20501, 197, 5269, 2090, 9793, 680, 729, 627, 2746, 33188, 197, 54160, 9793, 329, 11575, 9793, 1108, 30699, 197, 53027, 41393, 32809, 33917, 2157, 3822, 197, 1336, 8934, 287, 198, 1527, 197, 2050, 32809, 197, 2050, 11, 33188, 2282, 4049, 89170, 6831, 619, 74242, 8285, 501, 2692, 61551, 11575, 197, 20473, 44323, 198, 93450, 197, 25256, 13, 197, 4071, 197, 818, 54769, 93799, 1942, 318, 495, 20933, 13, 51398, 23845, 53577, 59574, 13083, 198, 4238, 60910, 36547, 33188, 1942, 373, 22724, 11, 197, 273, 2370, 73204, 2129, 6283, 2066, 11575, 78546, 9976, 15548, 339, 82419, 627, 58276, 11, 33188, 197, 54160, 20501, 1470, 391, 481, 44323, 17886, 26806, 33910, 74729, 64442, 9793, 525, 8986, 2433, 82266, 73204, 198, 37195, 48048, 197, 606, 197, 43063, 627, 11769, 197, 61665, 11, 59733, 11, 20501, 80557, 197, 7323, 44323, 33188, 197, 67733, 197, 54160, 13, 197, 13461, 197, 4636, 11575, 6391, 835, 198, 16810, 2157, 492, 74242, 197, 481, 32809, 197, 30318, 553, 33188, 8285, 533, 40507, 1538, 44323, 197, 818, 54769, 17886, 33188, 197, 54160, 56842, 198, 64, 2157, 324, 1126, 788, 197, 61665, 70440, 5014, 17886, 11575, 1470, 58140, 2157, 485, 53577, 32809, 11575, 197, 15674, 398, 197, 61665, 17886, 11575, 198, 82, 1673, 398, 2157, 485, 11, 24263, 753, 33188, 197, 67733, 197, 54160, 64442, 2765, 18780, 43398, 11575, 1470, 58140, 43827, 11575, 1942, 1673, 13, 62635, 198, 79079, 80557, 78755, 556, 197, 54160, 32809, 197, 2017, 4151, 52060, 33188, 197, 55087, 64442, 197, 35839, 11575, 9793, 7259, 198, 65, 15068, 17886, 38655, 197, 818, 54769, 11, 2157, 1802, 1942, 554, 64442, 197, 20670, 52060, 3324, 648, 17886, 32809, 80557, 17886, 26806, 345, 668, 74914, 38303, 23124, 13, 52792, 25494, 51880, 32809, 197, 29588, 80557, 93799, 44323, 197, 15674, 2136, 11, 13938, 197, 54160, 2157, 492, 198, 62556, 50394, 48048, 11575, 1942, 6592, 197, 61665, 11, 1942, 1412, 61551, 11, 1602, 40, 197, 5562, 2765, 263, 349, 32809, 35697, 2352, 197, 3833, 4843, 198, 627, 2028, 1942, 2222, 197, 61665, 197, 42475, 33188, 1186, 1573, 287, 512, 32, 2157, 10020, 1942, 1137, 44323, 49021, 53577, 6831, 14684, 198, 19346, 2490, 44323, 197, 12840, 24263, 753, 197, 4908, 32809, 74242, 88740, 1752, 53577, 5306, 858, 46806, 29831, 19682, 48048, 1186, 5412, 1942, 2084, 388, 198, 32, 1186, 68, 20659, 44323, 197, 31929, 290, 198, 32, 1942, 1137, 44323, 2765, 20850, 32809, 1942, 6180, 198, 9673, 60015, 25656, 197, 22138, 10413, 579, 17886, 2462, 1245, 3303, 7183, 44323, 33188, 197, 54160, 53577, 198, 36369, 197, 9782, 3303, 3307, 82, 44323, 197, 7323, 13, 197, 1688, 33188, 1942, 373, 22724, 11, 36547, 11575, 59451, 10653, 54843, 13938, 198, 54160, 64355, 32809, 197, 48684, 197, 20111, 44323, 197, 14965, 25494, 197, 309, 11, 13938, 9793, 2644, 44323, 197, 15674, 53577, 197, 3200, 485, 197, 11613, 345, 2465, 21113, 64589, 3253, 11476, 11, 13938, 197, 20111, 2136, 44323, 197, 5898, 20307, 82, 197, 14965, 6831, 486, 197, 19171, 197, 15674, 11, 197, 12380, 627, 3923, 753, 26665, 3988, 197, 309, 6795, 20501, 64442, 33188, 1602, 54160, 198, 16868, 3409, 82, 197, 5269, 32809, 77145, 52060, 197, 45010, 198, 39220, 17886, 4811, 398, 13, 62635, 2765, 7217, 77, 1431, 31780, 32809, 33188, 6831, 14684, 2157, 4836, 82266, 1186, 68, 20659, 13, 62635, 2765, 7217, 77, 1431, 198, 41119, 197, 14965, 25494, 197, 309, 11, 82266, 197, 62556, 50394, 48048, 2282, 30582, 75582, 969, 5247, 11, 21113, 1752, 25494, 197, 309, 197, 479, 750, 198, 484, 11, 17886, 197, 8370, 2789, 25494, 1470, 619, 2282, 52521, 33910, 50268, 197, 3935, 2791, 291, 13, 71267, 13938, 17886, 2968, 32809, 198, 34551, 553, 64442, 13938, 197, 61665, 82, 197, 548, 197, 74128, 13938, 197, 785, 11, 25494, 2157, 492, 197, 27963, 9796, 347, 20501, 198, 52969, 50394, 32809, 3253, 535, 2157, 2596, 32809, 35697, 2352, 197, 3833, 4843, 627, 40, 2157, 352, 74242, 197, 20111, 197, 3323, 44323, 11575, 1942, 2222, 197, 61665, 11, 14862, 295, 197, 12840, 13938, 197, 54160, 2765, 7217, 17886, 198, 24249, 44323, 64442, 197, 61665, 42478, 598, 11575, 2157, 1412, 8986, 42876, 197, 71272, 13, 197, 8368, 68, 2868, 848, 1705, 197, 41230, 64442, 198, 64, 99905, 20501, 197, 20111, 44323, 197, 9274, 197, 17, 11, 931, 2282, 1220, 44323, 17886, 1659, 197, 716, 26388, 1088, 197, 35214, 198, 35122, 197, 1729, 33188, 197, 54160, 13, 41065, 1942, 3171, 55992, 69563, 11, 2282, 332, 14294, 3002, 197, 414, 197, 20111, 2136, 33188, 198, 54160, 20501, 197, 74128, 197, 21315, 197, 3443, 2282, 15068, 2282, 1220, 44323, 17886, 1659, 197, 716, 26388, 1088, 627, 59561, 582, 38662, 11, 24263, 197, 1864, 1771, 17886, 83886, 44323, 7883, 613, 197, 606, 53577, 1186, 8782, 14294, 52060, 2282, 332, 33188, 3324, 6577, 198, 82190, 64442, 197, 906, 18441, 32809, 74242, 17886, 33188, 77608, 53577, 1186, 1573, 197, 414, 197, 10613, 44323, 197, 61665, 53577, 198, 5919, 556, 29275, 40, 4070, 3253, 606, 2129, 78, 1942, 638, 2765, 1660, 197, 6881, 2282, 6769, 748, 24263, 3324, 2094, 33188, 197, 67733, 197, 54160, 32809, 198, 98374, 197, 606, 197, 61665, 11, 24263, 197, 19171, 3324, 2094, 33188, 197, 67733, 21113, 8194, 32809, 197, 29588, 11575, 1942, 2222, 198, 1335, 13, 197, 13246, 11575, 197, 818, 37190, 11, 7883, 772, 26692, 53577, 36547, 7085, 85786, 336, 32809, 74242, 17886, 38655, 11, 14862, 295, 11575, 198, 3455, 44323, 7883, 70329, 45675, 36547, 197, 606, 96550, 9831, 44323, 33188, 21113, 8194, 6831, 484, 74242, 2157, 404, 48743, 345, 86258, 398, 53577, 197, 30096, 1942, 2518, 70154, 1147, 11, 197, 1729, 11575, 3303, 25260, 7883, 70329, 2282, 91387, 44323, 95053, 198, 42820, 197, 14075, 13, 78012, 33188, 197, 2118, 32136, 89170, 863, 20501, 1470, 437, 21914, 61551, 6831, 616, 61551, 99905, 278, 26, 24263, 8285, 1705, 197, 2118, 258, 198, 6881, 863, 53577, 197, 2118, 412, 197, 19041, 2029, 33026, 60586, 9753, 20501, 64442, 1602, 9514, 198, 197, 548, 80557, 197, 7323, 44323, 33188, 197, 67733, 198, 359, 8194, 11, 80557, 197, 1354, 492, 64442, 1942, 3171, 197, 16647, 11, 2282, 332, 197, 4345, 61551, 11575, 1942, 2222, 197, 61665, 197, 42475, 198, 22479, 197, 54160, 32809, 197, 29588, 11575, 9793, 4838, 58235, 44323, 21113, 29412, 92853, 3395, 811, 11, 197, 708, 40440, 20306, 198, 716, 10008, 21113, 29412, 92853, 3395, 811, 32809, 197, 98374, 197, 9514, 627, 2170, 197, 906, 82022, 94036, 197, 35563, 11, 69480, 53577, 18895, 2968, 197, 1030, 29675, 17886, 33188, 197, 54160, 26, 197, 30096, 198, 21704, 24263, 1470, 619, 77, 1431, 197, 86299, 13, 197, 4599, 197, 9514, 197, 30380, 80557, 62928, 2282, 20546, 11, 197, 9514, 94036, 68388, 24263, 198, 2118, 2465, 863, 197, 61665, 11, 2282, 332, 197, 9514, 1186, 96551, 73204, 99905, 278, 55690, 32809, 1942, 1910, 79390, 53577, 2765, 408, 24143, 198, 269, 33188, 71537, 27511, 44323, 70154, 1147, 42531, 287, 197, 2017, 197, 49818, 13, 197, 66177, 1470, 6572, 98138, 197, 1729, 3324, 354, 750, 198, 35798, 481, 50394, 598, 17886, 12821, 4504, 8285, 19926, 44323, 7883, 772, 12381, 197, 63399, 2282, 10259, 1942, 47876, 198, 438, 3303, 354, 49163, 36547, 7085, 1602, 438, 198, 1942, 6592, 197, 24366, 484, 811, 2282, 10259, 197, 31587, 53577, 9215, 15410, 198, 19493, 12381, 197, 6802, 67116, 13, 7721, 638, 5269, 64442, 2157, 4842, 45983, 18895, 2968, 197, 8723, 1634, 17389, 345, 52817, 11, 21113, 35798, 481, 197, 61665, 197, 10008, 627, 791, 7145, 819, 285, 7093, 291, 33188, 1942, 373, 197, 9274, 40440, 20306, 13, 62635, 20501, 197, 13885, 7627, 1186, 95644, 53577, 198, 13885, 7627, 17886, 12287, 1260, 197, 81580, 25653, 197, 5269, 197, 9514, 197, 7349, 36547, 24263, 13, 197, 14109, 2066, 1634, 197, 548, 1186, 3829, 78, 197, 16529, 197, 9514, 197, 30096, 14862, 414, 16868, 52286, 13, 197, 7009, 20530, 24263, 52060, 33188, 22724, 11, 1942, 1736, 197, 6836, 44323, 198, 355, 64355, 33188, 1942, 4238, 478, 197, 20111, 2136, 44323, 197, 5269, 197, 414, 197, 33725, 50388, 43827, 197, 61665, 23845, 32809, 198, 61665, 13083, 13, 197, 8989, 2868, 36781, 20501, 6831, 8251, 32809, 33188, 29402, 11, 2282, 332, 64442, 753, 1186, 277, 43827, 16868, 3409, 287, 33188, 198, 5269, 82266, 197, 35734, 13, 10473, 1146, 197, 16455, 94036, 1942, 352, 33188, 67398, 197, 2118, 23182, 2476, 53577, 33188, 404, 197, 33725, 6831, 484, 198, 327, 66917, 33188, 1942, 373, 3303, 3307, 44323, 197, 7323, 13, 41065, 3303, 3307, 11, 197, 98936, 197, 64185, 398, 2157, 5795, 345, 4752, 73204, 3303, 9037, 535, 16709, 17886, 3324, 6427, 71275, 33188, 29244, 67398, 7883, 613, 99905, 6831, 484, 1942, 23635, 2345, 198, 3163, 13083, 1470, 619, 74242, 197, 3852, 67398, 11, 95487, 11, 82266, 3253, 16375, 11, 197, 66372, 197, 4345, 1942, 321, 768, 627, 2028, 197, 25149, 33188, 197, 7998, 44323, 197, 5269, 2157, 1412, 197, 12008, 197, 906, 8285, 18865, 197, 2017, 197, 414, 29244, 198, 98157, 13, 62635, 753, 98366, 42919, 1285, 1942, 318, 2603, 32809, 1942, 352, 64442, 40440, 20306, 20501, 1186, 95644, 53577, 17886, 12287, 1260, 36547, 198, 1820, 1942, 373, 22724, 13, 71267, 1186, 533, 11, 33188, 197, 1030, 93772, 44323, 40803, 81239, 20501, 11575, 197 ]
0xBreath/holistic-books
Chikitsa chapter, verse 164 Benets – Useful in low back pain, sciatica, sacral pain, tail bone pain, knee pain and constipation. Method of Preparation Materials needed – Roots of Dashamula (Roots of 10 herbs taken individually)/Coarse powder of Dashamula (10 herbal roots) It is available in the market. Water Big vessel• • • •Stove Sterile cloth/sieve Bottle or small vessel for collecting the ltered Kashayam Castor oil Method of Preparing Kashayam Dashamoola is the group of 10 herbs. It is readily available in herbal stores. It is a combination of roots of – Bilva – Aegle marmelos Agnimantha – Premna mucronata Shyonaka – Oroxylum indicum Patala – Stereospermum suaveolens Gambhari – Gmelina arborea Brihati – Solanum indicum Kantakari – Solanum xanthocarpum Gokshura – Tribulus terrestris Shalaparni – Desmodium gangeticum Prishnaparni – Uraria picta e roots of Dashamula are taken in coarse or ne powder format. e combination is boiled with 16 times water in a big vessel. It is boiled until 4 times (parts) water remains, i.e. reduced to 1/4 quantity of the content. Say for example 2.5 grams of coarse powder of each drug summing up to 25 grams is boiled with 16 times i.e. roughly 400 ml water and reduced to 100ml. e decoction thus prepared is ltered through a sterile cloth or sieve into a bottle or small vessel. It is used in 2 divided doses i.e. 50 ml in the morning and 50 mlin the evening before food. If the disease demands administration of an extra dose, the quantity of powder of the herbs and water is proportionally increased. Method and Dose of Combination e Dashamula Kashayam is taken in 50 ml quantity (freshly prepared) or 10– 15 ml Kashayam diluted with 30–45 ml warm water (readily available bottled kashayam). To this 5–10 ml edible castor oil is added. e ingredients are mixed well and administered as oral consumption. When to use and how many times to take? e combination works best when given at evening, at least an hour before dinner. Some people might have intolerance to castor oil. ey need to consult a doctor before trying this remedy. Limitations e formulation might not be the sole remedy for back pain and allied problems. It is the best shot when the condition is mild or moderate. All people might not tolerate the taste, smell and or effect of castor oil. is remedy is not suitable for people with from diarrhoea, sensitive or sore stomach, dysentery, haemorrhoids, vomiting or nausea.24. Easy Ayurveda Home Remedy for Fever And Cold Y A simple home remedy for fever and cold can be prepared with three easily available herbs. is home remedy for cold and fever is prepared in the form of Ayurvedic kashayam. is home remedy is especially benecial if the fever is of viral origin. Here is the detailed method of how it is prepared. Ingredients Dry Ginger – 10 grams, Hareetaki (Harad) – Terminalia chebula – 20 grams and Guduchi – Indian Tinospora (giloya) – 30 grams. How to prepare home remedy for fever and cold? Coarse powder of these three herbs is taken in a clean wide mouthed vessel. Add 800 ml of water into the vessel, leave it for 2–3 h ours. Boil this mixture of herbs and water in mild re till the total water in the vessel is reduced to approximately 200 m l. After heating till only 200 ml of water remains in the vessel, put off the stove, take the vessel out and lter the contents. e ltered liquid is the home remedy. Precautions: All the general precautions and rules of kashayam making should be strictly followed.Dose: 10–15 ml once or twice in a day, half an hour before food. Benets is kashayam is traditionally used in the treatment of fever and cold. It increases immunity. It improves digestion capacity by correcting the enzymes in stomach and intestines. It is effective against cold associated with fever. Ginger and giloya have potent antiviral properties. Hence this can be used in viral diseases. Daily intake of this kashayam for a period of one month is very helpful in people suffering from recurrent fever and cold. Precaution: It is better to try this home remedy only after seeking professional advice.• • •25. Home Remedy for Body Heat, Burning Urination and Abdominal Pain Y Excess body heat, burning urination, related abdominal pain and burning sensation in palms and feet – all these symptoms suggests towards Pitta. Suppose you come home from hot Sun you may require a simple drink to cool body heat fast. Here is an easy to prepare quick home remedy using Amla and Jaggery. Amla in Ayurveda One of the peculiar feature of Amla is, its qualities blend in with other ingredients. For example, jaggery is sweet and has Pitta balancing effect. When you give jaggery processed with Amla, it further enhances its Pitta balancing effect. is simple principle is used in the following traditional Ayurvedic home remedy. What you need? Amla churna (Amla powder) – 25 grams (1 part) water – 200 ml (8 parts) Jaggery – 3–5 grams Procedure Take Amla powder in a wide mouthed container, add water to it, boil in mild heat, stir continuously and reduce it to approximately 50 ml, lter it, allow it• • • •to cool it down. Take 10–20 ml of this amla drink along with 3–5 g rams of jaggery powder. It can be taken before food for maximum effect. It can be taken once or twice a day. Once you prepare it, it can be stored for only one day. Means, everyday, you need to make the home remedy afresh. It can be taken upto 2–3 weeks for good results. Note e above mentioned method of boiling amla with water is Kashayam. Usually all Kashayams are given when they are mild hot. But here, we are letting it cool down, before taking it. For making this home remedy, either coarse powder or ne powder of Amla can be taken. Contra Indication: People with diabetes may skip this. Benets It relieves body heat, improves digestion. It is a good home remedy for burning urination. It is an ideal home remedy for Pitta. If your doctor has advised pitta diet to you, this home remedy for you.26. Giloy Ayurveda Home Remedy for Fever and Anorexia Y When it co mes to Ayurvedic medicine for fever, Giloy (Indian Tinospora) is an essential ingredient. is remedy is especially useful in fever associated with lack of interest in food. What you need? Giloy – Guduchi 25 grams – coarse/ne powder Water – 400 ml Long pepper – Pippali – 2–3 pinches – ne powder Honey – 1–2 teaspoons First Step – Preparation of Guduchi Kashaya 25 Grams of Giloy is added with 400 ml of water, boiled and reduced to 100 ml. 1 ounce of Tinospora is added with 16 ounces of water, boiled and reduced to 4 ounces. e boiling should be done in mild re, in an open vessel, with continuous stirring. Second StepTo the freshly prepared Tinospora kashaya, 2–3 pinches of long pepper are added and stirred well. How to take? 20–30 ml of this Kashaya is taken along with one teaspoon of honey, once or twice a day, 10 minutes before food. e dose can be even little higher based on strength of the disease and patient. Benets Useful in fever, chronic fever and associated indigestion and anorexia. How does it work? Tinospora is a known antipyretic herb of Ayurveda. It is widely used in many Ayurvedic medicines for fever. It also boosts immunity. It has antiviral and antibacterial action. Long pepper is again very useful against fever. It boosts liver and spleen function. It is an excellent anti
[ 921, 1609, 1220, 64, 12735, 11, 33487, 220, 10513, 198, 33, 1994, 188, 2641, 115972, 10464, 1285, 304, 3428, 1203, 6784, 11, 39074, 54397, 11, 11347, 3545, 6784, 11, 9986, 17685, 6784, 11, 22095, 6784, 323, 198, 1040, 49686, 627, 3607, 315, 74435, 198, 61612, 4460, 115972, 8605, 82, 315, 37770, 309, 5724, 320, 8605, 82, 315, 220, 605, 42393, 4529, 32399, 5738, 7489, 2648, 198, 22491, 1126, 315, 37770, 309, 5724, 320, 605, 51487, 20282, 8, 1102, 374, 2561, 304, 279, 3157, 627, 29353, 198, 16010, 27274, 6806, 198, 6806, 198, 6806, 198, 6806, 626, 1009, 198, 81450, 458, 28392, 2754, 19704, 198, 33, 63218, 477, 2678, 27274, 369, 26984, 279, 220, 188, 75, 34259, 42708, 352, 309, 198, 19235, 269, 5707, 198, 3607, 315, 5075, 45252, 42708, 352, 309, 198, 43363, 309, 47080, 374, 279, 1912, 315, 220, 605, 42393, 13, 1102, 374, 31368, 2561, 304, 51487, 10756, 13, 1102, 198, 285, 264, 10824, 315, 20282, 315, 115972, 33, 321, 6723, 1389, 362, 797, 273, 296, 2227, 301, 437, 198, 32, 5010, 40310, 23218, 1389, 12029, 3458, 65104, 2298, 460, 198, 2059, 26039, 13637, 1389, 507, 55889, 28433, 4547, 372, 198, 47, 4306, 64, 1389, 27155, 85499, 20508, 372, 924, 525, 337, 729, 198, 38, 3042, 77007, 1389, 480, 28226, 2259, 59588, 61148, 198, 33, 462, 9379, 72, 1389, 11730, 276, 372, 4547, 372, 198, 42, 519, 587, 2850, 1389, 11730, 276, 372, 865, 32329, 511, 8035, 372, 198, 38, 564, 939, 5808, 1389, 21163, 19990, 88026, 496, 285, 198, 2059, 278, 391, 1923, 72, 1389, 3959, 2658, 2411, 25893, 36324, 372, 198, 3617, 819, 7004, 1923, 72, 1389, 17229, 10649, 72829, 64, 198, 170, 223, 241, 68, 20282, 315, 37770, 309, 5724, 527, 4529, 304, 50347, 477, 220, 188, 818, 17138, 3645, 13, 101274, 223, 241, 68, 198, 76128, 374, 66185, 449, 220, 845, 3115, 3090, 304, 264, 2466, 27274, 13, 1102, 374, 66185, 3156, 220, 19, 198, 15487, 320, 18753, 8, 3090, 8625, 11, 602, 1770, 13, 11293, 311, 220, 16, 14, 19, 12472, 315, 279, 2262, 627, 46864, 369, 3187, 220, 17, 13, 20, 34419, 315, 50347, 17138, 315, 1855, 5623, 2694, 5424, 709, 311, 220, 914, 198, 51870, 374, 66185, 449, 220, 845, 3115, 602, 1770, 13, 17715, 220, 3443, 16116, 3090, 323, 11293, 311, 220, 1041, 1029, 627, 170, 223, 241, 68, 68652, 407, 8617, 10235, 374, 220, 188, 75, 34259, 1555, 264, 82743, 28392, 477, 75436, 1139, 264, 198, 65, 63218, 477, 2678, 27274, 13, 1102, 374, 1511, 304, 220, 17, 18255, 35130, 602, 1770, 13, 220, 1135, 16116, 304, 279, 6693, 198, 438, 220, 1135, 296, 3817, 279, 11714, 1603, 3691, 13, 1442, 279, 8624, 18651, 8735, 315, 198, 276, 5066, 19660, 11, 279, 12472, 315, 17138, 315, 279, 42393, 323, 3090, 374, 21801, 750, 198, 43842, 1503, 627, 3607, 323, 423, 974, 315, 86956, 198, 170, 223, 241, 68, 37770, 309, 5724, 42708, 352, 309, 374, 4529, 304, 220, 1135, 16116, 12472, 320, 72408, 398, 10235, 8, 477, 220, 605, 4235, 198, 868, 16116, 42708, 352, 309, 80703, 449, 220, 966, 4235, 1774, 16116, 8369, 3090, 320, 888, 1570, 2561, 72178, 198, 74, 1003, 352, 309, 4390, 1271, 420, 220, 20, 4235, 605, 16116, 67740, 6445, 269, 5707, 374, 3779, 627, 170, 223, 241, 68, 14293, 527, 9709, 1664, 323, 38018, 439, 21308, 15652, 627, 4599, 311, 1005, 323, 1268, 1690, 3115, 311, 1935, 5380, 170, 223, 241, 68, 10824, 4375, 1888, 994, 2728, 520, 11714, 11, 520, 3325, 459, 6596, 1603, 198, 67, 4481, 627, 8538, 1274, 2643, 617, 75431, 311, 6445, 269, 5707, 13, 101274, 223, 241, 1216, 1205, 311, 8666, 264, 198, 38083, 1603, 4560, 420, 40239, 627, 16934, 811, 198, 170, 223, 241, 68, 55986, 2643, 539, 387, 279, 13612, 40239, 369, 1203, 6784, 323, 54502, 198, 96440, 13, 1102, 374, 279, 1888, 6689, 994, 279, 3044, 374, 23900, 477, 24070, 13, 2052, 198, 16455, 2643, 539, 50134, 279, 12945, 11, 22843, 323, 477, 384, 171, 105, 222, 440, 315, 6445, 269, 5707, 627, 170, 223, 241, 285, 40239, 374, 539, 14791, 369, 1274, 449, 505, 58705, 77035, 64, 11, 16614, 477, 36366, 198, 267, 316, 613, 11, 22709, 306, 727, 11, 6520, 336, 54308, 17390, 11, 63571, 477, 61880, 13, 1187, 13, 19122, 24852, 80627, 64, 5492, 198, 6728, 9497, 369, 85001, 1628, 24062, 198, 56, 198, 32, 4382, 2162, 40239, 369, 34653, 323, 9439, 649, 387, 10235, 449, 2380, 6847, 198, 10547, 42393, 13, 101274, 223, 241, 285, 2162, 40239, 369, 9439, 323, 34653, 374, 10235, 304, 279, 1376, 315, 198, 74209, 80627, 292, 597, 1003, 352, 309, 13, 101274, 223, 241, 285, 2162, 40239, 374, 5423, 20331, 188, 16158, 422, 279, 34653, 374, 315, 198, 85, 37478, 6371, 13, 5810, 374, 279, 11944, 1749, 315, 1268, 433, 374, 10235, 627, 46847, 198, 86315, 68394, 1389, 220, 605, 34419, 345, 39, 548, 295, 14966, 320, 27588, 329, 8, 1389, 35190, 689, 3091, 65, 5724, 1389, 220, 508, 34419, 323, 198, 38, 664, 56017, 1389, 7904, 350, 15570, 71764, 320, 61887, 47162, 8, 1389, 220, 966, 34419, 627, 4438, 311, 10772, 2162, 40239, 369, 34653, 323, 9439, 5380, 7489, 2648, 17138, 315, 1521, 2380, 42393, 374, 4529, 304, 264, 4335, 7029, 11013, 291, 27274, 627, 2261, 220, 4728, 16116, 315, 3090, 1139, 279, 27274, 11, 5387, 433, 369, 220, 17, 4235, 18, 305, 11604, 627, 1255, 321, 420, 21655, 315, 42393, 323, 3090, 304, 23900, 220, 188, 265, 12222, 279, 2860, 3090, 304, 279, 198, 85, 36648, 374, 11293, 311, 13489, 220, 1049, 296, 326, 627, 6153, 24494, 12222, 1193, 220, 1049, 16116, 315, 3090, 8625, 304, 279, 27274, 11, 2231, 297, 171, 105, 222, 279, 198, 267, 1009, 11, 1935, 279, 27274, 704, 323, 220, 188, 75, 466, 279, 8970, 627, 170, 223, 241, 68, 220, 188, 75, 34259, 14812, 374, 279, 2162, 40239, 627, 4808, 936, 4065, 25, 2052, 279, 4689, 61003, 323, 5718, 315, 597, 1003, 352, 309, 3339, 1288, 198, 1395, 26549, 8272, 920, 974, 25, 220, 605, 4235, 868, 16116, 3131, 477, 11157, 304, 264, 1938, 11, 4376, 459, 6596, 1603, 3691, 627, 33, 1994, 188, 2641, 198, 170, 223, 241, 285, 597, 1003, 352, 309, 374, 36342, 1511, 304, 279, 6514, 315, 34653, 323, 9439, 627, 2181, 12992, 40368, 627, 2181, 36050, 74502, 8824, 555, 82475, 279, 56067, 304, 23152, 323, 198, 396, 478, 1572, 627, 2181, 374, 384, 171, 105, 222, 96978, 2403, 9439, 5938, 449, 34653, 627, 38, 5248, 323, 342, 321, 47162, 617, 36875, 3276, 344, 37478, 6012, 13, 32140, 420, 649, 387, 1511, 304, 198, 85, 37478, 19338, 627, 44653, 23730, 315, 420, 597, 1003, 352, 309, 369, 264, 4261, 315, 832, 2305, 374, 1633, 11190, 304, 198, 16455, 924, 171, 105, 222, 4776, 505, 65174, 34653, 323, 9439, 627, 4808, 936, 1516, 25, 1102, 374, 2731, 311, 1456, 420, 2162, 40239, 1193, 1306, 11125, 6721, 198, 329, 1805, 98566, 198, 6806, 198, 6806, 914, 13, 5492, 5031, 9497, 369, 14285, 198, 62406, 11, 55792, 17229, 2617, 323, 198, 5953, 5717, 992, 35567, 198, 56, 198, 849, 1140, 2547, 8798, 11, 20252, 4433, 2617, 11, 5552, 57056, 6784, 323, 20252, 198, 82, 42725, 304, 75818, 323, 7693, 1389, 682, 1521, 13803, 13533, 7119, 21823, 64, 627, 10254, 2972, 499, 2586, 2162, 505, 4106, 8219, 499, 1253, 1397, 264, 4382, 7172, 311, 7155, 198, 2664, 8798, 5043, 13, 5810, 374, 459, 4228, 311, 10772, 4062, 2162, 40239, 1701, 362, 1029, 64, 323, 198, 41, 16094, 727, 627, 32, 1029, 64, 304, 24852, 80627, 64, 198, 4054, 315, 279, 44797, 4668, 315, 362, 1029, 64, 374, 11, 1202, 29600, 20955, 304, 449, 1023, 198, 39220, 13, 1789, 3187, 11, 503, 16094, 727, 374, 10437, 323, 706, 21823, 64, 44463, 384, 171, 105, 222, 440, 13, 3277, 198, 9514, 3041, 503, 16094, 727, 15590, 449, 362, 1029, 64, 11, 433, 4726, 57924, 1202, 21823, 64, 44463, 198, 68, 171, 105, 222, 440, 13, 101274, 223, 241, 285, 4382, 17966, 374, 1511, 304, 279, 2768, 8776, 24852, 80627, 292, 198, 5227, 40239, 627, 3923, 499, 1205, 5380, 32, 1029, 64, 81969, 64, 320, 32, 1029, 64, 17138, 8, 1389, 220, 914, 34419, 320, 16, 961, 340, 13284, 1389, 220, 1049, 16116, 320, 23, 5596, 340, 41, 16094, 727, 1389, 220, 18, 4235, 20, 34419, 198, 34255, 198, 18293, 362, 1029, 64, 17138, 304, 264, 7029, 11013, 291, 5593, 11, 923, 3090, 311, 433, 11, 44790, 304, 23900, 198, 20559, 11, 23935, 31978, 323, 8108, 433, 311, 13489, 220, 1135, 16116, 11, 220, 188, 75, 466, 433, 11, 2187, 433, 6806, 198, 6806, 198, 6806, 198, 6806, 998, 7155, 433, 1523, 627, 18293, 220, 605, 4235, 508, 16116, 315, 420, 264, 1029, 64, 7172, 3235, 449, 220, 18, 4235, 20, 342, 436, 4214, 315, 503, 16094, 727, 17138, 627, 2181, 649, 387, 4529, 1603, 3691, 369, 7340, 384, 171, 105, 222, 440, 627, 2181, 649, 387, 4529, 3131, 477, 11157, 264, 1938, 627, 12805, 499, 10772, 433, 11, 433, 649, 387, 9967, 369, 1193, 832, 1938, 13, 60807, 11, 18254, 11, 499, 198, 17483, 311, 1304, 279, 2162, 40239, 8136, 2548, 627, 2181, 649, 387, 4529, 81226, 220, 17, 4235, 18, 5672, 369, 1695, 3135, 627, 9290, 198, 170, 223, 241, 68, 3485, 9932, 1749, 315, 50937, 264, 1029, 64, 449, 3090, 374, 42708, 352, 309, 13, 34067, 198, 543, 42708, 352, 4214, 527, 2728, 994, 814, 527, 23900, 4106, 13, 2030, 1618, 11, 584, 527, 20806, 433, 7155, 198, 2996, 11, 1603, 4737, 433, 627, 2520, 3339, 420, 2162, 40239, 11, 3060, 50347, 17138, 477, 220, 188, 818, 17138, 315, 362, 1029, 64, 198, 4919, 387, 4529, 627, 1128, 2221, 2314, 20901, 25, 9029, 449, 20335, 1253, 10936, 420, 627, 33, 1994, 188, 2641, 198, 2181, 1375, 39235, 2547, 8798, 11, 36050, 74502, 627, 2181, 374, 264, 1695, 2162, 40239, 369, 20252, 4433, 2617, 627, 2181, 374, 459, 10728, 2162, 40239, 369, 21823, 64, 627, 2746, 701, 10896, 706, 26160, 281, 46124, 10173, 311, 499, 11, 420, 2162, 40239, 369, 499, 13, 1627, 13, 21456, 2303, 24852, 80627, 64, 5492, 198, 6728, 9497, 369, 85001, 323, 198, 2127, 461, 68294, 198, 56, 198, 4599, 433, 1080, 11083, 311, 24852, 80627, 292, 16088, 369, 34653, 11, 21456, 2303, 320, 48664, 350, 15570, 71764, 8, 374, 459, 198, 49582, 25795, 13, 101274, 223, 241, 285, 40239, 374, 5423, 5505, 304, 34653, 5938, 449, 198, 105516, 315, 2802, 304, 3691, 627, 3923, 499, 1205, 5380, 98137, 2303, 1389, 480, 664, 56017, 220, 914, 34419, 1389, 50347, 14, 188, 818, 17138, 198, 29353, 1389, 220, 3443, 16116, 198, 6720, 25349, 1389, 393, 2877, 8115, 1389, 220, 17, 4235, 18, 9160, 8696, 1389, 220, 188, 818, 17138, 198, 39, 2596, 1389, 220, 16, 4235, 17, 93200, 198, 5451, 15166, 1389, 74435, 315, 480, 664, 56017, 42708, 12874, 198, 914, 29937, 82, 315, 21456, 2303, 374, 3779, 449, 220, 3443, 16116, 315, 3090, 11, 66185, 323, 11293, 311, 220, 1041, 198, 1029, 627, 16, 54808, 315, 350, 15570, 71764, 374, 3779, 449, 220, 845, 49138, 315, 3090, 11, 66185, 323, 11293, 198, 998, 220, 19, 49138, 627, 170, 223, 241, 68, 50937, 1288, 387, 2884, 304, 23900, 220, 188, 265, 11, 304, 459, 1825, 27274, 11, 449, 19815, 198, 267, 404, 12928, 627, 16041, 15166, 1271, 279, 50999, 10235, 350, 15570, 71764, 597, 1003, 12874, 11, 220, 17, 4235, 18, 9160, 8696, 315, 1317, 25349, 527, 198, 17249, 323, 75940, 1664, 627, 4438, 311, 1935, 5380, 508, 4235, 966, 16116, 315, 420, 42708, 12874, 374, 4529, 3235, 449, 832, 42384, 315, 26828, 11, 3131, 477, 198, 15930, 560, 264, 1938, 11, 220, 605, 4520, 1603, 3691, 627, 170, 223, 241, 68, 19660, 649, 387, 1524, 2697, 5190, 3196, 389, 8333, 315, 279, 8624, 323, 198, 23557, 627, 33, 1994, 188, 2641, 198, 10464, 1285, 304, 34653, 11, 21249, 34653, 323, 5938, 1280, 15505, 290, 323, 459, 461, 68294, 627, 4438, 1587, 433, 990, 5380, 51, 15570, 71764, 374, 264, 3967, 3276, 23799, 2171, 292, 39999, 315, 24852, 80627, 64, 13, 1102, 374, 13882, 1511, 304, 1690, 198, 74209, 80627, 292, 39653, 369, 34653, 13, 1102, 1101, 67232, 40368, 13, 1102, 706, 3276, 344, 37478, 323, 198, 519, 581, 71034, 1957, 627, 6720, 25349, 374, 1578, 1633, 5505, 2403, 34653, 13, 1102, 67232, 26587, 323, 87450, 268, 198, 1723, 13, 1102, 374, 459, 9250, 7294 ]
0xBreath/holistic-books
178 (From Fat 7); Fat 1g (Saturated 0g); Cholesterol 0mg; Sodium 22mg; Carbohydrate 46g (Dietary Fiber 2g); Protein 2g. Tip: You may find that adding apple in a juice produces a bit of foam. Simply give the juice a quick stir with a whisk before pouring into glasses.Chapter 12 Vegetable Juices In This Chapter Finding a vegetable juice for every meal of the day Wrapping things up with digestive and after-dinner juices Focusing on health with exercise, antioxidant, and elimination juices Partying down with mocktails and cocktail mixers Recipes in This Chapter Sunriser Beet in Motion Brassy Brassica Gingered Greens Waldorf Salad Sesame Says Me Winter Roots Smokin’ Peppers Healthy Giant Creamy Beet Seed Power Veggie Power Calcium Rules Sweet Potato Smack Tummy Tamer Aperitif Cabbage Patch Cucumber Chiller Potassium Power Exercise Elixir Anti-Aging Elixir Green Goodness Prune Power Dynamite Dandelion Vegetable Mocktail Italian Vegetable Mocktail Fiery Red Mixer Gingered Citrus Mixer Vegetables are packed with antioxidants, anti-inflammatory, and anti-cancer components, along with other high-powered nutrients that keep your body fit. Just like fruit, you need five or six servings of fresh vegetables every day, and juices are a tasty and easy way to ensure that your daily quota is met. Vegetable juices are great at breakfast, but they can supplement or substitute for a quick and nutritious lunch or light dinner. Fit them into your life and feel the energy and vitality they bring! So, how do vegetables differ from fruit? Because of their low acidity, vegetable juices offer a rainbow of goodness that you can consume any time of the day, with meals or as snacks, all day long. Proteins and fat take the longest time to be digested and move out of the stomach, but fruit is digested very quickly. For this reason, fruit is best consumed in the morning after rising or an hour or two before or after meals. If you eat fruit too close to a meal, the fruit tends to sit on top of food in the gut, causing it to putrefy and form gas. Br eakfast Juices Studies have proven that eating low-starch, high-protein breakfasts increases alertness and energy in the morning — and the positive effect actually stays with you and keeps you from craving high-calorie snacks in the afternoon and into the early evening! So, I include a protein in each of these breakfast juices so that you can start your day with a high-protein beverage and enjoy a slimmer body and at the same time, a more energetic life. In the morning, combining vegetables with some fruit can help to acclimate your taste buds to the savory side of vegetables. If your buds are already vegetable friendly, you can cut down or eliminate the fruit in these recipes, but you may like to keep them along with the hit of fructose they bring. Balancing sweet fruits with lemon and vegetables You’ll likely progress from exclusively juicing fruit to juicing some vegetables with fruit to mostly juicing veget ables. This progression is important because fruit is higher in sugar than veget ables, and vegetables help balance your body’s pH, making them the preferred juice. Early on, you should set and work toward the goal of juicing veget ables to fruit in a two-to-one ratio. You can get there by using two veget ables andone fruit in a single drink or by consuming two veget able juices for every fruit juice in a day. Fruits and fruit juices have definite advantages (their antioxidant s for one). But fruit juices, because they’re made from several whole fruits and because they aren’t bound up in the com plex carbohy drates and fiber of the whole fruit, are higher in sugars than veget able juices are, so they tend to spike blood sugar levels and increase insulin levels. One way to help you move toward a love of veget able juice is to include lemon with all juices, especially those that are exclusively fruit. Start by including a quarter lemon with the white pith intact with fruit ingredients. When you become accustomed to that amount, you can increase to one- half lemon with the white pith intact. Surprisingly, the taste isn’t puck er- tart. Instead, the lemon simply balances the cloyingly sweet flavor of all- fruit juices. S u n r i s e r Prep time: About 3 min • Juicing time: 2 min • Yield: 2 servings Ingr edients 2 oranges 1/2 lemon 1/2 red pepper, stem removed 4 carrots 2 celery stalks 1 piece (1-inch) peeled ginger 1/4 cup soy or whey protein powder Dir ections 1 Peel the oranges and lemon, leaving the white pith on.2 Cut the red pepper to fit the juicer feed tube. 3 Turn on the juicer and place a jug under the spout. 4 Working on a slow speed, process the oranges, lemon, and red pepper. 5 Increase the speed to medium and process the carrots, celery, and ginger. 6 Stir the protein powder into the drink, pour into 2 glasses and enjoy! Per serving: Calories 211 (From Fat 11); Fat 1g (Saturated 0g); Cholesterol 0mg; Sodium 223mg; Carbohydrate 39g (Dietary Fiber 4g); Protein 14g. Tip: Use whey or soy protein powder in any of the recipes in this chapter, but if you can, purchase an organic soy protein powder because non-organic soybeans are genetically modified and often are grown with a lot of herbicides. B e e t i n M o t i o n Prep time: About 3 min • Juicing time: 2 min • Yield: 2 servings Ingr edients 1 lime 3 carrots 2 celery stalks 2 apples 2 beets 1/4 cup soft tofu Dir ections 1 Peel the lime, leaving the white pith on.2 Scrub the beets and cut them if necessary to fit the juicer feed tube. 3 Cut the apples if necessary to fit the juicer feed tube. 4 Turn on the juicer and place a jug under the spout. 5 Working on a slow speed, process the lime. 6 Increase the speed to medium and process the carrots, celery, and apples. 7 Increase the speed to high and process the beets. 8 Using a fork, stir the tofu into the drink. Pour into 2 glasses and enjoy! Per serving: Calories 192 (From Fat 15); Fat 2g (Saturated 0g); Cholesterol 0mg; Sodium 153mg; Carbohydrate 45g (Dietary Fiber 4g); Protein 4g. Warning: Take it easy with beets. Raw beets have a laxative effect on your digestive system, so try one or even one-half beet in this recipe until your body adjusts. Tip: If you find that the tofu is too lumpy, pour the juice and the tofu into a blender and process to combine into a smooth and drinkable beverage. Tip: If you have beets with the green leaves attached, keep them on and juice them with the beets. B r a s s y B r a s s i c a Prep time: About 2 min • Juicing time: 2 min • Yield: 2 servings Ingr edients 1/2 lemon4 broccoli spears 1/4 green cabbage 2 apples 2 carrots 1/4 cup finely ground almonds Dir ections 1 Peel the lemon, leaving the white pith on. 2 Cut the broccoli, cabbage, and apples, if necessary to fit the juicer feed tube. 3 Turn on the juicer and place a jug under the spout. 4 Working on a slow speed, process the lemon. 5 Increase the speed to medium and process the broccoli, cabbage, apples, and carrots. 6 Stir the almonds into the drink, pour into 2 glasses, and enjoy! Per serving: Calories 443 (From Fat 128); Fat 14g (Saturated 1g); Cholesterol 0mg; Sodium 112mg; Carbohydrate 79g (Dietary Fiber 10g); Protein 13g. Tip: Use any of the Brassica plants — broccoli, cauliflower, cabbage, kale, turnip, or Brussels sprouts — in this drink. The apples and carrots sweeten the drink naturally, but for sensitive palates, add a teaspoon of honey. Note: Using cruciferous vegetables like broccoli, cabbage, Brussels sprouts, and cauliflower will make a slightly sulfurous and, therefore, “stinky” juice, but this is the active healing ingredients at work. G i n g e r e d G r e e n sPrep time: About 3 min • Juicing time: 2
[ 220, 11256, 320, 3915, 26417, 220, 22, 1237, 26417, 220, 16, 70, 320, 50, 35467, 220, 15, 70, 1237, 921, 35244, 220, 15, 12591, 26, 83541, 220, 1313, 12591, 280, 9028, 34658, 349, 220, 2790, 70, 320, 35, 3978, 661, 54727, 220, 17, 70, 1237, 49475, 220, 17, 70, 627, 16394, 25, 1472, 1253, 33595, 71831, 303, 430, 7999, 24149, 304, 264, 23661, 19159, 264, 2766, 315, 198, 831, 309, 13, 29524, 3041, 279, 23661, 264, 4062, 23935, 449, 264, 41759, 1603, 198, 55619, 287, 1139, 29247, 6487, 2943, 220, 717, 198, 43712, 456, 481, 22410, 1238, 198, 644, 1115, 15957, 198, 43897, 264, 36581, 23661, 369, 1475, 15496, 315, 279, 1938, 198, 32730, 3713, 2574, 709, 449, 60071, 323, 1306, 1773, 4481, 65959, 198, 435, 87595, 389, 2890, 449, 10368, 11, 70339, 11, 323, 198, 40895, 2617, 65959, 198, 3744, 7169, 1523, 449, 8018, 41060, 323, 41010, 6651, 388, 198, 70953, 304, 1115, 15957, 198, 8219, 6091, 261, 198, 75049, 304, 27660, 198, 3320, 27801, 59129, 3074, 198, 68394, 291, 42691, 198, 51668, 33942, 64646, 198, 64027, 373, 47559, 2206, 198, 20704, 75687, 198, 4487, 79117, 529, 5250, 36623, 198, 44454, 41841, 198, 30800, 88, 75049, 198, 36922, 7572, 198, 91013, 22235, 7572, 198, 96104, 23694, 198, 27687, 78703, 4487, 474, 198, 350, 8742, 350, 15589, 362, 716, 275, 333, 198, 356, 57589, 31512, 198, 356, 42012, 921, 15610, 198, 14020, 49163, 7572, 198, 33918, 469, 98872, 198, 23853, 6830, 3252, 469, 98872, 198, 7997, 7839, 2136, 198, 2394, 2957, 7572, 198, 33593, 635, 423, 38221, 290, 198, 95392, 14905, 14928, 198, 15155, 95392, 14905, 14928, 198, 40971, 727, 3816, 72392, 198, 68394, 291, 18002, 20962, 72392, 198, 43712, 456, 4893, 527, 19937, 449, 81115, 11, 7294, 3502, 171, 120912, 8836, 5382, 11, 323, 198, 15719, 1824, 11967, 6956, 11, 3235, 449, 1023, 1579, 41503, 198, 24217, 32930, 430, 2567, 701, 2547, 33595, 71831, 83, 13, 4702, 1093, 14098, 11, 499, 1205, 33595, 71831, 588, 477, 198, 51464, 79049, 315, 7878, 24822, 1475, 1938, 11, 323, 65959, 527, 264, 39953, 198, 438, 4228, 1648, 311, 6106, 430, 701, 7446, 43142, 374, 2322, 13, 95392, 198, 8783, 1238, 527, 2294, 520, 17954, 11, 719, 814, 649, 22822, 477, 198, 2008, 7815, 369, 264, 4062, 323, 78216, 16163, 477, 3177, 14177, 13, 30990, 198, 49818, 1139, 701, 2324, 323, 2733, 279, 4907, 323, 75716, 814, 4546, 4999, 4516, 11, 1268, 656, 24822, 1782, 505, 14098, 30, 9393, 315, 872, 3428, 198, 582, 19025, 11, 36581, 65959, 3085, 264, 48713, 315, 39526, 430, 499, 198, 4919, 25024, 904, 892, 315, 279, 1938, 11, 449, 21644, 477, 439, 43402, 11, 682, 198, 1316, 1317, 13, 15542, 1354, 323, 8834, 1935, 279, 22807, 892, 311, 387, 4170, 10185, 323, 198, 3479, 704, 315, 279, 23152, 11, 719, 14098, 374, 4170, 10185, 1633, 6288, 627, 2520, 420, 2944, 11, 14098, 374, 1888, 27073, 304, 279, 6693, 1306, 198, 60023, 477, 459, 6596, 477, 1403, 1603, 477, 1306, 21644, 13, 1442, 499, 8343, 198, 36698, 2288, 3345, 311, 264, 15496, 11, 279, 14098, 28335, 311, 2503, 389, 1948, 315, 3691, 198, 258, 279, 18340, 11, 14718, 433, 311, 2231, 1116, 88, 323, 1376, 6962, 627, 6971, 384, 587, 9533, 22410, 1238, 198, 94607, 617, 17033, 430, 12459, 3428, 5594, 1132, 11, 1579, 10039, 39340, 198, 9137, 9533, 82, 12992, 5225, 2136, 323, 4907, 304, 279, 6693, 2001, 323, 198, 1820, 6928, 2515, 3604, 27656, 449, 499, 323, 13912, 499, 505, 198, 5192, 2370, 1579, 49236, 30303, 43402, 304, 279, 13658, 323, 1139, 279, 4216, 198, 17206, 287, 0, 2100, 11, 358, 2997, 264, 13128, 304, 1855, 315, 1521, 17954, 65959, 198, 708, 430, 499, 649, 1212, 701, 1938, 449, 264, 1579, 10039, 39340, 43450, 323, 198, 268, 4215, 264, 1776, 19519, 2547, 323, 520, 279, 1890, 892, 11, 264, 810, 45955, 198, 14789, 627, 644, 279, 6693, 11, 35271, 24822, 449, 1063, 14098, 649, 1520, 198, 998, 1645, 94874, 701, 12945, 68543, 311, 279, 94760, 3185, 315, 24822, 13, 1442, 198, 22479, 68543, 527, 2736, 36581, 11919, 11, 499, 649, 4018, 1523, 477, 198, 40895, 3357, 279, 14098, 304, 1521, 19141, 11, 719, 499, 1253, 1093, 311, 2567, 198, 49818, 3235, 449, 279, 4295, 315, 1448, 87873, 814, 4546, 627, 38989, 9151, 10437, 26390, 449, 30564, 323, 198, 83571, 4893, 198, 2675, 4805, 4461, 5208, 505, 24121, 10479, 10332, 14098, 311, 10479, 10332, 1063, 198, 83571, 4893, 449, 14098, 311, 10213, 10479, 10332, 13294, 671, 645, 13, 1115, 33824, 374, 198, 15693, 1606, 14098, 374, 5190, 304, 13465, 220, 1109, 13294, 671, 645, 11, 323, 198, 83571, 4893, 1520, 8335, 701, 2547, 753, 37143, 11, 3339, 1124, 220, 279, 15236, 23661, 627, 42298, 389, 11, 499, 1288, 743, 323, 990, 9017, 279, 5915, 220, 315, 10479, 10332, 13294, 671, 645, 311, 198, 36698, 304, 264, 1403, 4791, 19101, 11595, 13, 1472, 649, 636, 1070, 555, 1701, 1403, 13294, 671, 645, 323, 606, 14098, 304, 264, 3254, 7172, 477, 555, 35208, 1403, 13294, 3025, 65959, 369, 1475, 198, 36698, 23661, 304, 264, 1938, 627, 37, 68998, 323, 14098, 65959, 617, 409, 171, 71831, 62664, 22934, 220, 320, 50828, 70339, 274, 369, 198, 606, 570, 2030, 14098, 65959, 11, 1606, 814, 3207, 1903, 505, 3892, 4459, 26390, 323, 198, 28753, 814, 7784, 1431, 6965, 709, 304, 279, 470, 281, 2635, 1841, 754, 8671, 1377, 988, 323, 33595, 71831, 655, 220, 315, 198, 1820, 4459, 14098, 11, 527, 5190, 304, 70913, 1109, 13294, 3025, 65959, 527, 11, 779, 814, 198, 83, 408, 311, 37393, 6680, 13465, 5990, 323, 5376, 32152, 5990, 627, 4054, 1648, 311, 1520, 499, 3351, 9017, 264, 3021, 315, 13294, 3025, 23661, 374, 311, 2997, 198, 273, 1677, 449, 682, 65959, 11, 5423, 1884, 430, 527, 24121, 14098, 13, 5256, 555, 198, 16564, 264, 8502, 30564, 449, 279, 4251, 281, 411, 35539, 449, 14098, 14293, 627, 4599, 499, 3719, 53184, 311, 430, 3392, 1174, 499, 649, 5376, 311, 832, 7058, 38106, 30564, 449, 279, 4251, 281, 411, 35539, 13, 8242, 49264, 11, 279, 12945, 4536, 1431, 49735, 2781, 7058, 83, 472, 13, 12361, 11, 279, 30564, 5042, 39954, 220, 279, 272, 2032, 11559, 10437, 33595, 120912, 3372, 315, 682, 7058, 36698, 65959, 627, 50, 577, 308, 436, 602, 274, 384, 436, 198, 4808, 79, 892, 25, 10180, 220, 18, 1332, 7436, 22410, 10332, 892, 25, 220, 17, 1332, 7436, 78478, 25, 220, 17, 79049, 198, 644, 911, 1608, 4167, 198, 17, 85138, 198, 16, 14, 17, 30564, 198, 16, 14, 17, 2579, 25349, 11, 19646, 7108, 198, 19, 62517, 198, 17, 70121, 55972, 82, 198, 16, 6710, 320, 16, 25224, 8, 83612, 44768, 198, 16, 14, 19, 10747, 29839, 477, 15240, 88, 13128, 17138, 198, 6315, 384, 5247, 198, 16, 89694, 279, 85138, 323, 30564, 11, 9564, 279, 4251, 281, 411, 389, 13, 17, 20223, 279, 2579, 25349, 311, 33595, 71831, 83, 279, 10479, 13296, 5510, 14019, 627, 18, 12268, 389, 279, 10479, 13296, 323, 2035, 264, 23200, 1234, 279, 993, 412, 627, 19, 22938, 389, 264, 6435, 4732, 11, 1920, 279, 85138, 11, 30564, 11, 323, 2579, 198, 375, 7067, 627, 20, 40733, 279, 4732, 311, 11298, 323, 1920, 279, 62517, 11, 70121, 345, 438, 44768, 627, 21, 65292, 279, 13128, 17138, 1139, 279, 7172, 11, 5019, 1139, 220, 17, 29247, 323, 198, 268, 4215, 4999, 3976, 13788, 25, 84037, 220, 11483, 320, 3915, 26417, 220, 806, 1237, 26417, 220, 16, 70, 320, 50, 35467, 220, 15, 70, 1237, 921, 35244, 220, 15, 12591, 26, 83541, 220, 12533, 12591, 280, 9028, 34658, 349, 220, 2137, 70, 320, 35, 3978, 661, 54727, 220, 19, 70, 1237, 49475, 220, 975, 70, 627, 16394, 25, 5560, 15240, 88, 477, 29839, 13128, 17138, 304, 904, 315, 279, 19141, 304, 420, 198, 41326, 11, 719, 422, 499, 649, 11, 7782, 459, 17808, 29839, 13128, 17138, 198, 28753, 2536, 12, 61694, 29839, 28440, 527, 52033, 1491, 72, 171, 71831, 291, 323, 3629, 198, 548, 15042, 449, 264, 2763, 315, 39999, 76195, 627, 33, 384, 384, 259, 220, 602, 308, 220, 386, 297, 259, 602, 297, 308, 198, 4808, 79, 892, 25, 10180, 220, 18, 1332, 7436, 22410, 10332, 892, 25, 220, 17, 1332, 7436, 78478, 25, 220, 17, 79049, 198, 644, 911, 1608, 4167, 198, 16, 42819, 198, 18, 62517, 198, 17, 70121, 55972, 82, 198, 17, 41776, 198, 17, 387, 1441, 198, 16, 14, 19, 10747, 8579, 80247, 198, 6315, 384, 5247, 198, 16, 89694, 279, 42819, 11, 9564, 279, 4251, 281, 411, 389, 13, 17, 33234, 392, 279, 387, 1441, 323, 4018, 1124, 422, 5995, 311, 33595, 71831, 83, 279, 10479, 13296, 5510, 198, 74838, 627, 18, 20223, 279, 41776, 422, 5995, 311, 33595, 71831, 83, 279, 10479, 13296, 5510, 14019, 627, 19, 12268, 389, 279, 10479, 13296, 323, 2035, 264, 23200, 1234, 279, 993, 412, 627, 20, 22938, 389, 264, 6435, 4732, 11, 1920, 279, 42819, 627, 21, 40733, 279, 4732, 311, 11298, 323, 1920, 279, 62517, 11, 70121, 345, 438, 41776, 627, 22, 40733, 279, 4732, 311, 1579, 323, 1920, 279, 387, 1441, 627, 23, 12362, 264, 23243, 11, 23935, 279, 80247, 1139, 279, 7172, 13, 27058, 1139, 220, 17, 29247, 323, 198, 268, 4215, 4999, 3976, 13788, 25, 84037, 220, 5926, 320, 3915, 26417, 220, 868, 1237, 26417, 220, 17, 70, 320, 50, 35467, 220, 15, 70, 1237, 921, 35244, 220, 15, 12591, 26, 83541, 220, 9800, 12591, 280, 9028, 34658, 349, 220, 1774, 70, 320, 35, 3978, 661, 54727, 220, 19, 70, 1237, 49475, 220, 19, 70, 627, 12358, 25, 12040, 433, 4228, 449, 387, 1441, 13, 23886, 387, 1441, 617, 264, 74830, 1413, 198, 27153, 389, 701, 60071, 1887, 11, 779, 1456, 832, 477, 1524, 832, 34902, 49112, 304, 198, 576, 11363, 3156, 701, 2547, 84431, 627, 16394, 25, 1442, 499, 33595, 71831, 303, 430, 279, 80247, 374, 2288, 326, 6895, 11, 5019, 279, 23661, 323, 279, 198, 998, 33721, 1139, 264, 62895, 323, 1920, 311, 16343, 1139, 264, 11113, 323, 198, 98427, 481, 43450, 627, 16394, 25, 1442, 499, 617, 387, 1441, 449, 279, 6307, 11141, 12673, 11, 2567, 1124, 198, 263, 323, 23661, 1124, 449, 279, 387, 1441, 627, 33, 436, 264, 274, 274, 379, 220, 426, 436, 264, 274, 274, 602, 272, 264, 198, 4808, 79, 892, 25, 10180, 220, 17, 1332, 7436, 22410, 10332, 892, 25, 220, 17, 1332, 7436, 78478, 25, 220, 17, 79049, 198, 644, 911, 1608, 4167, 198, 16, 14, 17, 30564, 19, 79276, 2395, 1590, 198, 16, 14, 19, 6307, 74873, 198, 17, 41776, 198, 17, 62517, 198, 16, 14, 19, 10747, 33595, 71831, 77, 989, 5015, 88922, 198, 6315, 384, 5247, 198, 16, 89694, 279, 30564, 11, 9564, 279, 4251, 281, 411, 389, 627, 17, 20223, 279, 79276, 11, 74873, 11, 323, 41776, 11, 422, 5995, 311, 33595, 71831, 83, 279, 198, 8783, 13296, 5510, 14019, 627, 18, 12268, 389, 279, 10479, 13296, 323, 2035, 264, 23200, 1234, 279, 993, 412, 627, 19, 22938, 389, 264, 6435, 4732, 11, 1920, 279, 30564, 627, 20, 40733, 279, 4732, 311, 11298, 323, 1920, 279, 79276, 345, 66, 57589, 11, 41776, 11, 323, 62517, 627, 21, 65292, 279, 88922, 1139, 279, 7172, 11, 5019, 1139, 220, 17, 29247, 11, 323, 4774, 4999, 3976, 13788, 25, 84037, 220, 17147, 320, 3915, 26417, 220, 4386, 1237, 26417, 220, 975, 70, 320, 50, 35467, 220, 16, 70, 1237, 921, 35244, 220, 15, 12591, 26, 83541, 220, 7261, 12591, 280, 9028, 34658, 349, 220, 4643, 70, 320, 35, 3978, 661, 54727, 220, 605, 70, 1237, 49475, 220, 1032, 70, 627, 16394, 25, 5560, 904, 315, 279, 59129, 3074, 11012, 2001, 79276, 11, 2211, 24520, 171, 120912, 1223, 345, 66, 57589, 11, 63577, 11, 2543, 575, 11, 477, 38269, 8314, 11934, 2001, 304, 420, 7172, 13, 578, 198, 680, 645, 323, 62517, 10437, 268, 279, 7172, 18182, 11, 719, 369, 16614, 198, 19866, 988, 11, 923, 264, 42384, 315, 26828, 627, 9290, 25, 12362, 15131, 11691, 788, 24822, 1093, 79276, 11, 74873, 11, 38269, 198, 52773, 11934, 11, 323, 2211, 24520, 171, 120912, 1223, 690, 1304, 264, 10284, 40769, 55709, 323, 345, 19041, 1348, 11, 1054, 267, 39134, 863, 23661, 11, 719, 420, 374, 279, 4642, 21730, 14293, 198, 266, 990, 627, 38, 602, 308, 342, 384, 436, 384, 294, 220, 480, 436, 384, 384, 308, 274, 4808, 79, 892, 25, 10180, 220, 18, 1332, 7436, 22410, 10332, 892, 25, 220, 17 ]
0xBreath/holistic-books
265 foot-roller technique 164 foot sequences 90, 91, 121 golf-ball technique 173, 177 hand sequences 132, 133, 161 maps 26, 31, 264, 337 self-help sequences 121, 161 glands see endocrine system; specific glands (eg prostate); specific reflex areas (eg adrenal gland reflex areas) golf-ball techniques feet 162, 166-7 hands 162, 168, 169, 170-5, 176-7 health concerns see specific health concerns (eg headaches) men 244-5 pregnant women 57, 238 reflexology lifestyle 52, 53 respiratory system 282 senior citizens 223, 228, 229348 INDexgripping golf-ball technique 169 multiple finger grip 281, 308 groin reflex areas children 213 foot self-help sequences 116, 117, 120 foot sequences 98, 99, 106 hand self-help sequences 156, 157, 161 hand sequences 136, 137, 140 hernia 247 impotence 246 maps 28, 29, 32, 33, 343 gums reflex areas see teeth/gums/jaw reflex areas Hair growth, stimulating 247 hand desserts children 214 hand relaxer workouts 316-19, 322-5 mini-sessions 196-7, 199, 251 rejuvenation 291 senior citizens 222 techniques 122-5, 142-5 use in sessions see hand workouts; specific desserts (eg finger-pull) hand maps & charts 24, 30-3 body system charts see specific body systems (eg cardiovascular system) hand problems 220, 326-9 hand rejuvenation 20, 44, 290-1, 314-25 hand relaxation exercises 180-1 hand-stretcher hand relaxer workout 316, 318, 319 left hand sequence 138, 139, 141 relaxation mini-sessions 197 right hand sequence 126, 127, 129, 131, 133, 135, 137 technique 124 hand tools 52, 57, 168-9, 202, 230 see also golf-ball techniques hand workouts babies 205-6 children 214-15 golf-ball self-help sequences 170-5, 176-7 health concerns see specific health concerns (eg headaches) mini-sessions 183-99 relaxer workouts 316-19, 322-5 self-help sequences 146-57, 158-61 self-help tools 168-9, 202, 230 sequences 126-37, 138-41 hands awareness & health 19, 44-5, 62-5, 290-1 ergonomics 64-5 fingernail length 69 pressure sensors & signals 8, 13, 19, 20, 291 skin care 62 spa treatments 62 hay fever see allergies head/brain reflex areas Alzheimer’s disease & dementia 226, 227, 278 babies 203 cerebral palsy 278 children 210, 215 epilepsy 278 foot maps 26, 27, 28, 29, 332 foot-roller technique 163 foot self-help sequences 108, 109, 121 foot sequences 84, 85, 102, 103, 107 golf-ball technique 167, 170, 175, 177, 286 hand maps 30, 31, 32, 33, 276, 332 hand self-help sequences 146, 147, 154, 155, 159, 161, 227 hand sequences 126, 127, 134, 135, 138- 9, 140 headaches & head pain 189, 252, 253 incontinence 286 insomnia 257 nervous system 276, 277 paralysis 279 Parkinson’s disease 279 pregnant women 241 stroke 278 see also nail-buffing headaches & head pain 48, 54, 189, 252, 252-3 health benefits 40, 46, 50-1, 54-7 relaxation response 13, 20, 42, 56 see also specific health concerns (eg headaches) health concerns 192-3, 249-51 babies 207 men 242-7 mini-session example 193 pregnant women 238-41 senior citizens 222-9 stress-related 20 teenagers 216-21 women 184, 231, 234-41 see also specific body systems (eg digestive system); specific health concerns (eg headaches) health pathways 48, 55, 58, 59, 222, 302-5, 311 hearing impairments 50, 227 heart attack 260, 263 heart failure, congestive 260, 262 heart reflex areas angina pectoris 263 arrhythmia 262 babies 203 cardiovascular system 260, 261 congestive heart failure 262 foot maps 26, 27, 260, 335 foot-roller technique 245 foot self-help sequences 111, 120 foot sequences 88, 89, 103 golf-ball technique 170, 172, 177 hand maps 30, 31, 260, 335 hand self-help sequences 150, 151, 158 hand sequences 130, 131 heart attack 263 high blood pressure 262 stress 244, 245 heartburn 266 hemorrhoids 267 hernias 247, 266 herpes zoster infection (shingles) 258 hiatus hernia 266 high blood pressure 260, 262 high cholesterol 255 hip reflex areas foot self-help sequences 118, 119, 121 foot sequences 100, 101, 107 golf-ball technique 173 lower backache 240 maps 29, 32, 33, 272, 342 musculoskeletal system 272, 273 skeletal reflex areas 35 hook & back-up 76-7 hormones 268, 284 see also specific hormones (eg adrenaline) hypoglycemia 251, 271 hypothalamus 276 IBS (irritable bowel syndrome) 266 ileocecal valve reflex areas 26, 31, 92, 93, 264 immune system 193 impotence 55, 246 incontinence 228, 286 infants see babies infertility 234-5 inflammation 254 injuries 25, 57, 62, 70, 186-7, 190-1 see also specific injuries (eg ankle sprain) inner ear reflex areas babies 203, 205 children 210, 211, 215 dizziness 255 foot self-help sequences 110, 111, 120 foot sequences 86, 87, 102, 103 golf-ball technique 170 hand self-help sequences 150, 151, 159 hand sequences 131, 140 hearing impairment 227 maps 26, 27, 30, 31 insomnia 257 irregular heartbeat (arrhythmia ) 260, 262 irritable bowel syndrome 266 Keyboarding problems 220, 291, 328 prevention 63, 64-5, 180-1, 216, 329 kidney infections & problems 54, 286, 287 kidney reflex areas acne 218 arthritis 223 babies 204 bladder problems 193, 286, 287 children 211, 215 diabetes & hypoglycemia 271 digestive system 265 fluid retention 239INDex 349 foot maps 26, 27, 28, 29, 286, 339 foot self-help sequences 112, 113, 121 foot sequences 90, 91, 104 golf-ball technique 171, 176 hand maps 30, 31, 286, 339 hand self-help sequences 148, 149, 159 hand sequences 128, 129, 138 kidney infections 286, 287 pregnant women 238, 239 psoriasis 257 senior citizens 222, 223 swollen feet 301 urinary system 286, 287 knee reflex areas foot maps 28, 29, 272, 341 foot self-help sequences 118, 119, 121 foot sequences 100, 101, 106 hand maps 32, 33, 272, 341 musculoskeletal system 272, 273 Lateral markers 21, 22-4 leg reflex areas foot maps 28, 29, 272, 341 foot self-help sequences 118, 119, 121 foot sequences 100, 101, 106 hand
[ 14374, 198, 4579, 12, 1496, 15105, 220, 10513, 198, 4579, 24630, 220, 1954, 11, 220, 5925, 11, 220, 7994, 198, 19665, 68302, 15105, 220, 11908, 11, 220, 11242, 198, 1450, 24630, 220, 9413, 11, 220, 9423, 11, 220, 10718, 198, 14370, 220, 1627, 11, 220, 2148, 11, 220, 12815, 11, 220, 17609, 198, 659, 50570, 24630, 220, 7994, 11, 220, 10718, 198, 70, 8329, 1518, 842, 78738, 1887, 26, 3230, 2355, 82375, 320, 797, 47447, 1237, 3230, 33766, 2355, 220, 5789, 320, 797, 60564, 67169, 33766, 5789, 340, 70, 8255, 68302, 12823, 7693, 220, 10674, 11, 220, 11247, 12, 22, 198, 6206, 220, 10674, 11, 220, 8953, 11, 220, 11739, 11, 220, 8258, 12, 20, 11, 220, 10967, 12, 22, 198, 2890, 10742, 720, 4151, 3230, 2890, 2355, 220, 10742, 320, 797, 55403, 340, 3026, 220, 13719, 12, 20, 198, 20895, 3278, 220, 3226, 11, 220, 13895, 198, 33766, 2508, 19433, 220, 4103, 11, 220, 4331, 198, 42631, 1887, 220, 16544, 198, 10195, 10495, 220, 12533, 11, 220, 14261, 11, 220, 14378, 19746, 19877, 327, 70, 462, 10964, 198, 19665, 68302, 15105, 220, 11739, 198, 5361, 14654, 25703, 220, 15282, 11, 220, 14498, 198, 42511, 258, 33766, 5789, 2911, 220, 11702, 198, 4579, 659, 50570, 24630, 220, 8027, 11, 220, 8546, 11, 220, 4364, 198, 4579, 24630, 220, 3264, 11, 220, 1484, 11, 220, 7461, 198, 1450, 659, 50570, 24630, 220, 10132, 11, 220, 10895, 11, 220, 10718, 198, 1450, 24630, 220, 9795, 11, 220, 10148, 11, 220, 6860, 198, 72909, 689, 220, 14125, 198, 3242, 98660, 220, 14205, 198, 14370, 220, 1591, 11, 220, 1682, 11, 220, 843, 11, 220, 1644, 11, 220, 16522, 198, 70, 6370, 33766, 5789, 1518, 18311, 4951, 6370, 4537, 675, 2355, 33766, 5789, 198, 70793, 6650, 11, 65792, 220, 14125, 198, 10888, 72513, 2911, 220, 11584, 198, 1450, 12234, 261, 46944, 220, 15340, 12, 777, 11, 220, 15805, 12, 20, 198, 13726, 1355, 8719, 220, 5162, 12, 22, 11, 220, 2550, 11, 220, 13860, 198, 73484, 367, 220, 17335, 198, 10195, 10495, 220, 9716, 198, 12823, 220, 8259, 12, 20, 11, 220, 10239, 12, 20, 198, 1005, 304, 16079, 720, 4151, 1450, 46944, 26, 2355, 220, 3230, 72513, 320, 797, 14654, 2320, 620, 340, 10888, 14370, 612, 27223, 220, 1187, 11, 220, 966, 12, 18, 2547, 1887, 27223, 720, 4151, 3230, 2547, 2355, 220, 6067, 320, 797, 41713, 1887, 340, 10888, 5435, 220, 8610, 11, 220, 17470, 12, 24, 198, 10888, 73484, 367, 220, 508, 11, 220, 2096, 11, 220, 13754, 12, 16, 11, 220, 16104, 12, 914, 198, 10888, 43685, 23783, 220, 5245, 12, 16, 198, 10888, 5594, 2171, 9211, 1450, 12234, 261, 26308, 220, 15340, 11, 220, 17592, 11, 220, 16874, 198, 2163, 1450, 8668, 220, 10350, 11, 220, 10125, 11, 220, 9335, 198, 43685, 13726, 1355, 8719, 220, 4468, 198, 1314, 1450, 8668, 220, 9390, 11, 220, 6804, 11, 220, 9748, 11, 220, 9263, 11, 2355, 220, 220, 9423, 11, 220, 8878, 11, 220, 10148, 198, 15105, 220, 8874, 198, 10888, 7526, 220, 4103, 11, 220, 3226, 11, 220, 8953, 12, 24, 11, 220, 2366, 11, 220, 9870, 198, 1518, 1101, 220, 19665, 68302, 12823, 198, 10888, 46944, 24869, 220, 10866, 12, 21, 198, 2911, 220, 11584, 12, 868, 198, 19665, 68302, 659, 50570, 24630, 220, 8258, 12, 20, 11, 220, 10967, 12, 22, 198, 2890, 10742, 1518, 3230, 2890, 2355, 220, 10742, 320, 797, 55403, 340, 13726, 1355, 8719, 220, 10750, 12, 1484, 198, 12234, 261, 46944, 220, 15340, 12, 777, 11, 220, 15805, 12, 20, 198, 659, 50570, 24630, 220, 10465, 12, 3226, 11, 220, 11286, 12, 5547, 198, 659, 50570, 7526, 220, 8953, 12, 24, 11, 220, 2366, 11, 220, 9870, 198, 24630, 220, 9390, 12, 1806, 11, 220, 10350, 12, 3174, 198, 89112, 17985, 612, 2890, 220, 777, 11, 220, 2096, 12, 20, 11, 220, 5538, 12, 20, 11, 220, 13754, 12, 16, 198, 36376, 14609, 1233, 220, 1227, 12, 20, 198, 39827, 944, 607, 3160, 220, 3076, 198, 7410, 26148, 612, 17738, 220, 23, 11, 220, 1032, 11, 220, 777, 11, 220, 508, 11, 2355, 220, 220, 17335, 198, 6930, 2512, 220, 5538, 198, 31493, 22972, 220, 5538, 198, 68412, 34653, 1518, 58742, 198, 2025, 14, 54160, 33766, 5789, 44531, 753, 8624, 612, 52857, 220, 14057, 11, 262, 220, 14206, 11, 220, 16949, 198, 24869, 220, 9639, 198, 60745, 281, 60384, 220, 16949, 198, 2911, 220, 8848, 11, 220, 12112, 198, 70655, 220, 16949, 198, 4579, 14370, 220, 1627, 11, 220, 1544, 11, 220, 1591, 11, 220, 1682, 11, 220, 17079, 198, 4579, 12, 1496, 15105, 220, 9892, 198, 4579, 659, 50570, 24630, 220, 6640, 11, 220, 7743, 11, 220, 7994, 198, 4579, 24630, 220, 5833, 11, 220, 5313, 11, 220, 4278, 11, 220, 6889, 11, 220, 7699, 198, 19665, 68302, 15105, 220, 11515, 11, 220, 8258, 11, 220, 10005, 11, 220, 11242, 11, 220, 17361, 198, 1450, 14370, 220, 966, 11, 220, 2148, 11, 220, 843, 11, 220, 1644, 11, 220, 16660, 11, 220, 17079, 198, 1450, 659, 50570, 24630, 220, 10465, 11, 220, 10288, 11, 220, 10559, 11, 2355, 220, 220, 9992, 11, 220, 11068, 11, 220, 10718, 11, 220, 14206, 198, 1450, 24630, 220, 9390, 11, 220, 6804, 11, 220, 9565, 11, 220, 8878, 11, 220, 10350, 12, 720, 220, 220, 24, 11, 220, 6860, 198, 55403, 612, 2010, 6784, 220, 9378, 11, 220, 12326, 11, 220, 14022, 198, 304, 22025, 768, 220, 17361, 198, 83511, 220, 15574, 198, 23418, 1887, 220, 16660, 11, 220, 16367, 198, 86139, 220, 17267, 198, 62145, 753, 8624, 220, 17267, 198, 20895, 3278, 220, 13341, 198, 12943, 220, 16949, 198, 1518, 1101, 220, 32095, 1481, 1386, 287, 198, 2025, 14576, 612, 2010, 6784, 220, 2166, 11, 220, 4370, 11, 220, 9378, 11, 220, 12326, 11, 2355, 220, 12326, 12, 18, 198, 12393, 7720, 220, 1272, 11, 220, 2790, 11, 220, 1135, 12, 16, 11, 220, 4370, 12, 22, 198, 43685, 2077, 220, 1032, 11, 220, 508, 11, 220, 2983, 11, 220, 3487, 198, 1518, 1101, 220, 3230, 2890, 10742, 320, 797, 2355, 220, 55403, 340, 12393, 10742, 220, 5926, 12, 18, 11, 220, 14735, 12, 3971, 24869, 220, 12060, 198, 3026, 220, 12754, 12, 22, 198, 13726, 58281, 3187, 220, 7285, 198, 20895, 3278, 220, 13895, 12, 3174, 198, 10195, 10495, 220, 9716, 12, 24, 198, 8631, 14228, 220, 508, 198, 37719, 220, 12463, 12, 1691, 198, 3278, 220, 10336, 11, 220, 12245, 11, 220, 11727, 12, 3174, 198, 1518, 1101, 220, 3230, 2547, 6067, 320, 797, 5996, 60071, 1887, 1237, 3230, 2890, 5996, 10742, 320, 797, 55403, 340, 12393, 44014, 220, 2166, 11, 220, 2131, 11, 220, 2970, 11, 220, 2946, 11, 220, 9716, 11, 220, 13121, 12, 20, 11, 2355, 220, 15134, 198, 383, 3329, 38974, 1392, 220, 1135, 11, 220, 14206, 198, 18207, 3440, 220, 11387, 11, 220, 15666, 198, 18207, 8060, 11, 44385, 535, 220, 11387, 11, 220, 14274, 198, 18207, 33766, 5789, 198, 6590, 2259, 281, 1279, 285, 220, 15666, 198, 2961, 61254, 689, 220, 14274, 198, 24869, 220, 9639, 198, 41713, 1887, 220, 11387, 11, 220, 15602, 198, 44385, 535, 4851, 8060, 220, 14274, 198, 4579, 14370, 220, 1627, 11, 220, 1544, 11, 220, 11387, 11, 220, 16596, 198, 4579, 12, 1496, 15105, 220, 13078, 198, 4579, 659, 50570, 24630, 220, 5037, 11, 220, 4364, 198, 4579, 24630, 220, 2421, 11, 220, 4578, 11, 220, 6889, 198, 19665, 68302, 15105, 220, 8258, 11, 220, 10861, 11, 220, 11242, 198, 1450, 14370, 220, 966, 11, 220, 2148, 11, 220, 11387, 11, 220, 16596, 198, 1450, 659, 50570, 24630, 220, 3965, 11, 220, 9690, 11, 220, 11286, 198, 1450, 24630, 220, 5894, 11, 220, 9263, 198, 4851, 3440, 220, 15666, 1579, 6680, 7410, 220, 14274, 198, 8631, 220, 13719, 11, 220, 13078, 198, 18207, 22464, 220, 15999, 198, 30132, 54308, 17390, 220, 16567, 198, 71, 944, 3557, 220, 14125, 11, 220, 15999, 198, 1964, 20975, 1167, 11975, 19405, 320, 939, 50703, 8, 220, 15966, 198, 6151, 1015, 72909, 689, 220, 15999, 198, 12156, 6680, 7410, 220, 11387, 11, 220, 14274, 198, 12156, 39086, 220, 3192, 198, 2200, 33766, 5789, 4579, 659, 50570, 24630, 220, 8899, 11, 220, 9079, 11, 220, 7994, 198, 4579, 24630, 220, 1041, 11, 220, 4645, 11, 220, 7699, 198, 19665, 68302, 15105, 220, 11908, 198, 4827, 1203, 1815, 220, 8273, 198, 14370, 220, 1682, 11, 220, 843, 11, 220, 1644, 11, 220, 15741, 11, 220, 17590, 198, 3167, 79134, 86255, 1887, 220, 15741, 11, 220, 15451, 198, 69397, 33766, 5789, 220, 1758, 198, 21543, 612, 1203, 5352, 220, 4767, 12, 22, 198, 71, 494, 3233, 220, 16332, 11, 220, 17058, 198, 1518, 1101, 220, 3230, 44315, 320, 797, 5996, 79492, 340, 79343, 540, 398, 66, 22689, 220, 13860, 11, 220, 15828, 198, 79343, 8942, 17243, 355, 220, 16660, 198, 3336, 50, 320, 404, 23349, 66358, 28439, 8, 220, 15999, 198, 458, 81656, 5531, 32530, 33766, 5789, 220, 1627, 11, 220, 2148, 11, 220, 6083, 11, 220, 6365, 11, 2355, 220, 12815, 198, 70155, 1887, 220, 7285, 198, 6802, 98660, 220, 2131, 11, 220, 14205, 198, 258, 22025, 768, 220, 14261, 11, 220, 17361, 198, 13885, 1821, 1518, 24869, 198, 13885, 62587, 220, 11727, 12, 20, 198, 258, 45864, 367, 220, 12375, 198, 258, 90927, 220, 914, 11, 220, 3226, 11, 220, 5538, 11, 220, 2031, 11, 220, 9714, 12, 22, 11, 220, 7028, 12, 16, 198, 1518, 1101, 220, 3230, 15319, 320, 797, 39448, 8314, 467, 340, 4481, 2487, 33766, 5789, 198, 24869, 220, 9639, 11, 220, 10866, 198, 2911, 220, 8848, 11, 220, 11483, 11, 220, 12112, 198, 294, 97745, 220, 3192, 198, 4579, 659, 50570, 24630, 220, 5120, 11, 220, 5037, 11, 220, 4364, 198, 4579, 24630, 220, 4218, 11, 220, 4044, 11, 220, 4278, 11, 220, 6889, 198, 19665, 68302, 15105, 220, 8258, 198, 1450, 659, 50570, 24630, 220, 3965, 11, 220, 9690, 11, 220, 11068, 198, 1450, 24630, 220, 9263, 11, 220, 6860, 198, 11011, 53317, 220, 14206, 198, 14370, 220, 1627, 11, 220, 1544, 11, 220, 966, 11, 220, 2148, 198, 1354, 50405, 220, 15574, 198, 404, 23108, 53205, 320, 1138, 61254, 689, 883, 220, 11387, 11, 220, 14274, 198, 404, 23349, 66358, 28439, 220, 15999, 198, 19448, 287, 5435, 220, 8610, 11, 220, 17335, 11, 220, 16884, 198, 27344, 220, 5495, 11, 220, 1227, 12, 20, 11, 220, 5245, 12, 16, 11, 220, 12463, 11, 220, 18196, 198, 64381, 3520, 30020, 612, 5435, 220, 4370, 11, 220, 17361, 11, 220, 17897, 198, 64381, 3520, 33766, 5789, 46905, 220, 13302, 198, 55652, 220, 12533, 198, 24869, 220, 7854, 198, 62564, 5435, 220, 7285, 11, 220, 17361, 11, 220, 17897, 198, 2911, 220, 11483, 11, 220, 12112, 198, 20335, 612, 9950, 540, 398, 66, 22689, 220, 15828, 198, 60071, 1887, 220, 14374, 198, 15962, 38231, 220, 14815, 5358, 327, 220, 18634, 4579, 14370, 220, 1627, 11, 220, 1544, 11, 220, 1591, 11, 220, 1682, 11, 220, 17361, 11, 220, 17887, 198, 4579, 659, 50570, 24630, 220, 7261, 11, 220, 8190, 11, 220, 7994, 198, 4579, 24630, 220, 1954, 11, 220, 5925, 11, 220, 6849, 198, 19665, 68302, 15105, 220, 11123, 11, 220, 10967, 198, 1450, 14370, 220, 966, 11, 220, 2148, 11, 220, 17361, 11, 220, 17887, 198, 1450, 659, 50570, 24630, 220, 10410, 11, 220, 10161, 11, 220, 11068, 198, 1450, 24630, 220, 4386, 11, 220, 9748, 11, 220, 10350, 198, 39042, 30020, 220, 17361, 11, 220, 17897, 198, 20895, 3278, 220, 13895, 11, 220, 14815, 198, 4831, 93003, 220, 15574, 198, 10195, 10495, 220, 9716, 11, 220, 12533, 198, 76193, 7693, 220, 12405, 198, 72735, 1887, 220, 17361, 11, 220, 17897, 198, 74, 34191, 33766, 5789, 198, 4579, 14370, 220, 1591, 11, 220, 1682, 11, 220, 15741, 11, 220, 16546, 198, 4579, 659, 50570, 24630, 220, 8899, 11, 220, 9079, 11, 220, 7994, 198, 4579, 24630, 220, 1041, 11, 220, 4645, 11, 220, 7461, 198, 1450, 14370, 220, 843, 11, 220, 1644, 11, 220, 15741, 11, 220, 16546, 198, 3167, 79134, 86255, 1887, 220, 15741, 11, 220, 15451, 198, 43, 19715, 24915, 220, 1691, 11, 220, 1313, 12, 19, 198, 1978, 33766, 5789, 4579, 14370, 220, 1591, 11, 220, 1682, 11, 220, 15741, 11, 220, 16546, 198, 4579, 659, 50570, 24630, 220, 8899, 11, 220, 9079, 11, 220, 7994, 198, 4579, 24630, 220, 1041, 11, 220, 4645, 11, 220, 7461, 198, 1450 ]
0xBreath/holistic-books
241 Placebo-controlled studies 132, 134, 138, 181, 185 Placebo-controlled studies, nonexisting 131, 157 Plaques 163 et seqq., 169 Plos Medicine 19 Pneumocystis carinii pneumonia (PCP) 100 et seq., 114, 120 Pneumonia 17, 39, 58, 175 et seq., 180 et seq., 187, 230 Pneumo viruses 199 Poison gas 228 Polio 60 et seqq. Polio, first epidemic 61 Pollard, Morris 50 Polymerase chain reaction (PCR) 30, 44, 47 et seqq., 88, 96, 98, 124, 141, 153 et seqq., 158, 183, 195, 221 Polyneur opathy (severe neural damage) 170 Popow, Miezeyeski 62 Popper, Erwin 62, 66 Poppers (nitrite inhalants) 100 et seqq. -Ads 109 318 · -Allaboutpoppers.com 110 -Comic strip 102 -Sales in the 1970s 102 -Sudden sniffing death 104 Prebiotics 35 Prescri ption Users Fees Act (PDUFA) 23 Prevention of disease 22, 33, 45, 49 Primitive peoples 265 Principle of proof 17, 19 Prion (proteinaceous infectious prOtein) 161 et seqq. Prionics 162 Prions in meat and bone meal hypothesis 173 Probiotics 35 Proceedings of the National Academy of Sciences 4 7, 120,195,199,257 Procleix test 156 Profits, maximizing 13, 19 et seqq., 27, 35, 124, 182, 193, 202, 214, 217, 255, 260, 263 et seqq. Progenotes 36 Project for the New American Century 219 Prokaryotes 36 Proline 169 Protein p 18 93 Protein, pi4 93 Prusiner, Stanley 163 et seq., 169 Publication bias 85 Pubmed 192, 216 Pucken, Jim 189 Purdey, Mark 170 Pure virus 93, 95, 195, 209 Purification 43, 84, 87, 93, 95, 155, 182, 249, 255 Pythagoras 29 Qinghai sea 191, 206 et seq. Quality checkups (studies) 52 Queen (British rock band) 141 Quinine 228 Rabies 45, 51 Rabies vaccine 51 Radio Corporation of America (RCA) 41 Radoschewski, Michael 252 Raffle, Angela 258 Rasnick, David 133, 144, 146 Raw food 57, 265 Reagan, Ronald 90, 115 Red Cross 122 Red Flags 247 Relenza 181 Reiman, Arnold 216 Rethinking AlDS 14 Retroviruses 30, 87 et seqq., 93 et seqq. -Supposed diameter 95 Reuters 214 Reverse transcriptase 87 et seq. Reye's syndrome 209 Reynolds, Bun 115 Rheumatism 22 Rhoads, Cornelius "Dusty'' 89 Ribavirin 154, 185 et seq. RNA (ribonucleic acid) 37, 45, 47, 84, 86 et seq., 93, 98,155,221 Robbins, Frederick 66 Robert Koch Institute 26, 43, 92 et seq., 96, 98, 116, 129, 175, 191 et seq., 194, 248, 250 Rockef eller Foundation 80 Rodriguez, Benigno 98 Rolling Stone 237 Rolling Stones 177 Royal Society 17 Ruf, Bernhard 209 Ri.igen 203 Ruhland, John 159 Rumsfeld, Donald 218 et seq. Rundschau 213 et seq. Saar -Echo 218 Safe Minds 246 Salk, Jonas 65, 67, 73 Salk vaccine 65, 67, 73 Sanatoria for tubercolosis treatment 53 Sanatorium, "Lebendige Kraft" 57 Sandler, Benjamin 60 San Francisco Bay Times 111 Sanger, Heinz Ludwig 98 Sanofi Pasteur MSD 255 San Sebastian (Spain) 222 Sapere aude 17 Saquina vir 116 SARS (Severe Acute Respiratory Syndrome) 175 et seqq., 299 -800 "probable" SARS cases 176 Scapegoat thinking 29, 86 Scarlet fever 42 Schecter, Arnold 189 Scheff, Liam 132, 140 Schmitt, Heinz-J. 251 Scholz, Roland 83, 161 et seq., 165, 168 et seq., 173 Science 20, 49, 52, 87 et seq., 112, 120, 122 et seq., 124, 126 et seqq., 136, 167, 195, 209, 220, 222 Scobey, Ralph 47 Scotland 170 Scrapie 163 et seqq., 167 et seq. ScUJvy 55, 59 Seattle 159, 177. 223, 225, 231 Secondary invader 180 Selenium deficiencies 264 Sensationalized media coverage 18, 27, 43, 59, 115, 160, 164, 178, 213, 222 Serono 99· Serostim 99 Sexually Transm itted Diseases 110 Sharav, Vera 22 et seq., 132, 248, 261 Shenton, Joan 148, 150 et seq. Shikwati, James 148 Shilts, Randy 104, ll1 Shotgun therapy 139 Sickles, Grace 66 Side effects 20, 22, 27, 31, 38, 79, 89, 110, 131 et seq., 135, 138, 141, 144 et seq., 153, 180, 182 et seqq., 186 et seq., 198, 214 et seq., 247 et seq., 258, 260 Siegel, Marc 191 Sierra Leone 155 Sigell, L. T. 104 Silent Spring 76, 80 Index Simpsonwood conference center, Georgia 237 Skeletons, sarcoma-c overed 114 Sloan-Kettering Institute for Cancer Research 89 Smallp ox 42 et seq., 228 -England 42 -Germany 42 -Philippines 42 Smith, Richard 19. 53, 91 Smithsonian Institution 66, 81 South Africa 134, 147, 152 Spanish flu 89, 220 et seqq., 225, 227 Special K 104 Spectator 147 Spektrum der Wis sensc haft 136, 166 Spencer, David 90 Spiegel 44, 89, 91, 96, 108 et seqq., 114 et seqq., 124 et seqq., 136, 145, 148, 191, 196, 220 Spiegelman, Sol 87 Spinal marrow 62 Sprayer, invention of the first mechanical crop 61 Spurlock, Morgan 32 Statistisches Bundesamt (Germany's national office of statistics) 248 Steam locomotiv e 24 Stem cells 20 Stern 136, 143 Steroids 185 Stevens-Johnson syndrome 140 Stewart, Gordon 135 Stiftung Priiventative Piidiatrie (Foundation for Pre­ ventive Pediatrics) 251 Stiftung Warentest 33 STIKO (Stiindige Impfkommission, German vaccine committee) 250 et seq. Stockholm Convention 72 Stratton, Kathleen 244 Strawberry scent 266 Strohman, Richard 153 Strokes 113, 133 Structure 94 Strychnine 228 Sudden sniffing death 104 Sugars, refined 32 et seqq., 264 Suicides 124, 145, 212 SukHwang Woo 20 Sullivan, Michael 100 Sunday Times 150 Supplements, dietary 266 Surrogate markers 87 et seq., 93, 97, 99, 155 Swine flu disaster 89 et seq. Switzerland 67, 131, 170
[ 220, 13341, 720, 17826, 754, 41370, 7978, 220, 9413, 11, 220, 9565, 11, 220, 10350, 11, 220, 10562, 11, 220, 9741, 720, 17826, 754, 41370, 7978, 11, 2536, 37995, 220, 9263, 11, 220, 10895, 720, 2169, 64, 14295, 220, 9892, 1880, 13278, 80, 2637, 220, 11739, 720, 47, 2353, 19152, 220, 777, 720, 47, 126261, 511, 599, 285, 1841, 258, 3893, 69329, 320, 118923, 8, 220, 1041, 1880, 13278, 2637, 720, 8011, 11, 220, 4364, 720, 47, 126261, 21947, 220, 1114, 11, 220, 2137, 11, 220, 2970, 11, 220, 10005, 1880, 13278, 2637, 220, 5245, 1880, 13278, 2637, 220, 9674, 11, 720, 9870, 720, 47, 818, 65725, 42068, 220, 2550, 720, 34004, 3416, 6962, 220, 14261, 720, 15000, 822, 220, 1399, 1880, 13278, 80, 13, 720, 15000, 822, 11, 1176, 42620, 220, 5547, 720, 50307, 569, 11, 30283, 220, 1135, 720, 39264, 1195, 521, 8957, 13010, 320, 74256, 8, 220, 966, 11, 220, 2096, 11, 220, 2618, 1880, 13278, 80, 2637, 720, 2421, 11, 220, 4161, 11, 220, 3264, 11, 220, 8874, 11, 220, 9335, 11, 220, 9800, 1880, 13278, 80, 2637, 220, 11286, 11, 220, 10750, 11, 220, 6280, 11, 720, 12425, 720, 39264, 818, 324, 1200, 19682, 320, 325, 19846, 30828, 5674, 8, 220, 8258, 720, 11859, 363, 11, 386, 74466, 58331, 6780, 220, 5538, 720, 11859, 716, 11, 9939, 7678, 220, 5538, 11, 220, 2287, 720, 47, 32542, 320, 45168, 1269, 77773, 1821, 8, 220, 1041, 1880, 13278, 80, 13, 720, 12, 61213, 220, 7743, 720, 17592, 9787, 482, 2460, 9274, 79, 32542, 916, 220, 5120, 720, 12, 80736, 13619, 220, 4278, 720, 6354, 3916, 304, 279, 220, 4468, 15, 82, 220, 4278, 720, 6354, 39095, 58387, 287, 4648, 220, 6849, 720, 4808, 8385, 51003, 220, 1758, 720, 14704, 745, 11051, 290, 14969, 59678, 3298, 320, 47, 22272, 3711, 8, 220, 1419, 720, 4808, 7611, 315, 8624, 220, 1313, 11, 220, 1644, 11, 220, 1774, 11, 220, 2491, 720, 34413, 32538, 220, 14374, 720, 3617, 16379, 315, 11311, 220, 1114, 11, 220, 777, 720, 3617, 290, 320, 79565, 77140, 50600, 550, 46, 39340, 8, 220, 10718, 1880, 13278, 80, 13, 720, 3617, 290, 1233, 220, 10674, 720, 3617, 919, 304, 13339, 323, 17685, 15496, 31178, 220, 11908, 720, 1360, 8385, 51003, 220, 1758, 720, 85438, 826, 315, 279, 5165, 16192, 315, 23199, 220, 19, 220, 22, 11, 720, 4364, 11, 6280, 11, 2550, 11, 15574, 720, 1360, 9326, 953, 1296, 220, 10132, 720, 19105, 1220, 11, 88278, 220, 1032, 11, 220, 777, 1880, 13278, 80, 2637, 220, 1544, 11, 220, 1758, 11, 220, 8874, 11, 220, 10828, 11, 720, 7285, 11, 220, 2366, 11, 220, 11584, 11, 220, 13460, 11, 220, 3192, 11, 220, 11387, 11, 220, 15666, 1880, 13278, 80, 13, 720, 1360, 4469, 6429, 220, 1927, 720, 8006, 369, 279, 1561, 3778, 28200, 220, 13762, 720, 1360, 74, 661, 6429, 220, 1927, 720, 1360, 1074, 220, 11739, 720, 1360, 39340, 281, 220, 972, 220, 6365, 720, 1360, 39340, 11, 9115, 19, 220, 6365, 720, 3617, 355, 10670, 11, 31552, 220, 9892, 1880, 13278, 2637, 220, 11739, 720, 73490, 15837, 220, 5313, 720, 30262, 2106, 220, 5926, 11, 220, 12463, 720, 47, 98090, 11, 11641, 220, 9378, 720, 47, 324, 451, 88, 11, 4488, 220, 8258, 720, 58713, 17188, 220, 6365, 11, 220, 2721, 11, 220, 6280, 11, 220, 12652, 720, 47, 324, 2461, 220, 3391, 11, 220, 5833, 11, 220, 4044, 11, 220, 6365, 11, 220, 2721, 11, 220, 9992, 11, 220, 10828, 11, 220, 14735, 11, 220, 3192, 720, 14149, 96462, 65747, 220, 1682, 720, 48, 287, 26279, 9581, 220, 7529, 11, 220, 11056, 1880, 13278, 13, 720, 34174, 1817, 8772, 320, 267, 58787, 8, 220, 4103, 720, 53106, 320, 52961, 7091, 7200, 8, 220, 9335, 720, 2232, 83334, 220, 14261, 720, 49, 98141, 220, 1774, 11, 220, 3971, 720, 49, 98141, 25474, 220, 3971, 720, 29303, 13332, 315, 5270, 320, 49, 5158, 8, 220, 3174, 720, 49, 5670, 331, 365, 33639, 11, 8096, 220, 12326, 720, 49, 45190, 11, 38243, 220, 15966, 720, 49, 300, 21035, 11, 6941, 220, 9423, 11, 220, 8929, 11, 220, 10465, 720, 20613, 3691, 220, 3226, 11, 220, 14374, 720, 697, 18851, 11, 39748, 220, 1954, 11, 220, 7322, 720, 6161, 11511, 220, 8259, 720, 6161, 34305, 220, 14125, 720, 6882, 24238, 220, 10562, 720, 697, 40310, 11, 44312, 220, 12463, 720, 49, 774, 16113, 1708, 6061, 220, 975, 720, 49, 8980, 46957, 4881, 220, 966, 11, 220, 4044, 1880, 13278, 80, 2637, 220, 6365, 1880, 13278, 80, 13, 720, 6354, 455, 3950, 23899, 220, 2721, 720, 36978, 220, 11584, 720, 46795, 36815, 521, 220, 4044, 1880, 13278, 13, 720, 697, 9188, 596, 28439, 220, 12652, 720, 697, 1910, 18938, 11, 66347, 220, 7322, 720, 49, 383, 46313, 2191, 220, 1313, 720, 73262, 2799, 82, 11, 99045, 9334, 330, 35, 47425, 4708, 220, 4578, 720, 99984, 113765, 258, 220, 10559, 11, 220, 9741, 1880, 13278, 13, 720, 31820, 320, 1936, 263, 22935, 292, 13935, 8, 220, 1806, 11, 220, 1774, 11, 220, 2618, 11, 220, 5833, 11, 220, 4218, 1880, 13278, 2637, 220, 6365, 11, 720, 3264, 11, 9992, 11, 12425, 720, 14804, 40430, 11, 51764, 220, 2287, 8563, 40593, 10181, 220, 1627, 11, 220, 3391, 11, 220, 6083, 1880, 13278, 2637, 220, 4161, 11, 220, 3264, 11, 220, 8027, 11, 720, 9748, 11, 220, 10005, 11, 220, 7529, 1880, 13278, 2637, 220, 6393, 11, 220, 14185, 11, 220, 5154, 720, 36152, 830, 27028, 5114, 220, 1490, 720, 60207, 14746, 28700, 11, 7505, 625, 78, 220, 3264, 720, 33455, 287, 14637, 220, 14590, 720, 33455, 287, 57200, 220, 11242, 720, 74872, 13581, 220, 1114, 720, 49, 1739, 11, 14502, 19221, 220, 12652, 720, 49, 72, 13, 6569, 220, 9639, 720, 49, 12825, 1974, 11, 3842, 220, 11068, 720, 49, 6370, 31202, 11, 9641, 220, 13302, 1880, 13278, 13, 720, 49, 1263, 21740, 2933, 220, 11702, 1880, 13278, 13, 720, 53379, 277, 482, 76094, 220, 13302, 720, 26747, 61410, 220, 14205, 720, 50, 1727, 11, 69186, 220, 2397, 11, 220, 3080, 11, 220, 5958, 720, 50, 1727, 25474, 220, 2397, 11, 220, 3080, 11, 220, 5958, 720, 24661, 96410, 369, 15286, 261, 2119, 10934, 6514, 220, 4331, 720, 24661, 66844, 11, 330, 2356, 65, 408, 7404, 65660, 1, 220, 3226, 720, 50, 5365, 1174, 30411, 220, 1399, 720, 24661, 13175, 9332, 8691, 220, 5037, 720, 50, 4091, 11, 1283, 41622, 85550, 220, 3264, 720, 24661, 93123, 58325, 324, 72495, 220, 3192, 720, 24661, 44609, 320, 75420, 8, 220, 9716, 720, 50, 391, 486, 264, 799, 220, 1114, 720, 53379, 54506, 9043, 220, 8027, 720, 50, 17485, 320, 1542, 19846, 6515, 1088, 77934, 5382, 57496, 8, 220, 10005, 1880, 720, 13565, 80, 2637, 220, 15531, 720, 12, 4728, 330, 20493, 481, 1, 328, 17485, 5157, 220, 10967, 720, 50, 5443, 3427, 266, 7422, 220, 1682, 11, 220, 4218, 720, 96056, 1169, 34653, 220, 2983, 720, 31224, 440, 261, 11, 44312, 220, 9378, 720, 50, 1557, 544, 11, 61742, 220, 9413, 11, 220, 6860, 720, 31224, 24621, 11, 1283, 41622, 12278, 13, 220, 13860, 720, 31224, 337, 89, 11, 58906, 220, 6069, 11, 220, 10718, 1880, 13278, 2637, 220, 10680, 11, 220, 8953, 1880, 13278, 2637, 220, 11908, 720, 36500, 220, 508, 11, 220, 2491, 11, 220, 4103, 11, 220, 4044, 1880, 13278, 2637, 220, 7261, 11, 220, 4364, 11, 220, 8259, 1880, 13278, 2637, 720, 8874, 11, 220, 9390, 1880, 13278, 80, 2637, 220, 9795, 11, 220, 11515, 11, 220, 6280, 11, 220, 12652, 11, 220, 8610, 11, 220, 9716, 720, 3407, 677, 1216, 11, 40904, 220, 2618, 720, 96925, 220, 8258, 720, 3407, 4714, 648, 220, 9892, 1880, 13278, 80, 2637, 220, 11515, 1880, 13278, 13, 720, 3407, 52, 41, 14029, 220, 2131, 11, 220, 2946, 720, 72772, 220, 11068, 11, 220, 11242, 13, 220, 12533, 11, 220, 11057, 11, 220, 12245, 720, 50063, 1558, 1013, 220, 5245, 720, 50, 15127, 72946, 220, 12815, 720, 50, 729, 1697, 1534, 3772, 10401, 220, 972, 11, 220, 1544, 11, 220, 3391, 11, 220, 2946, 11, 220, 7322, 11, 720, 6330, 11, 220, 10513, 11, 220, 11256, 11, 220, 11702, 11, 220, 9716, 720, 32845, 10358, 220, 1484, 14260, 720, 32845, 537, 318, 220, 1484, 720, 20004, 1870, 4149, 76, 433, 6702, 70674, 220, 5120, 720, 43315, 402, 11, 68200, 220, 1313, 1880, 13278, 2637, 220, 9413, 11, 220, 14185, 11, 220, 15602, 720, 2059, 75072, 11, 51206, 220, 10410, 11, 220, 3965, 1880, 13278, 13, 720, 2059, 1609, 86, 9491, 11, 7957, 220, 10410, 720, 2059, 321, 2641, 11, 46315, 220, 6849, 11, 9507, 16, 720, 37502, 13562, 15419, 220, 10125, 720, 50, 875, 645, 11, 32171, 220, 2287, 720, 16789, 6372, 220, 508, 11, 220, 1313, 11, 220, 1544, 11, 220, 2148, 11, 220, 1987, 11, 220, 4643, 11, 220, 4578, 11, 220, 5120, 11, 220, 9263, 1880, 720, 13565, 2637, 220, 8878, 11, 220, 10350, 11, 220, 9335, 11, 220, 8929, 1880, 13278, 2637, 220, 9800, 11, 220, 5245, 11, 220, 10828, 1880, 720, 13565, 80, 2637, 220, 9714, 1880, 13278, 2637, 220, 3753, 11, 220, 11584, 1880, 13278, 2637, 220, 14125, 1880, 13278, 2637, 720, 15966, 11, 220, 11387, 720, 51955, 29952, 11, 19412, 220, 7529, 720, 22771, 14210, 66491, 220, 9992, 720, 48346, 616, 11, 445, 13, 350, 13, 220, 6849, 720, 28671, 306, 12531, 220, 4767, 11, 220, 1490, 8167, 720, 50, 6802, 942, 6798, 10017, 4219, 11, 16272, 220, 14590, 720, 78668, 82, 11, 29147, 82945, 1824, 927, 291, 220, 8011, 720, 50, 39429, 16222, 22120, 287, 10181, 369, 26211, 8483, 220, 4578, 720, 26375, 79, 19488, 220, 2983, 1880, 13278, 2637, 220, 14261, 720, 12, 67308, 220, 2983, 720, 12279, 4858, 88, 220, 2983, 720, 12, 30690, 65006, 220, 2983, 720, 42985, 11, 12131, 220, 777, 13, 220, 4331, 11, 220, 5925, 720, 42985, 78713, 43964, 220, 2287, 11, 220, 5932, 720, 26070, 10384, 220, 9565, 11, 220, 10288, 11, 220, 9756, 720, 62897, 20236, 220, 4578, 11, 220, 8610, 1880, 13278, 80, 2637, 220, 11057, 11, 220, 14206, 720, 20989, 735, 220, 6849, 720, 50, 1002, 859, 220, 10288, 720, 20298, 74, 376, 372, 2761, 16208, 6225, 66, 120993, 220, 9795, 11, 220, 11247, 720, 6540, 20099, 11, 6941, 220, 1954, 720, 6540, 76047, 220, 2096, 11, 220, 4578, 11, 220, 5925, 11, 220, 4161, 11, 220, 6640, 1880, 13278, 80, 2637, 220, 8011, 1880, 13278, 80, 2637, 720, 8874, 1880, 13278, 80, 2637, 220, 9795, 11, 220, 9591, 11, 220, 10410, 11, 220, 7529, 11, 220, 5162, 11, 220, 8610, 720, 6540, 76047, 1543, 11, 11730, 220, 4044, 720, 6540, 992, 83748, 220, 5538, 720, 64505, 1155, 11, 28229, 315, 279, 1176, 22936, 19641, 220, 5547, 720, 6540, 324, 1039, 11, 23809, 220, 843, 720, 16257, 380, 88057, 47407, 36325, 320, 51270, 596, 5426, 5274, 315, 720, 55220, 8, 220, 14185, 720, 42744, 63907, 354, 344, 384, 220, 1187, 720, 626, 336, 7917, 220, 508, 720, 50, 4253, 220, 9795, 11, 220, 10290, 720, 81450, 17390, 220, 9741, 720, 626, 5230, 729, 12278, 3180, 942, 28439, 220, 6860, 720, 626, 27595, 11, 26952, 220, 8878, 720, 626, 2130, 2234, 28885, 81541, 1413, 21286, 12558, 2416, 68, 320, 19137, 369, 5075, 5879, 198, 688, 535, 99871, 8, 220, 13860, 720, 626, 2130, 2234, 468, 1415, 478, 220, 1644, 720, 790, 29661, 46, 320, 626, 72, 485, 7404, 14727, 69, 22873, 2796, 11, 6063, 25474, 720, 57885, 8, 220, 5154, 1880, 13278, 13, 720, 19931, 34605, 26958, 220, 5332, 720, 2645, 266, 783, 11, 65163, 220, 13719, 720, 2645, 675, 15717, 41466, 220, 15999, 720, 626, 299, 71, 1543, 11, 12131, 220, 9800, 720, 626, 56137, 220, 8190, 11, 220, 9423, 720, 23807, 220, 6281, 720, 50, 1568, 2174, 483, 220, 14261, 720, 50, 39095, 58387, 287, 4648, 220, 6849, 720, 50, 773, 1590, 11, 38291, 220, 843, 1880, 13278, 80, 2637, 220, 12815, 720, 37559, 76195, 220, 8874, 11, 220, 9591, 11, 220, 11227, 720, 50, 3178, 39, 71652, 56946, 220, 508, 720, 50, 37141, 11, 8096, 220, 1041, 720, 37165, 8691, 220, 3965, 720, 10254, 4779, 11, 34625, 220, 15999, 720, 23912, 49473, 24915, 220, 4044, 1880, 13278, 2637, 220, 6365, 11, 220, 3534, 11, 220, 1484, 11, 220, 9992, 720, 13521, 483, 20236, 21426, 220, 4578, 1880, 13278, 13, 720, 13521, 27521, 220, 3080, 11, 220, 9263, 11, 220, 8258 ]
0xBreath/holistic-books
ella (produces nerve toxins). She killed these with a frequency gen- erator. Five weeks later the pain and stiffness in her neck were gone, her pulse was down to 100, her periods were free of painNON-PAINFUL DISEASES 207and her hands seemed to shake less. She was put on the parasite program plus thioctic acid (2 a day) and histidine (500 mg, one a day to keep nickel levels down)and advised to cook and eat with non metal. Four weeks later her pulse was down to 80, her legs were much better. She zapped four remaining bacteria. Two months later the numbness and tremor had left; her legs still felt tired and her hands sometimes shook but she was quite reas sured that MS would not claim her life. Nor had a gene betrayed her. A half year later she was walking and working normally, doing liver cleanses and keeping up her vigilance against parasites and pollutants. Kendra Welch, 56, was diagnosed with MS a year ago, by MRI. She went to a chelating doctor and this cleared up her temporary ischemic attacks (T.I.A's) which were occurring daily. But she had lost her balance, eyesight was getting worse, her feet and hands stung. Her sister also had MS but nobody else in the family did which baffled her doctor. Her brain tissue was full of barium, europium, gadolinium, and platinum. These are dental alloys, al- though barium could come from bus exhaust (she wore no lip- stick). She was advised to have all metal removed from her mouth immediately. Two days afterward she came into the office without any neurological symptoms. She stated she was afraid to stop her new health program, though, and this was good policy. Lynne Ceretto, age 15, was diagnosed with an “MS-like syndrome” by MRI. She had intestinal flukes and stages, human liver fluke s and Trichinella in the brain. She had no tooth fillings. But there was benzene in her thymus keeping her immunity low. She also had propane and asbestos in her brain from leaky pipes and a worn washing machine belt. She, too, was told she had a “bad” gene. She was barely able to walk with help. It took several months to track down the source of benzene—the drinking water. Some times it was polluted; sometimes it was not! When the pump was oiled, some of it dripped onto the cement platform. Rain washed it to the center and down the pipe in the well. They eagerly removed the platform, found the oil on the water surface, cleaned every thing up carefully, until no benzene could be found which put her on the road to recovery. A year later she had recovered further. Norma Luellen, a young mother, had tingling, numbness and weak ness on the entire left side of her body. She was in process ofTHE CURE FOR ALL DISEASES 208clinical tests for MS. Her body was full of pentane, possibly from her workplace since 12 other persons working there also had MS (such a situation should make our government eager to jump at investigations)! She had intestinal flukes and their stages, not in the intestine or liver or thymus, but in her brain! We found her home air toxic with bismuth too, probably from cosmetics. In spite of staying on the parasite program she got reinfected with sheep liver fluke, probably from eating hamburgers. She was not able to stop her carbonated beverage habit and frequently showed xy lene, acetone, methylene chloride in addition to pentane in her white blood cells. Shannon Synder, age 44, had been getting more numb over her whole body for several years and was presently considered by her doctor to have MS. Her muscles twitched all night, making sleep impossible, and her hands shook. She had intestinal flukes in the brain (cerebrum and cerebellum ) but none in the intestine! The brain also had wood alcohol from drinking Diet Coke.TM She also had bismuth (cosmetics ), palladium, copper, samarium, and tellurium (tooth alloys) in her brain. She began to improve enough to be off Prednisone by her 10th day of the parasite program. Erica Blake, age 41, was diagnosed with MS two years earlier al though her symptoms went back 13 years. She was on Predni soneTM but her balance was getting so bad she had to be in a wheelchair. Chelation treatments kept her from deteriorating fur ther. Her brain was full of gasoline ; she used to work at a gas sta tion and now was getting it from the attached garage. Her hands and feet were completely numb. She had 5 root canals extracted and a few days later was able to stand. She could now walk with a cane. She had human liver fluke s, sheep liver fluke and Trichinellas and dog tapeworm stages in her cerebellum (motor con trol center). After killing parasites and starting to take thioctic acid (4 a day) and cleaning up her environment she improved enough to drive a car again, walk without a cane in her home. She re gained enough feeling in her hands and legs to do her housework, too. Kurt Nielsen, age 43, was told he had peripheral neuropathy. His feet were so numb he had to look at the clutch to drive. Also both hands were numb. He was full of kerosene and benzene possibly from fuel oil that he pumped for a living. There were fluke stagesNON-PAINFUL DISEASES 209in his brain and a dozen bacteria and viruses. He also had mer- cury and thallium in his immune system which came from tooth fillings. However, he had all his metal fillings replaced two years earlier! He thought there was no mercury left in his mouth! Actu- ally, he had little bits (called tattoos) left somewhere. And they were giving him the classical symptoms: numbness of hands and feet and gradual destruction of his nervous system. His peripheral neuropathy was due to thallium poisoning. The dentist couldn't find tattoos, and he was left in his predicament. (This was before I found mercury and thallium sources in many personal products.) Duncan Wood, a middle age father of 5 young children, could still slowly shuffle along when he arrived. He could not raise his arms to eat. He had uncontrolled inappropriate laughter every minute. He was diagnosed with MS two years earlier and told he had a “bad” gene. The fact that one child was beginning to show similar symptoms strengthened their belief in the gene theory. Ten days later his inappropriate laughter stopped; he could get his right hand to his face, he walked twice as fast and had very little tremor remaining. Strong chelating treatments obtained at a Mexican clinic had drawn much of the mercury and thallium out of his brain. He killed the flukes and Shigella bacteria electronically and stopped consuming unboiled milk. The brain solvents, xylene and toluene were removed quickly, too, as well as asbestos. His fast improvement showed them how important it was to remove the source of these pollutants in his home. Two days later he regressed considerably which made him feel quite depressed, since his chelating treatments had not stopped. Was there still an unknown factor? It was a return of Shigella bacteria! He had inadvertently eaten a non-sterile dairy food: milk added to soup when it was already done cooking! This was a valuable lesson. Nothing else had returned. He was away from the asbestos and xylene from the workshop at home. He zapped the bacteria again and applied greater vigilance to eating only sterilized dairy foods. He recouped his losses in one day. Then they scheduled their dental work, which had already been done once two years ago! He had leftover mercury and thallium. Now, selecting a dentist with experience in finding tattoos and cleaning cavitations made much more sense to him than it had before. He also planned to do a kidney and liver cleanse after re-THE CURE FOR ALL DISEASES 210turning home. And to stay out of the workshop until the asbestos - containing belt had been replaced and the furniture painting had been moved to a different building. Shigella also causes irritability and depression, a fre quent problem for MS cases. High Blood Pressure High blood pressure is one of the easiest problems to correct without resorting to drugs. The most important change to make is to stop using caffeine as in coffee, tea, or carbonated beverages. Don't use decaffein- ated coffee or tea either because of the solvent pollution in them. Switch to hot milk or hot water if a hot beverage is de sired, or any of the beverages given in the recipe section. If be ing without caffeine leaves you fatigued, take an arg
[ 6985, 198, 7, 8723, 1634, 32015, 220, 62186, 570, 3005, 7577, 1521, 449, 264, 11900, 4173, 7058, 40622, 13, 21594, 5672, 3010, 279, 6784, 323, 70334, 304, 1077, 13272, 1051, 198, 46696, 11, 1077, 28334, 574, 1523, 311, 220, 1041, 11, 1077, 18852, 1051, 1949, 315, 6784, 30663, 9483, 6979, 50736, 423, 9311, 4157, 50, 198, 12060, 438, 1077, 6206, 9508, 311, 27116, 2753, 13, 3005, 574, 2231, 389, 279, 220, 85573, 198, 15252, 5636, 270, 822, 26636, 13935, 220, 320, 17, 264, 1938, 8, 323, 13034, 91073, 220, 320, 2636, 14060, 11, 832, 264, 198, 1316, 311, 2567, 52349, 220, 5990, 1523, 8, 438, 26160, 311, 4394, 323, 8343, 449, 198, 6414, 9501, 13, 13625, 5672, 3010, 1077, 28334, 574, 1523, 311, 220, 1490, 11, 1077, 14535, 198, 52898, 1790, 2731, 13, 3005, 1167, 5795, 3116, 9861, 24032, 13, 9220, 198, 50814, 3010, 279, 57371, 2136, 220, 323, 18659, 269, 220, 1047, 2163, 26, 1077, 14535, 2103, 6612, 198, 83, 2757, 323, 1077, 6206, 7170, 36014, 719, 1364, 574, 5115, 312, 300, 2771, 67, 198, 9210, 10504, 1053, 539, 3802, 1077, 2324, 13, 8170, 1047, 264, 15207, 65397, 1077, 13, 362, 198, 38106, 1060, 3010, 1364, 574, 11689, 323, 3318, 14614, 11, 3815, 26587, 198, 9326, 598, 288, 323, 10494, 709, 1077, 38494, 685, 2403, 79383, 323, 198, 31241, 332, 1821, 627, 42, 61799, 85263, 11, 220, 3487, 11, 574, 29704, 449, 10504, 264, 1060, 4227, 11, 555, 52460, 13, 3005, 198, 42700, 311, 264, 523, 301, 1113, 10896, 323, 420, 23803, 709, 1077, 13643, 198, 285, 2464, 292, 8951, 220, 320, 51, 2506, 885, 596, 8, 902, 1051, 31965, 7446, 13, 2030, 1364, 1047, 198, 55437, 1077, 8335, 11, 6548, 492, 574, 3794, 11201, 11, 1077, 7693, 323, 6206, 198, 267, 2234, 13, 6385, 13219, 1101, 1047, 10504, 719, 19093, 775, 304, 279, 3070, 1550, 198, 8370, 65516, 839, 1077, 10896, 13, 6385, 8271, 20438, 574, 2539, 315, 3703, 2411, 13801, 20732, 897, 2411, 1174, 34316, 37737, 2411, 1174, 323, 63327, 662, 4314, 527, 29106, 95851, 11, 453, 7058, 4636, 3703, 2411, 1436, 2586, 505, 5951, 17960, 320, 32158, 28670, 912, 19588, 7058, 30133, 570, 3005, 574, 26160, 311, 617, 682, 9501, 7108, 505, 1077, 11013, 198, 318, 44287, 13, 9220, 2919, 49043, 1364, 3782, 1139, 279, 5274, 2085, 198, 3852, 64908, 13803, 13, 3005, 11224, 1364, 574, 16984, 311, 3009, 1077, 198, 943, 2890, 2068, 11, 3582, 11, 323, 420, 574, 1695, 4947, 627, 43, 1910, 818, 28764, 53979, 11, 4325, 220, 868, 11, 574, 29704, 449, 459, 1054, 4931, 12970, 28439, 863, 555, 198, 79770, 13, 3005, 1047, 63900, 1344, 65850, 323, 18094, 11, 3823, 26587, 1344, 10647, 274, 323, 198, 1305, 718, 258, 6985, 220, 304, 279, 8271, 13, 3005, 1047, 912, 26588, 5266, 826, 13, 2030, 1070, 574, 198, 8123, 89, 1994, 304, 1077, 270, 1631, 355, 220, 10494, 1077, 40368, 3428, 13, 3005, 1101, 1047, 198, 782, 26393, 220, 323, 77235, 220, 304, 1077, 8271, 505, 24237, 88, 32275, 323, 264, 24634, 198, 98191, 5780, 19671, 13, 3005, 11, 2288, 11, 574, 3309, 1364, 1047, 264, 1054, 14176, 863, 15207, 16853, 8100, 574, 20025, 3025, 311, 4321, 449, 1520, 13, 1102, 3952, 3892, 4038, 311, 198, 13432, 1523, 279, 2592, 315, 72046, 1994, 22416, 16558, 3090, 13, 4427, 3115, 198, 275, 574, 95869, 26, 7170, 433, 574, 539, 0, 3277, 279, 14155, 574, 297, 2230, 345, 15031, 315, 433, 50511, 7069, 8800, 279, 24532, 5452, 13, 22674, 38593, 433, 311, 279, 198, 3133, 323, 1523, 279, 13961, 304, 279, 1664, 13, 2435, 63473, 7108, 279, 198, 16111, 11, 1766, 279, 5707, 389, 279, 3090, 7479, 11, 28822, 1475, 3245, 709, 198, 10727, 3725, 11, 3156, 912, 72046, 1994, 1436, 387, 1766, 902, 2231, 1077, 389, 279, 198, 8714, 311, 13654, 13, 362, 1060, 3010, 1364, 1047, 26403, 4726, 627, 26042, 64, 18866, 16046, 11, 264, 3995, 6691, 11, 1047, 43327, 2785, 11, 57371, 2136, 323, 7621, 86496, 198, 263, 279, 4553, 2163, 3185, 315, 1077, 2547, 13, 3005, 574, 304, 1920, 315, 17673, 356, 4622, 4716, 13398, 423, 9311, 4157, 50, 198, 12171, 91899, 7177, 369, 10504, 13, 6385, 2547, 574, 2539, 315, 20801, 2194, 1174, 11000, 505, 198, 1964, 27465, 2533, 220, 717, 1023, 11434, 3318, 1070, 1101, 1047, 10504, 198, 1161, 1412, 264, 6671, 1288, 1304, 1057, 3109, 24450, 311, 7940, 520, 198, 43114, 343, 811, 42395, 3005, 1047, 63900, 1344, 65850, 323, 872, 18094, 11, 539, 304, 198, 1820, 92234, 477, 26587, 477, 270, 1631, 355, 1174, 719, 304, 1077, 8271, 0, 1226, 1766, 1077, 198, 5227, 3805, 21503, 449, 293, 2191, 952, 220, 2288, 11, 4762, 505, 66065, 662, 763, 34781, 198, 1073, 19994, 389, 279, 85573, 2068, 1364, 2751, 312, 13885, 1599, 449, 33012, 198, 75, 1553, 1344, 10647, 1174, 4762, 505, 12459, 57947, 388, 13, 3005, 574, 539, 3025, 311, 198, 9684, 1077, 12782, 660, 43450, 14464, 323, 14134, 8710, 31884, 326, 1994, 345, 68323, 606, 1174, 21747, 64651, 82882, 220, 304, 5369, 311, 20801, 2194, 304, 1077, 4251, 198, 51105, 7917, 627, 2059, 17893, 5837, 910, 11, 4325, 220, 2096, 11, 1047, 1027, 3794, 810, 57371, 927, 1077, 4459, 198, 2664, 369, 3892, 1667, 323, 220, 574, 50801, 220, 6646, 220, 555, 1077, 198, 38083, 311, 617, 10504, 13, 6385, 24569, 60513, 291, 682, 3814, 11, 3339, 6212, 198, 318, 10236, 11, 323, 1077, 6206, 36014, 13, 3005, 1047, 63900, 1344, 65850, 304, 279, 198, 54160, 320, 66, 486, 1347, 372, 220, 323, 28091, 17696, 372, 883, 719, 7000, 304, 279, 92234, 0, 578, 198, 54160, 1101, 1047, 7732, 13200, 220, 505, 16558, 27304, 74362, 844, 44, 3005, 1101, 198, 32345, 293, 2191, 952, 220, 320, 9594, 46366, 7026, 67597, 13786, 1174, 24166, 1174, 10167, 34765, 1174, 323, 198, 73457, 324, 2411, 220, 320, 998, 8942, 95851, 8, 304, 1077, 8271, 13, 3005, 6137, 311, 7417, 3403, 198, 998, 387, 1022, 30924, 26209, 606, 555, 1077, 220, 605, 339, 1938, 315, 279, 85573, 2068, 627, 50554, 64, 31994, 11, 4325, 220, 3174, 11, 574, 29704, 449, 10504, 1403, 1667, 6931, 453, 3582, 198, 1964, 13803, 4024, 1203, 220, 1032, 1667, 13, 3005, 574, 389, 30924, 7907, 274, 606, 22809, 719, 198, 1964, 8335, 574, 3794, 779, 3958, 1364, 1047, 311, 387, 304, 264, 54618, 627, 1163, 301, 367, 22972, 8774, 1077, 505, 39436, 1113, 18742, 9139, 13, 6385, 8271, 198, 16514, 2539, 315, 46595, 2652, 1364, 1511, 311, 990, 520, 264, 6962, 29611, 73352, 323, 1457, 574, 198, 51210, 433, 505, 279, 12673, 19833, 13, 6385, 6206, 323, 7693, 1051, 198, 884, 50268, 57371, 13, 3005, 1047, 220, 20, 3789, 649, 1147, 220, 28532, 323, 264, 2478, 2919, 198, 68676, 574, 3025, 311, 2559, 13, 3005, 1436, 1457, 4321, 449, 264, 63335, 13, 3005, 1047, 198, 26380, 26587, 1344, 10647, 274, 11, 33012, 26587, 1344, 10647, 220, 323, 1183, 718, 258, 75595, 220, 323, 5679, 198, 31147, 365, 494, 220, 18094, 220, 304, 1077, 28091, 17696, 372, 220, 320, 59088, 390, 259, 1098, 4219, 570, 4740, 198, 74, 9585, 79383, 323, 6041, 311, 1935, 270, 822, 26636, 13935, 220, 320, 19, 264, 1938, 8, 323, 198, 18883, 287, 709, 1077, 4676, 1364, 13241, 3403, 311, 6678, 264, 1841, 198, 33871, 11, 4321, 2085, 264, 63335, 304, 1077, 2162, 13, 3005, 312, 18661, 3403, 198, 1897, 20659, 304, 1077, 6206, 323, 14535, 311, 656, 1077, 3838, 1816, 11, 2288, 627, 42, 5757, 64551, 11, 4325, 220, 3391, 11, 574, 3309, 568, 1047, 35688, 98666, 19682, 13, 5414, 7693, 198, 52898, 779, 57371, 568, 1047, 311, 1427, 520, 279, 43789, 311, 6678, 13, 7429, 2225, 6206, 198, 52898, 57371, 13, 1283, 574, 2539, 315, 597, 6398, 1994, 220, 323, 72046, 1994, 11000, 505, 198, 64475, 5707, 430, 568, 62454, 369, 264, 5496, 13, 2684, 1051, 1344, 10647, 18094, 30663, 9483, 6979, 50736, 423, 9311, 4157, 50, 198, 12652, 258, 813, 8271, 323, 264, 21030, 24032, 323, 42068, 13, 1283, 1101, 1047, 4809, 7058, 26533, 323, 270, 543, 2411, 220, 304, 813, 22852, 1887, 902, 3782, 505, 26588, 198, 7712, 826, 13, 4452, 11, 568, 1047, 682, 813, 9501, 5266, 826, 12860, 1403, 1667, 198, 686, 5741, 0, 1283, 3463, 1070, 574, 912, 51852, 2163, 304, 813, 11013, 0, 3298, 84, 7058, 750, 11, 568, 1047, 2697, 9660, 320, 44982, 54742, 8, 2163, 15038, 13, 1628, 814, 1051, 198, 70, 2299, 1461, 279, 29924, 13803, 25, 57371, 2136, 220, 315, 6206, 323, 7693, 198, 438, 53722, 19814, 315, 813, 23418, 1887, 13, 5414, 35688, 198, 818, 84, 897, 19682, 220, 574, 4245, 311, 270, 543, 2411, 52236, 13, 578, 50351, 7846, 956, 1505, 198, 83, 17173, 437, 11, 323, 568, 574, 2163, 304, 813, 79434, 2908, 13, 320, 2028, 574, 1603, 358, 198, 15456, 51852, 323, 270, 543, 2411, 8336, 304, 1690, 4443, 3956, 29275, 35, 38566, 12404, 11, 264, 6278, 4325, 7126, 315, 220, 20, 3995, 2911, 11, 1436, 2103, 198, 36311, 398, 27037, 3235, 994, 568, 11721, 13, 1283, 1436, 539, 4933, 813, 11977, 198, 998, 8343, 13, 1283, 1047, 653, 59707, 33781, 43214, 1475, 9568, 627, 1548, 574, 29704, 449, 10504, 1403, 1667, 6931, 323, 3309, 568, 1047, 264, 198, 2118, 14176, 863, 15207, 662, 578, 2144, 430, 832, 1716, 574, 7314, 311, 1501, 4528, 198, 24738, 52273, 60862, 872, 16801, 304, 279, 15207, 10334, 13, 18165, 2919, 198, 68676, 813, 33781, 43214, 10717, 26, 568, 1436, 636, 813, 1314, 1450, 198, 998, 813, 3663, 1174, 568, 15203, 11157, 439, 5043, 323, 1047, 1633, 2697, 18659, 269, 198, 44536, 13, 27191, 523, 301, 1113, 22972, 12457, 520, 264, 24160, 198, 90365, 1047, 15107, 1790, 315, 279, 51852, 323, 270, 543, 2411, 220, 704, 315, 813, 8271, 627, 1548, 7577, 279, 1344, 65850, 323, 1443, 343, 6985, 220, 24032, 71870, 323, 198, 90963, 35208, 653, 754, 2230, 14403, 13, 578, 8271, 2092, 48764, 11, 865, 64651, 220, 323, 198, 21220, 84, 1994, 220, 1051, 7108, 6288, 11, 2288, 11, 439, 1664, 439, 77235, 662, 5414, 5043, 198, 318, 782, 7986, 8710, 1124, 1268, 3062, 433, 574, 311, 4148, 279, 198, 2484, 315, 1521, 83661, 304, 813, 2162, 627, 11874, 2919, 3010, 568, 1239, 14715, 33452, 902, 1903, 1461, 2733, 198, 84270, 42642, 11, 2533, 813, 523, 301, 1113, 22972, 1047, 539, 10717, 627, 27125, 1070, 2103, 459, 9987, 8331, 30, 1102, 574, 264, 471, 315, 1443, 343, 6985, 198, 65, 78852, 0, 1283, 1047, 70185, 35661, 264, 2536, 12, 3751, 458, 34479, 3691, 25, 14403, 198, 17249, 311, 19724, 220, 994, 433, 574, 2736, 2884, 17677, 0, 1115, 574, 264, 198, 838, 13429, 18228, 13, 12334, 775, 1047, 6052, 13, 1283, 574, 3201, 505, 279, 198, 300, 65264, 220, 323, 865, 64651, 220, 505, 279, 26129, 520, 2162, 13, 1283, 1167, 5795, 279, 198, 65, 78852, 1578, 323, 9435, 7191, 38494, 685, 311, 12459, 1193, 198, 3751, 321, 1534, 34479, 15657, 13, 1283, 1421, 283, 7018, 813, 18151, 304, 832, 1938, 627, 12487, 814, 13847, 872, 29106, 990, 11, 902, 1047, 2736, 1027, 198, 10655, 3131, 1403, 1667, 4227, 0, 1283, 1047, 65543, 51852, 323, 270, 543, 2411, 16853, 7184, 11, 27397, 264, 50351, 449, 3217, 304, 9455, 54742, 323, 198, 18883, 287, 57709, 31767, 1903, 1790, 810, 5647, 311, 1461, 1109, 433, 1047, 198, 15145, 13, 1283, 1101, 13205, 311, 656, 264, 39042, 323, 26587, 81155, 1306, 312, 9469, 1837, 356, 4622, 4716, 13398, 423, 9311, 4157, 50, 198, 8848, 413, 287, 2162, 13, 1628, 311, 4822, 704, 315, 279, 26129, 3156, 279, 77235, 18722, 778, 2101, 19671, 1047, 1027, 12860, 323, 279, 14891, 19354, 1047, 198, 82850, 7882, 311, 264, 2204, 4857, 627, 2059, 343, 6985, 1101, 11384, 30118, 2968, 220, 323, 18710, 1174, 264, 3541, 934, 306, 198, 35686, 369, 10504, 5157, 627, 12243, 20671, 40090, 198, 12243, 6680, 7410, 220, 374, 832, 315, 279, 30689, 5435, 311, 4495, 198, 30096, 22541, 287, 311, 11217, 627, 791, 1455, 3062, 2349, 311, 1304, 374, 311, 3009, 1701, 49750, 198, 300, 304, 11033, 1174, 15600, 11, 477, 12782, 660, 47497, 13, 4418, 956, 1005, 409, 24712, 72720, 7058, 660, 11033, 477, 15600, 3060, 1606, 315, 279, 69996, 25793, 304, 1124, 627, 17259, 311, 4106, 14403, 477, 4106, 3090, 422, 264, 4106, 43450, 374, 409, 274, 2757, 11, 477, 198, 3852, 315, 279, 47497, 2728, 304, 279, 11363, 3857, 13, 1442, 387, 6892, 2085, 198, 88860, 483, 11141, 499, 8834, 343, 3340, 11, 1935, 459, 1417 ]
0xBreath/holistic-books
of people who stay in therapyfor many years. I don’ t believe in getting stuck in this sort of holding pattern. For true spiritual develo pment to occur, you must contin ually grow. Programs and self-help books are wonderful and great. There a re layers to personal growth that can and do unfold with repetition. However, if you find you rself repeating the same destructive behavior or mulling over past behavior, feeling s, or emotions, you will find it dif ficult to rea ch the sixth chakra l evel of consciousness. Instead of daydreaming about how you have this defect or that ingrained behavior or emotion, visualize yourself as healed and strong. Spend time daydreaming about living in a dif ferent mind-set and staying there. Living your life dif ferently is as easy as a decision. My philosophy: get the lesson and move on. W e all have a l imited amount of time on this planet. Y ou might have seventy, eighty, ninety, or one hundred years total. W ith the knowledge that your time is limited, why not make the best use of it by working with universal ener gy instead of against it? When you make the decision to accept this spiritual aspect of who you are, you will see yourself grow by leaps and bounds. Healing Ajna DAIL Y AFFIRMA TION I follow the path of truth. Healing the Physical Body T o h elp relieve blockages or im balances in the sixth chakra, it’ s important to choose life-af firming foods, clean water, and a healthy, toxin-free living environment. Move your body daily and practice meditation. Living in this manner is essential as you awaken each of the chakras. However, if you wish to experien ce the physical lightness that brings to you the gifts of the sixth chakra, you must keep you r body free of toxins. Of course, you can’ t control everything in your environment, but try to control what you can.Y ou wil l have increased ability to access your intuition if you spend time in nature. Y our body will s ync up with the rhythms of nature, and you will experience more flow in your life. Y OGA E YE E XERCISES Great for strengthening the cone s and rods in the eyes as well as stimulating the brain, these yoga eye exerc ises take only two to three minutes to do. Remove your glasses or contact lenses. Sit tall with your palms on your lap facing up. Keep your head steady. Repeat each of the follo wing three exercises ten times: Look up to the right and down to the left. Then look up to the left and down to the right. Look side to side, as if you were trying to look at each ear. Look up between your eyebrows, and look down toward your chin. Finally, look toward your nose, and hold for twenty to thirty seconds. When y ou’re finished, rub your hands together to create frictio n and heat. Place the heels of your hands over your eyes, and hold for about thirty seconds. Still holding your hands over your eyes, gently move the heels of your han ds in a circular motion over your eyes to massage t hem. When you’re finished, remove your hands and open your eyes. L IGHT T HERAPY In additi on to eye exercises, you can strengthen your sense of sight and help heal a whole hos t of diseases by using light therapy. The best source of light therapy, of course, is the sun. N ever stare directly at the sun. However, you can stare at the sun with your eyes closed. Y ou can also try circular eye motions: with your eyes closed, look toward the sun and trace its shape by moving your eyes in a clo ckwise motion and then switching to counterclockwise. Do this sunn ing therapy for ten minutes daily. In the winter you can achieve a similar ef fect by using a full-spectrum light box designed for light therapy. According to a M ayo Clinic article, t he ligh t box should provide an exposure to 10,000 lux of light and emit as little ultraviolet light as possible to av oid skin and eye damage. In the same waythat you wouldn’ t look directly at the sun for your eye exercises, avoid staring d irectly at the light box. Consult your eye doctor befor e using any type of light the rapy for your ey es if you have glaucoma, cataracts, or eye damage from diabetes. Y OGA A SANAS AND P RANA Y AMA E XERCISES T O H EAL THE S IXTH C HAKRA Practice these breathing techni ques and poses to help balanc e the Ajna chakra. T o view a video demo of these exer cises, go to www.youtube.com/c/MichelleFondinAuthor. Click on the Playlists tab, and select Chakra Healing Asanas & Pranayamas. Scr oll down the list until you find the one you’r e looking for. Alternate-Nostril Br eathing — Nadi Shodhana : The practice of nadi shodhana synchronizes the hemispheres of the brain. Begin by sitting with your back straight and your eye s closed. Place your left hand on your lap, with you r palm facing up. T ake your right hand and place your index and middle fingers on the third eye in between your eyebrows. Gently rest your right thu mb on your right nostri l. Rest the inside of your folded ring finger on your left nostril. T o begin, inhale through both nostrils and exhale through both nostrils with your lips closed. Block your right nostril with your thumb, and inhale through your left nostril for the count of two. Block both nostrils and hold for six. Th en exhale through your right nostril for the count of four. In hale through your right nostril for two, hold both for six, and then exhale through your le ft nostril for four. Keep the same counts as you alternate. Repeat this breathing pattern for two to five minutes. Bee Br e ath — Bhramari : This breathing technique helps clear sinuses, alleviate headaches, and calm nerves. Sit in a comfortable position with your spine tall, and close your eyes. Gently press the middle and ring fingerof each hand a gainst your eyes, covering them completely. Press your thumbs into your inner ears to close of f your hearing. Rest your pinkies on your up per cheeks and your in dex fingers slightly above your eyebrows. T ake a deep bre ath through your nose and into your belly, and exhale by saying HUM or OM, em phasizing the mmmmm sound and prolonging it for the entire exhalation. Y ou will feel the vibration throughout your head. Repeat for at least ten breaths. Y ou will feel invigorated after completing the bee breath. Eagle Pose — Garudasana : Eagle pose is great for cultivating focus and one-pointed attention. Begin b y standing on your mat with your feet parallel. Bend your knees and lif t your right leg up to cross it over your left. If you can, wrap your toes be hind your left calf. Y ou will now be in a seated-chair squ at with one leg wrapped around the other. If it’ s too dif ficult to wrap your toes, place your right foot on the side of your left leg. Y ou can also plac e a yoga block next to your left foot and place your r ight toes on the bloc k. Next, bring your ar ms up and bend them so they look like goalposts. W rap your right arm underneath your left, and threa d it around until your two h ands meet at the top. Y our arms will be interlac ed together like you r legs. W ith your arms wrapped, bring both palms together. Y our focal point will be your hands. Bring your elbows up and your shoulders down. Hold the pose for four to six breaths, and then repeat o n the other side. Dolphin Pose — Ardha Pincha Mayurasana : Dolphin pose is a mild inversion, or a y oga pose in wh ich the head is at a lower position than the heart. As a gene ral rule, inversions are good for all the upper chakras. Even though dolphin pose looks easy, it’ s actually quite challenging a s it requires some upper body strength. Y ou can work your way up to holding dolphin pose by taking frequent breaks. Dolphin pose is also good practice to build your strength for a yoga headstand. Begin on your h ands and knees on your mat. Lay your forearms on the mat with your elbows directly u nderneath your shoulders. Fold your hands together in front of you, and lock your shoulders back to create a stable base. Y o ur hands and elbows will form a triangle. Gently lift yo ur knees of f the floor and walk your feet tow ard your elbows until you’re in an upside-down letter V. Y our head will float above the floor. Lift your tailbone high into the sky. T o enhance the ene r
[ 315, 1274, 889, 4822, 304, 15419, 2000, 1690, 1667, 13, 358, 1541, 529, 259, 4510, 304, 3794, 16075, 304, 420, 3460, 315, 10168, 198, 14676, 13, 1789, 837, 18330, 90870, 78, 281, 479, 311, 12446, 1174, 499, 2011, 2018, 577, 750, 3139, 16853, 10920, 82, 323, 659, 50570, 6603, 527, 11364, 323, 2294, 13, 2684, 264, 312, 13931, 311, 198, 30712, 6650, 220, 430, 649, 323, 656, 28572, 449, 54515, 13, 4452, 1174, 422, 499, 198, 3990, 499, 436, 726, 40916, 279, 1890, 40652, 7865, 477, 296, 61736, 927, 3347, 198, 56966, 1174, 8430, 274, 11, 477, 21958, 11, 499, 690, 1505, 433, 1422, 282, 3951, 311, 312, 64, 523, 279, 26084, 198, 331, 52503, 326, 384, 899, 315, 25917, 13, 12361, 315, 1938, 57291, 287, 922, 1268, 499, 617, 198, 576, 23011, 477, 430, 81336, 2692, 7865, 477, 20356, 11, 51187, 6261, 439, 198, 383, 5962, 323, 3831, 13, 78137, 892, 1938, 57291, 287, 922, 5496, 304, 264, 1422, 18728, 306, 198, 38824, 25063, 323, 19994, 1070, 13, 19048, 701, 2324, 1422, 18728, 4501, 374, 439, 4228, 439, 264, 198, 65038, 13, 3092, 19675, 25, 636, 279, 18228, 323, 3351, 389, 627, 54, 384, 682, 617, 264, 326, 737, 1639, 3392, 315, 892, 389, 420, 11841, 13, 816, 6033, 2643, 617, 198, 325, 688, 88, 1174, 80679, 1174, 78976, 1174, 477, 832, 7895, 1667, 2860, 13, 468, 78942, 279, 6677, 430, 198, 22479, 892, 374, 7347, 11, 3249, 539, 1304, 279, 1888, 1005, 315, 433, 555, 3318, 449, 198, 96400, 38556, 29720, 4619, 315, 2403, 433, 30, 3277, 499, 1304, 279, 5597, 311, 198, 10543, 420, 18330, 13189, 315, 889, 499, 527, 11, 499, 690, 1518, 6261, 3139, 555, 198, 273, 2690, 323, 14597, 627, 1548, 6260, 41757, 3458, 198, 35, 6093, 816, 70038, 2871, 4940, 350, 1294, 198, 40, 1833, 279, 1853, 315, 8206, 627, 49741, 279, 28479, 14285, 198, 51, 297, 305, 658, 79, 48839, 2565, 1154, 477, 737, 39954, 304, 279, 26084, 523, 52503, 11, 433, 529, 274, 3062, 198, 998, 5268, 2324, 12, 2642, 7626, 287, 15657, 11, 4335, 3090, 1174, 323, 264, 9498, 1174, 98534, 12862, 5496, 198, 24175, 13, 14903, 701, 2547, 7446, 323, 6725, 33862, 13, 19048, 304, 420, 198, 76, 4992, 374, 7718, 439, 499, 42518, 1855, 315, 279, 523, 587, 13075, 13, 4452, 1174, 422, 499, 198, 82199, 311, 2183, 3675, 3846, 279, 7106, 3177, 2136, 430, 12716, 311, 499, 279, 21258, 315, 279, 198, 51464, 339, 523, 52503, 11, 499, 2011, 2567, 499, 436, 2547, 1949, 315, 62186, 13, 5046, 3388, 11, 499, 649, 529, 259, 198, 2935, 4395, 304, 701, 4676, 11, 719, 1456, 311, 2585, 1148, 499, 649, 7659, 6033, 31331, 326, 617, 7319, 5845, 311, 2680, 701, 57351, 422, 499, 8493, 198, 1712, 304, 7138, 13, 816, 1057, 2547, 690, 274, 379, 1031, 709, 449, 279, 81821, 315, 7138, 11, 323, 499, 198, 14724, 3217, 810, 6530, 304, 701, 2324, 627, 56, 507, 16519, 220, 469, 78048, 220, 469, 1630, 28534, 9311, 50, 198, 22111, 369, 48513, 279, 22949, 274, 323, 58000, 304, 279, 6548, 439, 1664, 439, 65792, 198, 1820, 8271, 11, 1521, 27102, 8071, 7584, 374, 288, 1935, 1193, 1403, 311, 2380, 4520, 311, 656, 627, 13319, 701, 29247, 477, 3729, 36057, 13, 29508, 16615, 449, 701, 75818, 389, 701, 24301, 198, 69, 4628, 709, 13, 13969, 701, 2010, 24981, 662, 45901, 1855, 315, 279, 9630, 385, 20611, 2380, 198, 327, 48815, 5899, 3115, 512, 10596, 709, 311, 279, 1314, 323, 1523, 311, 279, 2163, 13, 5112, 1427, 709, 311, 279, 2163, 323, 198, 2996, 311, 279, 1314, 627, 10596, 3185, 311, 3185, 11, 439, 422, 499, 1051, 4560, 311, 1427, 520, 1855, 2487, 16853, 10596, 709, 1990, 701, 61225, 11, 323, 1427, 1523, 9017, 701, 46175, 627, 24901, 1174, 1427, 9017, 701, 19689, 11, 323, 3412, 369, 17510, 311, 27219, 6622, 627, 4599, 379, 6033, 3207, 8220, 11, 10485, 701, 6206, 3871, 311, 1893, 1448, 858, 822, 308, 323, 8798, 627, 17826, 279, 34460, 315, 701, 6206, 927, 701, 6548, 11, 323, 3412, 369, 922, 27219, 198, 17859, 13, 16782, 10168, 701, 6206, 927, 701, 6548, 11, 30373, 3351, 279, 34460, 315, 198, 22479, 19538, 11729, 304, 264, 28029, 11633, 927, 701, 6548, 311, 6378, 259, 17728, 13, 3277, 198, 9514, 3207, 8220, 11, 4148, 701, 6206, 323, 1825, 701, 6548, 627, 43, 47280, 2607, 220, 350, 16019, 2599, 56, 198, 644, 923, 12583, 389, 311, 8071, 23783, 11, 499, 220, 649, 20259, 701, 5647, 315, 14254, 323, 1520, 198, 383, 278, 264, 4459, 68927, 259, 315, 19338, 555, 220, 1701, 3177, 15419, 662, 578, 1888, 2592, 315, 3177, 198, 46755, 1174, 315, 3388, 11, 374, 279, 7160, 13, 452, 3596, 46943, 6089, 520, 279, 7160, 13, 4452, 1174, 499, 198, 4919, 46943, 520, 279, 7160, 449, 701, 6548, 8036, 13, 816, 6033, 649, 1101, 1456, 28029, 8071, 198, 76, 41356, 25, 449, 701, 6548, 8036, 11, 220, 1427, 9017, 279, 7160, 323, 11917, 1202, 6211, 555, 198, 66215, 701, 6548, 304, 264, 5405, 39713, 4583, 11633, 323, 1243, 28865, 311, 198, 1868, 3035, 1039, 4583, 13, 3234, 420, 7160, 77, 6892, 15419, 369, 5899, 4520, 7446, 662, 763, 279, 198, 84028, 499, 649, 11322, 264, 4528, 31469, 282, 440, 555, 1701, 264, 2539, 1355, 39806, 3177, 3830, 198, 5919, 1571, 369, 3177, 15419, 662, 10771, 311, 264, 386, 264, 16417, 40324, 4652, 11, 220, 259, 568, 326, 1108, 259, 3830, 198, 5562, 3493, 459, 14675, 311, 220, 605, 11, 931, 14379, 315, 3177, 323, 17105, 439, 2697, 198, 360, 376, 85311, 3177, 439, 3284, 311, 1860, 49866, 6930, 323, 8071, 5674, 13, 763, 279, 1890, 1648, 9210, 499, 8434, 529, 259, 1427, 6089, 520, 279, 7160, 369, 701, 8071, 23783, 11, 5766, 198, 267, 3329, 294, 220, 1248, 398, 520, 279, 3177, 3830, 13, 220, 20556, 701, 8071, 10896, 387, 2000, 384, 1701, 904, 198, 1337, 315, 3177, 279, 7477, 88, 369, 701, 3999, 1560, 422, 499, 617, 2840, 2933, 82945, 11, 272, 6526, 11613, 11, 477, 8071, 198, 43965, 505, 20335, 627, 56, 507, 16519, 220, 362, 60800, 1950, 3651, 220, 393, 432, 39874, 816, 52889, 220, 469, 1630, 28534, 9311, 50, 350, 507, 220, 473, 469, 984, 3247, 198, 50, 40812, 3701, 220, 356, 473, 12173, 5726, 198, 89592, 1521, 27027, 2869, 72, 92484, 323, 34103, 311, 1520, 9839, 1149, 384, 279, 41757, 3458, 198, 331, 52503, 627, 51, 297, 1684, 264, 2835, 17074, 315, 1521, 506, 261, 272, 5014, 11, 733, 311, 198, 2185, 662, 45078, 916, 2971, 10482, 718, 6853, 37, 2159, 258, 7279, 16853, 2677, 389, 279, 7199, 18035, 5769, 11, 323, 3373, 198, 1163, 52503, 49741, 1666, 26997, 612, 2394, 276, 352, 29189, 16853, 66608, 297, 657, 1523, 279, 1160, 3156, 499, 1505, 279, 832, 499, 529, 81, 384, 3411, 369, 16853, 84142, 99076, 496, 321, 3320, 384, 44661, 2001, 452, 2836, 1443, 347, 84203, 551, 220, 578, 6725, 315, 308, 2836, 198, 939, 347, 84203, 14453, 4861, 279, 17728, 285, 65733, 315, 279, 8271, 13, 19110, 555, 11961, 449, 198, 22479, 1203, 7833, 323, 701, 8071, 274, 8036, 13, 11004, 701, 2163, 1450, 389, 701, 24301, 345, 4291, 499, 436, 33552, 13176, 709, 13, 350, 264, 441, 220, 701, 1314, 1450, 323, 2035, 701, 1963, 323, 198, 20231, 19779, 389, 279, 4948, 8071, 304, 1990, 701, 61225, 13, 480, 4501, 2800, 701, 198, 1315, 78474, 10221, 389, 701, 1314, 31712, 462, 326, 13, 9240, 279, 4871, 315, 701, 48135, 10264, 14654, 198, 263, 701, 220, 2163, 57426, 321, 13, 350, 297, 3240, 1174, 60537, 1604, 1555, 2225, 57426, 8839, 323, 57759, 1604, 198, 20322, 2225, 57426, 8839, 449, 701, 23726, 8036, 13, 8527, 701, 1314, 57426, 321, 449, 198, 22479, 25015, 11, 323, 60537, 1604, 1555, 701, 2163, 57426, 321, 369, 279, 1797, 315, 1403, 13, 8527, 198, 21704, 57426, 8839, 323, 3412, 369, 4848, 13, 666, 665, 57759, 1604, 1555, 701, 1314, 57426, 321, 369, 279, 198, 1868, 315, 3116, 662, 763, 111485, 1555, 701, 1314, 57426, 321, 369, 1403, 11, 3412, 2225, 369, 4848, 345, 438, 1243, 220, 57759, 1604, 1555, 701, 514, 10702, 57426, 321, 369, 3116, 662, 13969, 279, 1890, 14921, 439, 198, 9514, 25631, 13, 45901, 420, 27027, 5497, 369, 1403, 311, 4330, 4520, 627, 33, 2176, 3320, 384, 12004, 2001, 31930, 2453, 2850, 551, 220, 1115, 27027, 15105, 8779, 2867, 7589, 4881, 345, 278, 3532, 6629, 55403, 11, 323, 19858, 50581, 13, 29508, 304, 264, 10882, 2361, 449, 198, 22479, 35776, 16615, 11, 323, 3345, 701, 6548, 13, 480, 4501, 3577, 279, 6278, 323, 220, 10264, 14654, 1073, 1855, 1450, 264, 8895, 267, 701, 6548, 11, 18702, 1124, 6724, 662, 8612, 701, 198, 96490, 1139, 701, 9358, 25212, 311, 3345, 315, 282, 701, 11011, 13, 9240, 701, 18718, 552, 389, 198, 22479, 709, 824, 54888, 323, 701, 304, 81001, 19779, 10284, 3485, 701, 61225, 627, 51, 264, 441, 264, 5655, 5395, 12004, 1555, 701, 19689, 323, 1139, 701, 36517, 1174, 323, 57759, 1604, 555, 198, 82, 17718, 473, 2864, 220, 477, 48437, 1174, 991, 1343, 300, 4954, 279, 296, 3906, 3906, 220, 5222, 323, 33482, 287, 433, 369, 198, 1820, 4553, 506, 12130, 367, 13, 816, 6033, 690, 2733, 279, 48913, 6957, 701, 2010, 627, 39818, 369, 520, 3325, 5899, 11745, 82, 13, 816, 6033, 690, 2733, 1558, 71070, 660, 1306, 220, 27666, 198, 1820, 38328, 11745, 627, 36, 33774, 51473, 2001, 12471, 54841, 3444, 551, 220, 36895, 17477, 374, 2294, 369, 99139, 5357, 323, 198, 606, 16983, 291, 6666, 13, 19110, 293, 379, 11509, 389, 701, 5634, 449, 701, 7693, 198, 47203, 13, 48838, 701, 31624, 323, 10345, 259, 701, 1314, 2531, 709, 311, 5425, 433, 927, 701, 2163, 627, 2746, 499, 649, 11, 15411, 701, 45713, 387, 48419, 701, 2163, 65643, 13, 816, 6033, 690, 1457, 387, 304, 264, 198, 325, 660, 79781, 8330, 520, 449, 832, 2531, 20037, 2212, 279, 1023, 662, 1442, 433, 529, 274, 2288, 1422, 282, 3951, 198, 998, 15411, 701, 45713, 11, 2035, 701, 1314, 4579, 389, 279, 3185, 315, 701, 2163, 2531, 13, 816, 6033, 649, 198, 19171, 29960, 384, 264, 27102, 2565, 1828, 311, 220, 701, 2163, 4579, 323, 2035, 701, 436, 220, 492, 45713, 389, 198, 1820, 41840, 597, 13, 9479, 11, 4546, 701, 802, 10030, 709, 323, 37920, 1124, 779, 814, 1427, 1093, 198, 35039, 12953, 13, 468, 7477, 701, 1314, 6916, 30456, 701, 2163, 11, 323, 270, 5325, 294, 433, 2212, 198, 39830, 701, 1403, 305, 323, 82, 3449, 520, 279, 1948, 13, 816, 1057, 11977, 690, 387, 958, 93529, 1608, 3871, 198, 4908, 499, 436, 14535, 13, 468, 78942, 701, 11977, 220, 20037, 11, 4546, 2225, 75818, 3871, 662, 816, 1057, 198, 69, 3768, 1486, 690, 387, 701, 6206, 13, 40224, 701, 82012, 709, 323, 701, 28004, 198, 2996, 13, 23588, 279, 17477, 369, 3116, 311, 4848, 11745, 82, 11, 323, 1243, 13454, 297, 308, 279, 1023, 198, 3002, 627, 35, 44070, 258, 51473, 2001, 75007, 4317, 17929, 6583, 3297, 19879, 3444, 551, 220, 96096, 17477, 374, 264, 23900, 198, 258, 4464, 11, 477, 264, 379, 297, 6885, 17477, 304, 421, 10864, 279, 2010, 374, 520, 264, 4827, 2361, 1109, 279, 198, 18207, 13, 1666, 264, 15207, 436, 278, 6037, 11, 1558, 36379, 527, 1695, 369, 682, 279, 8582, 523, 587, 13075, 13, 7570, 198, 4636, 99269, 17477, 5992, 4228, 1174, 433, 529, 274, 3604, 5115, 17436, 264, 274, 433, 7612, 198, 15031, 8582, 2547, 8333, 13, 816, 6033, 649, 990, 701, 1648, 709, 311, 10168, 99269, 198, 2972, 555, 4737, 21420, 18808, 13, 96096, 17477, 374, 1101, 1695, 6725, 311, 1977, 198, 22479, 8333, 369, 264, 27102, 2010, 2752, 627, 11382, 389, 701, 305, 323, 82, 323, 31624, 389, 701, 5634, 13, 45024, 701, 2291, 16293, 389, 279, 198, 8637, 449, 220, 701, 82012, 6089, 577, 220, 910, 28917, 701, 28004, 13, 61573, 701, 6206, 198, 998, 3522, 304, 4156, 315, 499, 11, 323, 5409, 701, 28004, 1203, 311, 1893, 264, 15528, 198, 3231, 13, 816, 297, 4433, 6206, 323, 82012, 690, 1376, 264, 22217, 13, 480, 4501, 12157, 30596, 4433, 31624, 315, 282, 198, 1820, 6558, 220, 323, 4321, 701, 7693, 16190, 85009, 701, 82012, 3156, 499, 3207, 304, 459, 36941, 15220, 6661, 650, 662, 816, 1057, 2010, 690, 220, 2273, 3485, 279, 220, 6558, 662, 53535, 701, 9986, 20337, 1579, 198, 18614, 279, 13180, 662, 350, 297, 18885, 279, 665, 68, 436 ]
0xBreath/holistic-books
ana chakra, activ ating the vishuddhi c hakra. Kumbhaka: breath retention. Kundalini: latent energy. Kurma nadi: nadi associated with the vishuddhi chakra. Its control brings the ability to liv e without ph ysical sustenance. Limbic system: group of structures in the brain associated with certain aspects of emotion and memor y.Lingam: a symbol representing Lord Shiva, the male aspect of creation; the symbol of the astral bod y. Loka: world, dimension or plane of e xistence or consciousness. Lord Shiva: archetypal renunciate and yogi who dwells in meditation high in the Himala yas; Hindu god; destr oyer of the univ erse. Mala: a rosary-like string of beads used in medita tional practices. Manas: one aspect of mind; the mental faculty of comparing, classifying and reasoning. Manas shakti: mental force. Manipura: the Sanskrit name for the solar plexus (literally means ‘city of gems’). Mantra: a sound or a series of sounds having physical, psychic or spiritual potency w hen recited in a certain pr escribed manner. Marg: path. Maya: principle of illusion. Moksha: liberation from the cy cle of births and dea ths. Moola bandha: yogic practice of stimulating the muladhara chakra for the awakening of kundalini. It is practised by contracting the perineum in males or the cervix in females. Mool prakruti: basic nature. Mudra: a psychic attitude often e xpressed by a physical gestur e, movement or posture that affects the flow of psychic energy in the bod y. Muladhara: the base r oot chakra. Nada: sound, especially inner sound. Nada yoga: the yoga of subtle sound. Nadi: a channel of ener gy.Neti: hatha yoga cleansing technique in which warm saline water is passed through the nasal passages; one of the sha tkarmas. Nirvana: enlightenment, samadhi; harmony between individual consciousness and univ ersal consciousness. Om: the underlying sound of creation; the mantra from which all others have come. Panch mahabhoot: the five prime elements. Parasympathetic nervous system: division of the autonomic nervous system concerned with restorative processes and relaxation of the body and mind. Pashu: the instinctual or animal aspect of human beha viour. Pineal gland: small pine-shaped endocrine gland in the mid-brain directly behind the e yebrow centre; the physical correlate of the ajna c hakra. Pingala: conductor and channel of prana shakti or vital force, located on the right side of the psy chic body; the ‘tha’ of ha tha yoga. Prakriti: the basic principle or substance of the entire phenomenal or manifest w orld composed of the thr ee gunas or a ttributes. Prana: life force in the body; bio-energy in general; the vital energy that operates in the r egion of the heart and lungs; the psy chic equivalent of the physical breath. Prana shakti: pranic or vital f orce. Pranayama: yogic practice of manipulating and controlling the flow of prana in the subtle bod y by controlling the r espiratory process. Prithvi tattva: the earth element. Purusha: consciousness; the spirit or pur e self. Rajas: one of the gunas (le vels of consciousness).Rudra granthi: the knot of Shiva, the psychic knot within the ajna chakra that symbolises attachment to siddhis or higher mental attributes that must be transcended bef ore full awakening of kundalini can occur. Sacral plexus: nerve plexus in the back wall of the pelvis associated with the swadhisthana and m uladhara c hakras, and responsible for the functioning of the urinar y and reproductive systems. Sadhaka: a disciple. Sadhana: spiritual discipline or practice. Sadhu: a holy man. Sahasrara: the 1000-petalled lotus or chakra manifesting at the top of the head; the highest psychic centre; the threshold between psychic and spiritual r ealms that contains all the c hakras belo w it. Samadhi: state of being above mortal existence; all-knowing and all- pervading state of being; the fulfilment of meditation; a union with the object of medita tion and univ ersal consciousness. Samana: vital ener gy operating in the r egion of the na vel. Sankalp: spiritual r esolve. Sankalpa shakti: willpower. Sanskar: family values or disposition. Sat-chit-ananda: a state of inner b liss. Satsang: spiritual guidance, discussion and instruction fr om a guru. Sattva: one of the three gunas of prakruti; the pure or equilibrated state of mind or na ture. Shakti: power, energy; the feminine aspect of cr eation. Shambhavi mudra: mudra name after Shambhu or Shiva focusing the eyes on bhrumadh ya. Shanti: peace.Shatkarma: rightful action (good kar ma). Shiva lingum: oval-shaped stone that is the symbol of Shiva consciousness or the astral bod y. Shuddhi: purification. Siddha: adept, yogi; one w ho has contr ol over nature, matter and mind. Siddhi: perfection. Solar plexus: intersection of a group of nerves in the abdominal region; the physical manifesta tion of the manipura c hakra. Soma: a plant used by the Rishis of ancient India for the purpose of spiritual awakening and mortality. Sushumna nadi: the most important psychic passagewa y. It flows in the central canal within the spinal cor d. Swadhisthana: the sacral c hakra (literally means ‘centr e of taste’). Swami: one who is the master of their o wn mind. Swara yoga: the science of the br eath cycle. Swayambhu: self-created. Sympathetic nervous system: the division of the autonomic nervous system responsible for maintaining the physical activity of the organ systems and expenditur e of energy. Tamas: darkness; inertia. Tanmatra: the fives senses: sight, hearing, taste, touch, smell, and the sixth sense, intuition. Tantra: the ancient science that uses specific techniques to expand and liberate the consciousness fr om its limita tions. Tapasya: the practice of austerity; purifying the body of deficiencies and weaknesses.Trataka: the meditational yoga technique that involves steadily gazing at an object. Trishula: the three-pronged implement held by Lord Shiva; it symbolises the three nadis. Udana: the vital ener gy operating above the throat. Uddiyana bandha: literally ‘flying upwards’; a yogic practice of pranic manipulation utilising the abdominal m uscles and or gans. Vairagya: non-attachment. Vajra mudra: contraction of the v ajra nadi. Vajra nadi: the nadi that connects the expression of sexual energy with the brain and is concer ned with the f low of ojas, the highest f orm of energy in the human bod y (concentra ted in semen). Vasana: desires that are the driving force behind every thought and action of life. Vastu: the Indian system of ar chitecture. Vastu shastra: the Indian scriptur e of architecture. Vayu: refers to the ener gy associated with eac h chakra (literally mean ‘wind’). Vedanta: the ultima te philosoph y of the V edas. Vedas: the oldest religious texts of the Aryans, written more than 5000 years ago. Vishnu: Hindu god; pr eserver of the univ erse. Vishuddhi: refers to the thr oat chakra (literally means ‘pur e’). Vritti: a modification arising in consciousness, likened to the circular wave pattern emanating when a stone is dr opped into a still pool of wa ter. Vyana: vital ener gy that pervades the w hole body. Yantra: a symbolic design used for concentration and meditation; the visual form of a mantra.Yoga: methods and practices leading to the union of individual human consciousness with the divine principle. Yoga nidras: psychic sleep; yogic practice in which we can raise ourselves from the mundane sta te of body consciousness. Yoga Sutras: text written by Patanjali delineating the eightfold path of raja yoga, the systematic path of meditation that culminates in the samadhi experience. OceanofPDF.comB i b l i o g r a p h y Athavale, Jayant Balaji and Kunda Jayant Athavale, Introduction to Spirituality, vols 1-21, Sana tan Bhara tiya
[ 3444, 198, 331, 52503, 11, 4197, 520, 287, 279, 348, 819, 8512, 6151, 272, 305, 52503, 627, 42, 3635, 71, 13637, 25, 11745, 38231, 627, 42, 1263, 278, 6729, 25, 42767, 4907, 627, 42, 87679, 308, 2836, 25, 308, 2836, 5938, 449, 279, 348, 819, 8512, 6151, 523, 52503, 13, 11699, 2585, 12716, 279, 198, 2968, 311, 15471, 384, 2085, 1343, 32910, 950, 10446, 10431, 16853, 43, 21495, 292, 1887, 25, 220, 1912, 315, 14726, 304, 279, 8271, 5938, 449, 3738, 13878, 198, 1073, 20356, 323, 16420, 379, 1236, 287, 309, 25, 264, 7891, 14393, 10425, 1443, 10126, 11, 279, 8762, 13189, 315, 9886, 26, 279, 198, 19314, 315, 279, 23112, 278, 30111, 379, 627, 43, 31866, 25, 1917, 11, 13167, 477, 11277, 315, 384, 865, 81624, 477, 25917, 16853, 52182, 1443, 10126, 25, 5438, 295, 1100, 278, 5790, 1371, 6629, 323, 42453, 72, 889, 14156, 6572, 304, 33862, 1579, 304, 198, 1820, 76438, 64, 106989, 26, 36142, 10087, 26, 409, 496, 297, 27253, 315, 279, 653, 344, 2781, 325, 627, 44, 6181, 25, 264, 27282, 661, 12970, 925, 315, 55308, 1511, 304, 1812, 6388, 259, 4001, 12659, 16853, 1692, 300, 25, 832, 13189, 315, 4059, 26, 279, 10723, 22291, 315, 27393, 1174, 538, 7922, 323, 198, 20489, 287, 627, 1692, 300, 559, 10114, 72, 25, 220, 10723, 5457, 627, 93976, 5808, 25, 279, 15089, 88650, 836, 369, 279, 13238, 281, 2635, 355, 320, 69191, 750, 3445, 3451, 9103, 315, 198, 100153, 529, 4390, 1692, 2221, 25, 264, 5222, 477, 264, 4101, 315, 10578, 3515, 7106, 11, 50217, 477, 18330, 198, 19644, 2301, 289, 48916, 1421, 1639, 304, 264, 3738, 550, 1560, 17890, 11827, 16853, 45337, 25, 1853, 627, 11356, 64, 25, 17966, 315, 41919, 627, 44, 564, 15605, 25, 55633, 505, 279, 9693, 11551, 315, 66332, 323, 409, 64, 270, 82, 627, 44, 47080, 7200, 4317, 25, 42453, 292, 6725, 315, 65792, 279, 15975, 52687, 5169, 523, 52503, 369, 279, 198, 675, 74462, 315, 597, 1263, 278, 6729, 13, 1102, 374, 3856, 4147, 555, 60506, 279, 824, 483, 372, 304, 198, 1764, 645, 477, 279, 52664, 953, 304, 28585, 16853, 44, 1786, 550, 587, 81, 32973, 25, 6913, 7138, 627, 44, 664, 969, 25, 264, 50217, 19451, 3629, 384, 865, 14655, 555, 264, 7106, 13033, 324, 384, 11, 7351, 477, 198, 2252, 554, 430, 22223, 279, 6530, 315, 50217, 4907, 304, 279, 30111, 379, 627, 60255, 52687, 5169, 25, 279, 2385, 436, 297, 354, 523, 52503, 627, 45, 2649, 25, 5222, 11, 5423, 9358, 5222, 627, 45, 2649, 27102, 25, 279, 27102, 315, 27545, 5222, 627, 45, 2836, 25, 264, 5613, 315, 38556, 29720, 17426, 72, 25, 52677, 64, 27102, 60052, 15105, 304, 902, 8369, 99107, 3090, 374, 5946, 198, 20322, 279, 72188, 47869, 26, 832, 315, 279, 16249, 17603, 2227, 300, 627, 45, 404, 68559, 25, 81869, 11, 10167, 329, 6151, 26, 26348, 1990, 3927, 198, 64589, 2136, 323, 653, 344, 55495, 278, 25917, 16853, 64588, 25, 279, 16940, 5222, 315, 9886, 26, 279, 68009, 505, 902, 682, 3885, 198, 19553, 2586, 627, 47, 3581, 44316, 67466, 1944, 25, 220, 279, 4330, 10461, 5540, 16853, 4368, 6539, 1331, 589, 5411, 23418, 1887, 25, 13096, 315, 279, 3154, 48228, 23418, 1887, 198, 444, 29644, 291, 449, 2800, 63465, 11618, 323, 43685, 315, 279, 2547, 323, 198, 38824, 627, 47, 1003, 84, 25, 279, 31655, 940, 477, 10065, 13189, 315, 3823, 2824, 64, 3355, 414, 627, 47, 483, 278, 67169, 25, 2678, 34697, 35831, 842, 78738, 67169, 304, 279, 5209, 31217, 467, 6089, 198, 30998, 485, 279, 384, 379, 3141, 654, 12541, 26, 279, 7106, 81584, 315, 279, 26514, 3458, 272, 305, 52503, 627, 70983, 6181, 25, 61856, 323, 5613, 315, 550, 3444, 559, 10114, 72, 477, 16595, 5457, 11, 7559, 389, 279, 198, 1315, 3185, 315, 279, 26200, 47994, 2547, 26, 279, 3451, 23218, 529, 315, 6520, 49588, 27102, 627, 3617, 587, 1018, 72, 25, 279, 6913, 17966, 477, 20278, 315, 279, 4553, 57492, 477, 198, 43415, 289, 477, 509, 24306, 315, 279, 8983, 37443, 6166, 300, 477, 264, 259, 3688, 627, 3617, 3444, 25, 2324, 5457, 304, 279, 2547, 26, 17332, 65487, 304, 4689, 26, 279, 16595, 4907, 430, 198, 3376, 988, 304, 279, 436, 8866, 290, 315, 279, 4851, 323, 45274, 26, 279, 26200, 47994, 13890, 315, 279, 198, 47692, 11745, 627, 3617, 3444, 559, 10114, 72, 25, 550, 32370, 477, 16595, 282, 477, 346, 627, 3617, 276, 352, 3105, 25, 42453, 292, 6725, 315, 63614, 323, 26991, 279, 6530, 315, 550, 3444, 198, 258, 279, 27545, 30111, 379, 555, 26991, 279, 436, 1560, 5682, 5382, 1920, 627, 3617, 411, 10176, 259, 1617, 6723, 25, 220, 279, 9578, 2449, 627, 47, 324, 1136, 64, 25, 25917, 26, 279, 9090, 477, 4087, 384, 659, 627, 49, 67922, 25, 832, 315, 279, 6166, 300, 320, 273, 348, 2053, 315, 25917, 570, 49, 664, 969, 16109, 339, 72, 25, 279, 51900, 315, 1443, 10126, 11, 279, 50217, 51900, 2949, 279, 26514, 3458, 523, 52503, 430, 198, 19314, 5014, 20581, 311, 274, 1810, 26301, 477, 5190, 10723, 8365, 430, 2011, 387, 198, 1485, 66, 2954, 58046, 16536, 2539, 75149, 315, 597, 1263, 278, 6729, 649, 12446, 16853, 94528, 3545, 281, 2635, 355, 25, 32015, 281, 2635, 355, 304, 279, 1203, 7147, 315, 279, 12077, 2749, 5938, 449, 279, 198, 2332, 329, 21843, 84203, 323, 296, 8725, 52687, 5169, 272, 98759, 13075, 11, 323, 8647, 369, 279, 31301, 198, 1073, 279, 4433, 14080, 379, 323, 42889, 6067, 627, 50, 52687, 13637, 25, 264, 84795, 16853, 50, 52687, 3444, 25, 18330, 26434, 477, 6725, 16853, 60765, 17156, 25, 264, 27823, 893, 627, 50, 93066, 81, 5169, 25, 279, 220, 1041, 15, 2320, 295, 4841, 2763, 355, 477, 523, 52503, 14794, 287, 520, 279, 1948, 315, 279, 198, 2025, 26, 279, 8592, 50217, 12541, 26, 279, 12447, 1990, 50217, 323, 198, 86390, 940, 436, 384, 278, 1026, 430, 5727, 682, 279, 272, 98759, 13075, 1689, 78, 289, 433, 627, 24903, 329, 6151, 25, 1614, 315, 1694, 3485, 49972, 14209, 26, 682, 100220, 287, 323, 682, 7058, 79, 651, 2277, 1614, 315, 1694, 26, 279, 64201, 479, 315, 33862, 26, 264, 11552, 449, 279, 198, 1735, 315, 1812, 6388, 73352, 323, 653, 344, 55495, 278, 25917, 16853, 24903, 3444, 25, 16595, 38556, 29720, 10565, 304, 279, 436, 8866, 290, 315, 279, 4415, 9231, 627, 50, 1201, 278, 79, 25, 18330, 436, 1560, 4035, 627, 50, 1201, 278, 6733, 559, 10114, 72, 25, 220, 690, 13477, 627, 47982, 29234, 25, 3070, 2819, 477, 46096, 627, 35982, 11843, 275, 19415, 10018, 25, 220, 264, 1614, 315, 9358, 293, 326, 1056, 627, 50, 1900, 526, 25, 18330, 19351, 1174, 10430, 323, 7754, 1448, 8019, 264, 60526, 627, 50, 1617, 6723, 25, 832, 315, 279, 2380, 6166, 300, 315, 550, 587, 81, 32973, 26, 279, 10748, 477, 3312, 321, 61666, 1614, 315, 198, 38824, 477, 4415, 259, 554, 627, 2059, 10114, 72, 25, 2410, 11, 4907, 26, 279, 46284, 13189, 315, 1589, 384, 367, 627, 2059, 3042, 71, 6321, 27275, 969, 25, 27275, 969, 836, 1306, 1443, 3042, 17156, 477, 1443, 10126, 21760, 279, 6548, 389, 198, 65, 4171, 372, 52687, 13835, 627, 2059, 15719, 25, 9096, 815, 9379, 74, 20306, 25, 99044, 1957, 320, 19045, 24318, 7643, 4390, 2059, 10126, 38172, 372, 25, 61137, 35831, 9998, 430, 374, 279, 7891, 315, 1443, 10126, 25917, 477, 198, 1820, 23112, 278, 30111, 379, 627, 2059, 8512, 6151, 25, 94536, 627, 50, 1810, 4317, 25, 76588, 11, 42453, 72, 26, 832, 289, 11640, 706, 6155, 8492, 927, 7138, 11, 5030, 323, 4059, 627, 50, 1810, 6151, 25, 39143, 627, 72041, 281, 2635, 355, 25, 19801, 315, 264, 1912, 315, 50581, 304, 279, 57056, 5654, 26, 279, 198, 47692, 14794, 64, 73352, 315, 279, 14951, 5808, 272, 305, 52503, 627, 50, 7942, 25, 264, 6136, 1511, 555, 279, 432, 819, 285, 315, 14154, 6890, 369, 279, 7580, 315, 18330, 198, 675, 74462, 323, 29528, 16853, 50, 1136, 372, 3458, 308, 2836, 25, 220, 279, 1455, 3062, 50217, 1522, 351, 365, 64, 379, 13, 1102, 28555, 304, 279, 8792, 198, 4919, 278, 2949, 279, 50112, 1867, 294, 627, 13521, 329, 21843, 84203, 25, 220, 279, 11347, 3545, 272, 305, 52503, 320, 69191, 750, 3445, 3451, 1189, 81, 384, 315, 12945, 529, 4390, 13521, 10830, 25, 832, 889, 374, 279, 7491, 315, 872, 297, 66580, 4059, 627, 13521, 5169, 27102, 25, 279, 8198, 315, 279, 1437, 384, 589, 11008, 627, 50, 3195, 3042, 17156, 25, 659, 72057, 627, 35767, 1331, 589, 5411, 23418, 1887, 25, 279, 13096, 315, 279, 3154, 48228, 23418, 1887, 198, 417, 43419, 369, 20958, 279, 7106, 5820, 315, 279, 2942, 6067, 323, 198, 327, 3825, 53030, 384, 315, 4907, 627, 51, 29189, 25, 27394, 26, 78552, 627, 77197, 8637, 969, 25, 279, 282, 1924, 38207, 25, 14254, 11, 11011, 11, 12945, 11, 5916, 11, 22843, 11, 323, 279, 26084, 198, 98935, 11, 57351, 627, 77197, 2221, 25, 279, 14154, 8198, 430, 5829, 3230, 12823, 311, 9407, 323, 198, 2808, 59768, 279, 25917, 1448, 8019, 1202, 4017, 64, 259, 919, 627, 24821, 6539, 64, 25, 279, 6725, 315, 61630, 26, 4087, 7922, 279, 2547, 315, 72946, 323, 198, 13451, 2136, 288, 8404, 61224, 25, 279, 1812, 50924, 27102, 15105, 430, 18065, 43071, 342, 6795, 520, 459, 198, 1735, 627, 1305, 819, 5724, 25, 279, 2380, 27748, 647, 291, 4305, 5762, 555, 10425, 1443, 10126, 26, 433, 7891, 5014, 220, 279, 198, 28956, 34634, 285, 627, 52, 46783, 25, 279, 16595, 38556, 29720, 10565, 3485, 279, 28691, 627, 52, 634, 16618, 3444, 7200, 4317, 25, 16280, 3451, 69, 6852, 45054, 529, 26, 264, 42453, 292, 6725, 315, 550, 32370, 198, 1543, 575, 2987, 4186, 3876, 279, 57056, 296, 603, 19153, 323, 477, 342, 598, 627, 53, 1334, 351, 7911, 25, 2536, 12, 22751, 627, 53, 1662, 969, 27275, 969, 25, 71895, 315, 279, 348, 26514, 969, 308, 2836, 627, 53, 1662, 969, 308, 2836, 25, 279, 308, 2836, 430, 34161, 279, 7645, 315, 7392, 4907, 449, 279, 198, 54160, 323, 374, 3613, 261, 54805, 449, 279, 282, 3428, 315, 297, 30826, 11, 279, 8592, 282, 68702, 315, 4907, 304, 198, 1820, 3823, 30111, 379, 320, 444, 1189, 969, 42323, 304, 75757, 4390, 53, 300, 3444, 25, 32097, 430, 527, 279, 10043, 5457, 4920, 1475, 3463, 323, 1957, 315, 198, 14789, 627, 53, 561, 84, 25, 279, 7904, 1887, 315, 802, 523, 42234, 627, 53, 561, 84, 16249, 13645, 25, 279, 7904, 5429, 324, 384, 315, 18112, 627, 53, 352, 84, 25, 19813, 311, 279, 38556, 29720, 5938, 449, 384, 582, 305, 523, 52503, 320, 69191, 750, 3152, 3451, 19703, 529, 4390, 53, 291, 8424, 25, 279, 8675, 7675, 1028, 13868, 379, 315, 279, 650, 1608, 300, 627, 53, 291, 300, 25, 279, 24417, 10597, 22755, 315, 279, 87410, 598, 11, 5439, 810, 1109, 220, 2636, 15, 1667, 198, 6438, 627, 53, 819, 9110, 25, 36142, 10087, 26, 550, 1560, 2906, 315, 279, 653, 344, 2781, 325, 627, 53, 819, 8512, 6151, 25, 19813, 311, 279, 8983, 72754, 523, 52503, 320, 69191, 750, 3445, 3451, 26047, 384, 529, 4390, 53, 1018, 10462, 25, 264, 17466, 40986, 304, 25917, 1174, 55385, 291, 311, 279, 28029, 12330, 198, 14676, 69239, 1113, 994, 264, 9998, 374, 1377, 4083, 291, 1139, 264, 2103, 7463, 315, 10667, 2024, 627, 93697, 3444, 25, 16595, 38556, 29720, 430, 47274, 3536, 279, 289, 14512, 2547, 627, 56, 276, 2221, 25, 264, 36396, 2955, 1511, 369, 20545, 323, 33862, 26, 279, 9302, 198, 630, 315, 264, 68009, 7659, 14361, 25, 5528, 323, 12659, 6522, 311, 279, 11552, 315, 3927, 3823, 198, 64589, 2136, 449, 279, 30467, 17966, 16853, 56, 14361, 72039, 13075, 25, 50217, 6212, 26, 42453, 292, 6725, 304, 902, 584, 649, 4933, 13520, 505, 198, 1820, 69782, 29611, 1028, 315, 2547, 25917, 16853, 56, 14361, 328, 332, 13075, 25, 1495, 5439, 555, 7281, 53191, 8115, 91784, 1113, 279, 8223, 20557, 1853, 315, 436, 19580, 198, 88, 14361, 11, 279, 37538, 1853, 315, 33862, 430, 11957, 1083, 988, 304, 279, 10167, 329, 6151, 198, 50659, 16853, 97283, 1073, 24317, 662, 884, 33, 602, 293, 326, 602, 297, 342, 436, 264, 281, 305, 379, 198, 86340, 402, 1604, 11, 19455, 519, 19984, 42888, 323, 735, 27990, 19455, 519, 20277, 402, 1604, 11, 29438, 311, 17326, 10965, 345, 85, 3145, 220, 16, 12, 1691, 11, 328, 3444, 14531, 31930, 5169, 9165, 7911 ]
0xBreath/holistic-books
nutrition to calori es is absolutely the worst of all food types, except perhaps for pure white sugar, which is all calories and absolutely no nutrition (this is also true for other forms of sugar. Honey, too, contains almost no nutrition.). Gram for gram, fats contain many m ore calories than do sugars or starches. Yet gram for gram, fats contain virtually no nutrition except for small quantities of essential fatty acids. The perverse reason people like to eat fats is that they are very hard to digest and greatly slow the dige stive action of the stomach. Another way of saying that is that they have a very high satiety value. Fats make a person feel full for a long time because their presence in the stomach makes it churn and churn and churn. Fats coat proteins and starches and delay their digestion, often causing them to begin fermenting (starches) or putrefying (proteins) in the digestive tract. The best fats contain high levels of monosaturated vegetable oils that have never been exposed to heat or chemicals –like virgin olive oil. Use small quantities of olive oil for salad dressing. Monosaturated fats also have far less tendency to go rancid than a ny other type. Vegetable oils with high proportions of unsaturated fats, the kind that all the authorities push because they con tain no cholesterol, go rancid rapidly upon very brief exposure to air. The danger here is that rancidity in vegetable oil is virtual ly unnoticeable. Rancid animal fat on the other hand, smells "off." Eating rancid oil is a sure -fire way to accelerate ageing, invite degenerative conditions in general, and enhance the likelihood of cancer. I recommend that you use only high -quality virgin olive oil, the only generally -available fat that is largely monosaturated. (Pearson and Shaw, 1983) When you buy vegetable o il, even olive oil, get small bottles so you use them up before the oil has much time being exposed to air (as you use the oil air fills the bottle) or, if you buy olive oil in a large can to save money, immediately upon opening it, transfer the oil to pin t jars filled to the very brim to exclude virtually all air, and seal the jars securely. In either case, keep now -opened, in - use small bottles of oil in the refrigerator because rancidity is simply the combination of oil with oxygen from the air and this chemical reaction is accelerated at warmer temperatures and slowed greatly at cold ones. Chemical reactions typically double in speed with every 10 degrees C. increase in temperature. So oil goes rancid about six t imes faster at normal room temperature than it does in the fridge. If you'll think about the implications of this data you'll see there are two powerful reasons not to fry food. One, the food is coated with oil and gains in satiety value at the expense of becoming relatively indigestible and produc tive of toxemia. Secondly, if frying occurs at 150 degrees Centigrade and normal room temperature is 20 degrees Centigrade, then oil goes rancid 2 to the 13th power faster in the frying pan, or about 8,200 times faster. Heating oil for only ten minutes in a hot skillet induces as much rancidity as about 6 weeks of sitting open and exposed to air at room temperature. Think about that the next time you're tempted to eat something from a fast food restaurant where the hot fa t in the deep fryer has been reactin g with oxygen all day, or even for several days. Back to butter, where we started. If you must have something traditionally northern European on your bread, you are far bette r off to use butter, not margarine. However, Mediterranean peoples traditionally d ip their bread in high -quality extra -virgin olive oil that smells and tastes like olives. It’s delicious, why not try it. But best yet, put low -sugar fruit preserves on your toast or develop a taste for dry toast. Probably the finest use for butter is melt ed over steamed vegetables. This way only small quantities are needed and the fat goes on something that is otherwise very easy to digest so its presence will not produce as many toxins in the di gestive tract. Milk, Meat, And Other Protein Foods Speaking of butter, how about milk? The dairy lobby is very powerful in North America. Its political clout and campaign contributions have the governments of both the United States and especially that of Canada eating out of its hand (literally), providing the dair y industry with price supports. Because of these price supports, in Canada cheese costs half again more than it does in the United States. The dairy lobby is also very cozy with the medical profession so licensed nutritionists constantly bombard us with "d rink milk" and "cheese is good for you" propaganda. And people naturally like dairy foods. They taste good and are fat -rich with a high satiety value. Dairy makes you feel full for a long time. Dairy is also high in protein; protein is hard to digest and this too keeps one feeling full for a long time. But many people, especially those from cultures who traditionally (genetically) didn't have dairy cows, particularly Africans, Asians and Jews, just do not produce the enzymes necessary to digest cows milk. Some individuals belonging to these groups can digest goats milk. Some can't digest any kind except human breast milk. And some can digest fermented milk products like yogurt and kiefer. Whenever one eats a protein food that is not fully digestible, it put refies in the digestive tract, with all the bad consequences previously described. But no one, absolutely no one can fully digest pasteurized cows milk, which is what most people use because they have been ma de to fear cow -transmitted diseases and/or they are forced to use pasteurized dairy products by health authorities. I suspect drinking pasteurized milk or eating cheese made from pasteurized milk is one of the reasons so many people develop allergic reactions to milk. Yet many states do not allow unpast eurized dairy to be sold, even privately between neighbors. To explain all this, I first have to explain a bit more about protein digestion in general and then talk about allergies and how they can be created. Proteins are long, complex molecules, intricat e chains whose individual links are amino acids. Proteins are the very stuff of life. All living protoplasm, animal or plant, is largely composed of proteins. There are virtually an infinite number of different proteins but all are composed of the same few dozen amino acids hooked together in highly variable patterns. Amino acids themselves are highly complex organic molecules too. The human body custom -assembles all its proteins from amino acids derived from digesting protein foods, and can also manufactur e small quantities of certain of its own amino acids to order, but there are eight amino acids it cannot make and these are for that reason called essential amino acids. Essential amino acids must be containe d in the food we eat.. Few proteins are water s oluble. When we eat proteins the digestive apparatus must first break them down into their water -soluble components, amino acids, so these can pass into the blood and then be reassembled into the various proteins the body uses. Th e body has an interesting mechanism to digest proteins; it uses enzymes. An enzyme is like the key for a lock. It is a complex molecule that latches to a protein molecule and then breaks it apart into amino acids. Then the enzyme finds yet another prot ein molecule to free. Enzymes are efficient, reusable many many times. Enzymes that digest proteins are effective only in the very acid environment of the stomach, are manufactured by the pancreas and are released when protein foods are present. The stomach then releases hydrochloric acid and churns away like a washing machine, mixing the enzymes and the acid with the proteins until everything has digested. So far so good. That's how its supposed to be. But. Dr. Henry Bieler, who wrote Food Is Your Best Medicine, came up with the finest metaphor I know of to explain how protein digestion goes wrong. He compared all proteins to the white of an egg (which is actually a form of protein). When raw and liquid, the long chains of albumen (egg white) proteins are in their natural form. Howeve r, cook the egg and the egg white both solidifies and becomes smaller. What has happened is that the protein chains have shriveled and literally tied themselves into knots. Once this happens, pancreatic enzymes no longer fit and cannot separate a ll the amino acids. Cooked proteins may churn and churn and churn in the presence of acid and pancreatic enzymes but they will not digest completely. Part becomes water -soluble; part does not. But, indigestible protein is still subject to an undesirable form of cons umption in the gut. Various bacteria make their home in our airless, warm intestines. Some of these live on protein. In the process of consuming undigested proteins, they release highly toxic substances. They poison us. What is true of the white of an egg is also true of flesh foods and dairy. Raw meat and raw fish are actually easily digestible foods and if not wrongly combined will not produce toxemia in a person that still has a strong pancreas. However
[ 26677, 311, 1652, 13915, 1560, 374, 11112, 279, 12047, 315, 682, 3691, 4595, 11, 720, 11945, 8530, 369, 10748, 4251, 13465, 11, 902, 374, 682, 25247, 323, 11112, 912, 26677, 320, 576, 374, 1101, 837, 369, 1023, 7739, 315, 13465, 13, 720, 39, 2596, 11, 2288, 11, 5727, 4661, 912, 26677, 36434, 29937, 369, 23882, 11, 50127, 6782, 1690, 296, 16536, 25247, 1109, 656, 70913, 477, 70181, 288, 13, 14968, 23882, 720, 2000, 23882, 11, 50127, 6782, 21907, 912, 26677, 3734, 369, 2678, 33776, 315, 7718, 40085, 33969, 13, 2355, 791, 95904, 2944, 1274, 1093, 311, 8343, 50127, 374, 430, 814, 527, 1633, 2653, 311, 21552, 323, 19407, 6435, 279, 4170, 68, 357, 535, 1957, 315, 279, 23152, 13, 720, 14364, 1648, 315, 5605, 430, 374, 430, 814, 617, 264, 1633, 1579, 7731, 72, 2676, 907, 13, 435, 1900, 1304, 264, 1732, 2733, 2539, 369, 264, 1317, 892, 1606, 872, 720, 74519, 304, 279, 23152, 3727, 433, 81969, 323, 81969, 323, 81969, 13, 435, 1900, 23724, 28896, 323, 70181, 288, 323, 7781, 872, 74502, 11, 3629, 720, 936, 985, 1124, 311, 3240, 68736, 287, 320, 267, 1132, 288, 8, 477, 2231, 1116, 7169, 320, 782, 668, 1354, 8, 304, 279, 60071, 42929, 13, 2355, 791, 1888, 50127, 6782, 1579, 5990, 315, 1647, 437, 35467, 36581, 32462, 430, 617, 2646, 1027, 15246, 311, 8798, 477, 26333, 1389, 4908, 36999, 720, 337, 535, 5707, 13, 5560, 2678, 33776, 315, 33213, 5707, 369, 33566, 32623, 13, 3206, 437, 35467, 50127, 1101, 617, 3117, 2753, 31954, 311, 733, 436, 1149, 307, 1109, 264, 19541, 720, 1605, 955, 13, 95392, 32462, 449, 1579, 49892, 315, 7120, 35467, 50127, 11, 279, 3169, 430, 682, 279, 11527, 4585, 1606, 814, 390, 259, 467, 912, 720, 971, 273, 33282, 11, 733, 436, 1149, 307, 19019, 5304, 1633, 10015, 14675, 311, 3805, 13, 578, 8137, 1618, 374, 430, 436, 1149, 19025, 304, 36581, 5707, 374, 4200, 14869, 720, 359, 24467, 481, 13, 432, 1149, 307, 10065, 8834, 389, 279, 1023, 1450, 11, 50737, 330, 1885, 1210, 60638, 436, 1149, 307, 5707, 374, 264, 2771, 482, 11029, 1648, 311, 43880, 80043, 11, 220, 22114, 720, 451, 7642, 1413, 4787, 304, 4689, 11, 323, 18885, 279, 29736, 315, 9572, 13, 358, 7079, 430, 499, 1005, 1193, 1579, 482, 10692, 36999, 33213, 720, 74913, 11, 279, 1193, 8965, 482, 10547, 8834, 430, 374, 14090, 1647, 437, 35467, 13, 320, 92140, 942, 323, 36285, 11, 220, 3753, 18, 8, 2355, 4599, 499, 3780, 36581, 297, 3900, 11, 1524, 33213, 5707, 11, 636, 2678, 27474, 779, 499, 1005, 1124, 709, 1603, 279, 5707, 706, 1790, 892, 1694, 15246, 311, 3805, 720, 38051, 499, 1005, 279, 5707, 3805, 41687, 279, 16893, 8, 477, 11, 422, 499, 3780, 33213, 5707, 304, 264, 3544, 649, 311, 3665, 3300, 11, 7214, 5304, 8736, 433, 11, 220, 8481, 720, 1820, 5707, 311, 9160, 259, 61111, 10409, 311, 279, 1633, 1437, 318, 311, 22429, 21907, 682, 3805, 11, 323, 26418, 279, 61111, 52123, 13, 763, 3060, 1162, 11, 2567, 1457, 482, 57228, 11, 304, 18722, 817, 2678, 27474, 315, 5707, 304, 279, 46044, 1606, 436, 1149, 19025, 374, 5042, 279, 10824, 315, 5707, 449, 24463, 505, 279, 3805, 323, 420, 720, 32056, 13010, 374, 49858, 520, 46039, 20472, 323, 48946, 19407, 520, 9439, 6305, 13, 2355, 64938, 950, 25481, 11383, 2033, 304, 4732, 449, 1475, 220, 605, 12628, 356, 13, 5376, 304, 9499, 13, 2100, 5707, 5900, 436, 1149, 307, 922, 4848, 259, 737, 288, 720, 69, 2352, 520, 4725, 3130, 9499, 1109, 220, 433, 1587, 304, 279, 38681, 13, 1442, 499, 3358, 1781, 922, 279, 25127, 315, 420, 828, 499, 3358, 1518, 1070, 527, 720, 20375, 8147, 8125, 539, 311, 53646, 3691, 13, 3861, 11, 279, 3691, 374, 49482, 449, 5707, 323, 20192, 304, 7731, 72, 2676, 907, 520, 279, 20900, 315, 10671, 720, 3833, 8046, 1280, 15505, 1260, 323, 2558, 66, 259, 535, 315, 41569, 22689, 13, 72131, 11, 422, 87196, 13980, 520, 220, 3965, 12628, 5838, 5346, 1037, 323, 4725, 3130, 720, 35658, 374, 220, 508, 12628, 5838, 5346, 1037, 11, 1243, 5707, 5900, 436, 1149, 307, 220, 17, 311, 279, 220, 1032, 339, 2410, 10819, 304, 279, 87196, 7363, 11, 477, 922, 220, 23, 11, 1049, 3115, 220, 10819, 13, 720, 1548, 1113, 5707, 369, 1193, 5899, 4520, 304, 264, 4106, 79085, 90974, 439, 1790, 436, 1149, 19025, 439, 922, 220, 21, 5672, 315, 11961, 1825, 323, 15246, 311, 3805, 520, 720, 3039, 9499, 13, 21834, 922, 430, 279, 1828, 892, 499, 2351, 54980, 311, 8343, 2555, 505, 264, 5043, 3691, 10960, 1405, 279, 4106, 2267, 259, 304, 720, 1820, 5655, 53646, 261, 706, 1027, 14085, 258, 342, 449, 24463, 682, 1938, 11, 477, 1524, 369, 3892, 2919, 13, 2355, 3792, 311, 14432, 11, 1405, 584, 3940, 13, 1442, 499, 2011, 617, 2555, 36342, 18671, 7665, 389, 701, 16385, 11, 499, 527, 3117, 1297, 668, 436, 1022, 720, 998, 1005, 14432, 11, 539, 19205, 75314, 13, 4452, 11, 38785, 32538, 36342, 294, 6125, 872, 16385, 304, 1579, 482, 10692, 5066, 482, 46957, 8326, 33213, 5707, 430, 720, 3647, 6572, 323, 36263, 1093, 8492, 1924, 13, 1102, 753, 18406, 11, 3249, 539, 1456, 433, 13, 2030, 1888, 3686, 11, 2231, 3428, 482, 82, 8734, 14098, 75998, 389, 701, 23211, 477, 2274, 264, 720, 83, 5642, 369, 9235, 23211, 13, 38254, 279, 28807, 1005, 369, 14432, 374, 30099, 1608, 927, 4179, 3690, 24822, 13, 1115, 1648, 1193, 2678, 33776, 527, 4460, 720, 438, 279, 8834, 5900, 389, 2555, 430, 374, 6062, 1633, 4228, 311, 21552, 779, 1202, 9546, 690, 539, 8356, 439, 1690, 62186, 304, 279, 1891, 13033, 535, 720, 2193, 13, 2355, 720, 44, 34263, 11, 45965, 11, 1628, 7089, 49475, 40160, 2355, 33117, 315, 14432, 11, 1268, 922, 14403, 30, 578, 34479, 19865, 374, 1633, 8147, 304, 4892, 5270, 13, 11699, 5054, 1206, 412, 323, 4901, 720, 48210, 4065, 617, 279, 17047, 315, 2225, 279, 3723, 4273, 323, 5423, 430, 315, 7008, 12459, 704, 315, 1202, 1450, 320, 69191, 750, 8, 1174, 720, 782, 1325, 287, 279, 110035, 379, 5064, 449, 3430, 11815, 13, 9393, 315, 1521, 3430, 11815, 11, 304, 7008, 17604, 7194, 4376, 1578, 810, 1109, 433, 720, 28156, 304, 279, 3723, 4273, 13, 578, 34479, 19865, 374, 1101, 1633, 43535, 449, 279, 6593, 4913, 779, 16383, 26677, 1705, 15320, 2355, 79444, 569, 603, 449, 330, 67, 436, 771, 14403, 1, 323, 330, 1557, 2423, 374, 1695, 369, 499, 1, 30617, 13, 2355, 3112, 1274, 18182, 1093, 34479, 15657, 13, 2435, 12945, 1695, 323, 527, 8834, 482, 14172, 449, 264, 1579, 7731, 72, 2676, 907, 13, 79122, 3727, 499, 2733, 2539, 369, 264, 720, 4930, 892, 13, 79122, 374, 1101, 1579, 304, 13128, 26, 13128, 374, 2653, 311, 21552, 323, 420, 2288, 13912, 832, 8430, 2539, 369, 264, 1317, 892, 13, 2030, 1690, 720, 16455, 11, 5423, 1884, 505, 27833, 889, 36342, 320, 4469, 37774, 8, 3287, 956, 617, 34479, 46266, 11, 8104, 66738, 11, 75408, 323, 720, 41, 28844, 11, 1120, 656, 539, 8356, 279, 56067, 5995, 311, 21552, 46266, 14403, 13, 4427, 7931, 33152, 311, 1521, 5315, 649, 21552, 71932, 720, 76, 34263, 13, 4427, 649, 956, 21552, 904, 3169, 3734, 3823, 17659, 14403, 13, 1628, 1063, 649, 21552, 96080, 14403, 3956, 1093, 55575, 323, 597, 648, 809, 662, 720, 65361, 832, 50777, 264, 13128, 3691, 430, 374, 539, 7373, 21552, 1260, 11, 433, 2231, 2098, 552, 304, 279, 60071, 42929, 11, 449, 682, 279, 3958, 16296, 720, 1762, 18785, 7633, 13, 2355, 4071, 912, 832, 11, 11112, 912, 832, 649, 7373, 21552, 3347, 12844, 1534, 46266, 14403, 11, 902, 374, 1148, 1455, 1274, 1005, 1606, 814, 617, 1027, 7643, 409, 720, 998, 8850, 19923, 482, 1485, 5600, 19338, 323, 5255, 814, 527, 9770, 311, 1005, 3347, 12844, 1534, 34479, 3956, 555, 2890, 11527, 13, 358, 15562, 16558, 720, 57968, 324, 1534, 14403, 477, 12459, 17604, 1903, 505, 3347, 12844, 1534, 14403, 374, 832, 315, 279, 8125, 779, 1690, 1274, 2274, 57596, 25481, 311, 720, 76, 34263, 13, 14968, 1690, 5415, 656, 539, 2187, 22355, 561, 384, 324, 1534, 34479, 311, 387, 6216, 11, 1524, 38171, 1990, 19228, 13, 2057, 10552, 682, 420, 11, 358, 1176, 720, 19553, 311, 10552, 264, 2766, 810, 922, 13128, 74502, 304, 4689, 323, 1243, 3137, 922, 58742, 323, 1268, 814, 649, 387, 3549, 13, 2355, 1360, 668, 1354, 527, 1317, 11, 6485, 35715, 11, 94603, 266, 384, 27271, 6832, 3927, 7902, 527, 42500, 33969, 13, 15542, 1354, 527, 279, 1633, 6392, 315, 2324, 13, 720, 2460, 5496, 1760, 56178, 10753, 11, 10065, 477, 6136, 11, 374, 14090, 24306, 315, 28896, 13, 2684, 527, 21907, 459, 24746, 1396, 315, 2204, 28896, 720, 8248, 682, 527, 24306, 315, 279, 1890, 2478, 220, 21030, 42500, 33969, 43770, 3871, 304, 7701, 3977, 12912, 13, 362, 32924, 33969, 5694, 527, 720, 12156, 398, 6485, 17808, 35715, 2288, 13, 578, 3823, 2547, 2587, 482, 300, 41794, 682, 1202, 28896, 505, 42500, 33969, 14592, 505, 720, 37439, 287, 13128, 15657, 11, 323, 649, 1101, 5968, 324, 384, 2678, 33776, 315, 3738, 315, 1202, 1866, 42500, 33969, 311, 2015, 11, 719, 1070, 527, 8223, 720, 309, 3394, 33969, 433, 4250, 1304, 323, 1521, 527, 369, 430, 2944, 2663, 7718, 42500, 33969, 13, 48833, 42500, 33969, 2011, 387, 6782, 68, 294, 304, 720, 1820, 3691, 584, 8343, 13, 662, 2355, 72204, 28896, 527, 3090, 274, 8492, 41572, 13, 3277, 584, 8343, 28896, 279, 60071, 41705, 2011, 1176, 1464, 1124, 1523, 1139, 872, 3090, 482, 39298, 41572, 720, 5260, 11, 42500, 33969, 11, 779, 1521, 649, 1522, 1139, 279, 6680, 323, 1243, 387, 312, 300, 26994, 1139, 279, 5370, 28896, 279, 2547, 5829, 13, 666, 384, 720, 2664, 706, 459, 7185, 17383, 311, 21552, 28896, 26, 433, 5829, 56067, 13, 1556, 49242, 374, 1093, 279, 1401, 369, 264, 5409, 13, 1102, 374, 264, 6485, 720, 76, 55269, 430, 326, 9296, 311, 264, 13128, 43030, 323, 1243, 18808, 433, 10980, 1139, 42500, 33969, 13, 5112, 279, 49242, 14035, 3686, 2500, 1760, 4466, 720, 76, 55269, 311, 1949, 13, 2998, 21436, 288, 527, 11297, 11, 62671, 1690, 1690, 3115, 13, 2355, 1737, 21436, 288, 430, 21552, 28896, 527, 7524, 1193, 304, 279, 1633, 13935, 4676, 315, 279, 23152, 11, 527, 28648, 555, 279, 62268, 300, 220, 323, 720, 548, 6004, 994, 13128, 15657, 527, 3118, 13, 578, 23152, 1243, 19786, 17055, 72967, 292, 13935, 323, 81969, 82, 3201, 1093, 264, 28786, 5780, 11, 720, 36171, 287, 279, 56067, 323, 279, 13935, 449, 279, 28896, 3156, 4395, 706, 4170, 10185, 13, 2355, 4516, 3117, 779, 1695, 13, 3011, 596, 1268, 1202, 10171, 311, 387, 13, 2030, 13, 2999, 13, 18063, 12371, 8023, 11, 889, 6267, 12369, 2209, 4718, 7252, 19152, 11, 3782, 709, 449, 279, 720, 5589, 478, 46450, 358, 1440, 315, 311, 10552, 1268, 13128, 74502, 5900, 5076, 13, 1283, 7863, 682, 28896, 311, 279, 4251, 315, 459, 19151, 320, 8370, 374, 720, 74128, 264, 1376, 315, 13128, 570, 3277, 7257, 323, 14812, 11, 279, 1317, 27271, 315, 8176, 268, 320, 29468, 4251, 8, 28896, 527, 304, 872, 5933, 1376, 13, 720, 4438, 83148, 436, 11, 4394, 279, 19151, 323, 279, 19151, 4251, 2225, 6573, 9803, 323, 9221, 9333, 13, 3639, 706, 7077, 374, 430, 279, 13128, 27271, 617, 720, 939, 58035, 839, 323, 16280, 17791, 5694, 1139, 61317, 13, 9843, 420, 8741, 11, 98144, 56067, 912, 5129, 5052, 323, 4250, 8821, 264, 9507, 279, 720, 309, 3394, 33969, 13, 12797, 291, 28896, 1253, 81969, 323, 81969, 323, 81969, 304, 279, 9546, 315, 13935, 323, 98144, 56067, 719, 814, 690, 539, 720, 37439, 6724, 13, 3744, 9221, 3090, 482, 39298, 41572, 26, 961, 1587, 539, 13, 2355, 4071, 11, 1280, 15505, 1260, 13128, 374, 2103, 3917, 311, 459, 77344, 1376, 315, 1615, 4543, 562, 304, 279, 18340, 13, 40741, 24032, 1304, 872, 2162, 304, 1057, 720, 1334, 1752, 11, 8369, 39408, 1572, 13, 4427, 315, 1521, 3974, 389, 13128, 13, 763, 279, 1920, 315, 35208, 2073, 343, 10185, 28896, 11, 814, 4984, 7701, 220, 21503, 720, 2008, 9623, 13, 2435, 21109, 603, 13, 2355, 3923, 374, 837, 315, 279, 4251, 315, 459, 19151, 220, 374, 1101, 837, 315, 26000, 15657, 323, 34479, 13, 23886, 13339, 323, 7257, 7795, 527, 3604, 6847, 21552, 1260, 15657, 720, 438, 422, 539, 72309, 11093, 690, 539, 8356, 41569, 22689, 304, 264, 1732, 430, 2103, 706, 264, 3831, 62268, 300, 13, 4452 ]
0xBreath/holistic-books
doesn ’ t always happen instantaneous ly, but once the realignment is initiated in your thoughts, you’ve begun being in balance. The Habit of Thinking in Alignment with Your Dreams Oscar W ilde onc e observed that “we are all in the gutter, but some of us are l ooking at th e stars.” This is a perfect example of what it means to align your vision and thoughts so th at they’re balanced with what you sense you’re here to be. A thought such as It is my intention to cr eate a place to help underprivileged childr en is in reality a message to the Universe. If you feel stro ngly tha t you came her e for a particular purpose, then you should cultivate ener g y to match this dream. It doesn’ t matter what the circumstances of your life are. Y our current financial status is unimportant when it comes to your pursuit o f this purpose. The presence of a gaggle of naysayers shoul dn’ t sway you or make you doubt your attraction to your calling. What you’re doing as yo u get your life balanced with your dream is beginning to co-create your life. Co-creation is cooperatively usi ng the ener gy from the invisibl e field of Spirit. It is perfectly balancing your in-the-world calling with the pure ener gy of creation. Y ou emulate this creation field by being as much like it as possi ble. This involves your willingness to contemplate yourself as a being of balance attracting the c onditions you desire to produce. It is in the contemplation o f this power that you actually acquir e this power. Reread that statement until it sticks with you like super glue. Y ou cannot manifest a place f or helping underprivileged children by contemplating the impossibility of that happening. Even if you’re in the gutter, you have the option of looking at the stars. This means thinking star thoughts andrejecting the weight of those that attract the gutter. Y our balance point is a certainty that you af firm with th oughts along the lines of I know it, I desir e it, it’ s on its way, nothing can stop it, and ther e’ s nothing for me to be upset about. This alig nment will completely turn your world around. The Universe is based on a Law of Attraction. Y ou’ll begin seeing the Universe conspiring with you to attract the right pe ople, the right finances, and the seemingly synchronistic ev ents to turn your dreams into reality, here and now. When you’re balanced with thoughts of deserving this cooperation from the world of S pirit, you a ctively engage in bringing it about. Y ou’re e njoying the lightness of being in balance wi th the creative ener gy of life. It’ s no longer possible to sit around complaining or feeling frustrated. Y ou are ener gized! Why? Because you’re balanced with the Source of all creation. And just like it, you acc ess creativity by attracting all that you need with your thoughts. It just doesn’ t work if you’re in a state of imbalance, complaining, living in fear, or expecting the worst. The same logic of realignment for balancing your dream ene r gy with your daily habits applies to any thing you’re capable of imagining: writing and producing your own music album, training horses, adopting a child from an impoverished land, own ing your own home in the country, landing the job that’ s always eluded you, making the kind of money th at will free you from debt, running a marathon.... Y ou name it, and if you can dream it, y ou can achi eve it. But only if you align your inner creative ener gy— your thoughts— so that they match up perfectly with your desire s. Thoughts that rein force cu rrent habits that are incongruous with your desire must be replaced with aligned ener gy. No o ne has said it better than Jesus of Nazareth: “Believe that you shall receive and you shall receive.” What’ s the point of living a li fe disputing such in-balance wisdom?CHAPTER TWO THERE’S MORE TO LIFE THAN MAKING IT GO FASTER B A L A N C I N G Y O U R D E S I R E T O E N J O Y L I F E W I T H Y O U R N E E D T O A C H I E V E  “One of the symptoms of an approaching nervous breakdown is the belief that one’s work is terribly important...” — BERTRAND RUSSELL “The more you advance toward God, the less He will give you worldly duties to perform...” — RAMAKRISHNA T  he k ey t o balancing your desire to be at peace with your need to achieve, perform, and earn a living is in recognizing that there’ s no such thing as stress; there are only people thinking stres sful thoughts. It’ s really as simple as that. When you change the way you process the world, the world you’re processing changes. Stress is an insi de job. Y ou can ’ t fill a container with it because tension isn’ t a physical item or object. There isn’ t some thing that you can point to and say, Ther e it is, that’ s str ess! It simply doesn’ t exist in that form. Y et 112 mill ion people in America take medication for stress-related symptoms, which in clude fa tigue, heart palpitations, indigestion, diarrhea, c onstipation, nervousness, excessive eating, rashes, nail biting, loss of appetite, insomnia, anxiety, irritability, panic, moodiness, memory lapses, the inability to concentrate, ulc ers, obsessive-c ompulsive behavior, feeling up set... and on and on goes an almost inexhaustible list. And they’re all caused by something that doesn’ t exist in the physical world. Being out of ba lance on this st ress measure results in being one of the millions of people requiring medication to manage the symptoms listed above. It means that you often feel exasperated because you never really enjoy the life yo u work so hard to achieve. Y ou may frequently feel as if you’re spending your life running on an endless treadmill. All of the pressure of working and striving may have many worldly rewards, yet at the same time there’ s a feeling of going absolutely nowhere. If this sounds familiar, it’ s a signal to begin reconsidering ways of processing thoughts about your life and work, and start pursuing freedom from the symptoms of stress b y becoming more balanced. Getting into balance isn’ t necessarily about changing your behavior. Certai nly you can pursue stress-reducing activities such as meditation, exercise, w alks along a beach, or whatever works for you. But if you continue to align yourself with achieving more, defeating the other guy, winning at all costs, and going faster because you believe that’ s how to keep up, then you’re guaranteed to attract th e vibrat ional equivalent of this thinking into your life—even if you do yoga and stand on your head chanting mantras every day!Stress Reduction Is about Realignment Y ou become what you think about all day long. Y ou also become how you think al l day long. T o measure the we ight of your thoughts, you need to think in terms o f vibration and ener gy. Let’ s suppose that you have a high- frequency desire to be a person who has no symptoms of stress. Let’ s assign this thought a 10 on a scale of 1 to 10, with the lowest-ener gy thought of 1 representing a nervous breakdown, and a 10 representing enlightened, peaceful mastery. Next, yo u need to note the thoughts you have that support your desire for a p eaceful, stress-free life. Thou ghts such as I’m overwhelmed, I never have enough time, I have so many p eople wanting things fr om me that I don’ t even have time to think, I have so much mor e on my plate than I can handle, and I fee l pr essur ed by my need to make money to pay my bills aren’ t balanced and peaceful. These thoughts are resistant ener gy, which counters the desi re for a peaceful, stre ss-free existence. In other words, they’re nonaligned and out of balance. Y our desire may be a 10, but y our mental ener gy in this situation is in a much lower range, perhaps a 2 or 3. Simply c hanging your behavior isn’ t going to get you back into balance. Y ou’re s till attra cting symptom s of stress when you say no to people and their demands, but vibrate to a frequency that’ s thinking, I r eally should be doing what they ask of me, or Maybe I can squ eeze in their r e quests later. Y ou may have pulled back from an overly full and frenzied schedule, yet you con tinue to radiate thoughts of fear and scarcity that will activate the Law of
[ 3250, 18217, 259, 2744, 3621, 96219, 14869, 1174, 719, 3131, 198, 1820, 1972, 3615, 374, 33230, 304, 701, 11555, 11, 499, 4070, 22088, 1694, 304, 8335, 627, 791, 95178, 315, 53389, 304, 33365, 449, 4718, 53718, 198, 46, 25529, 468, 3900, 451, 78970, 384, 13468, 430, 1054, 906, 527, 682, 304, 279, 50079, 1174, 719, 1063, 315, 603, 198, 548, 326, 297, 10979, 520, 270, 384, 9958, 2029, 1115, 374, 264, 4832, 3187, 315, 1148, 433, 3445, 311, 5398, 198, 22479, 11376, 323, 11555, 779, 270, 520, 814, 3207, 24770, 449, 1148, 499, 5647, 198, 9514, 3207, 1618, 311, 387, 13, 362, 3463, 1778, 439, 1102, 374, 856, 14944, 311, 1589, 384, 349, 264, 2035, 311, 198, 8823, 1234, 98388, 1716, 81, 665, 220, 374, 304, 8903, 264, 1984, 311, 279, 29849, 13, 1442, 499, 198, 57676, 31511, 7933, 398, 49588, 259, 499, 3782, 1077, 384, 369, 264, 4040, 7580, 11, 1243, 220, 499, 1288, 198, 93113, 736, 38556, 342, 379, 311, 2489, 420, 8063, 13, 1102, 3250, 529, 259, 5030, 1148, 279, 198, 44398, 372, 9623, 315, 701, 2324, 527, 13, 816, 1057, 1510, 6020, 2704, 374, 653, 15693, 198, 9493, 433, 4131, 311, 701, 33436, 297, 282, 420, 7580, 13, 578, 9546, 315, 220, 264, 46692, 3491, 315, 198, 77, 954, 5184, 559, 11206, 48588, 529, 259, 61229, 499, 477, 1304, 499, 10712, 701, 33464, 311, 701, 198, 74826, 13, 3639, 499, 3207, 3815, 439, 30596, 577, 636, 701, 2324, 24770, 449, 701, 8063, 374, 198, 7413, 1251, 311, 1080, 40779, 701, 2324, 627, 7489, 12, 38475, 374, 22415, 8046, 603, 72, 7933, 279, 38556, 29720, 505, 279, 100137, 581, 75, 384, 2115, 315, 198, 87475, 13, 1102, 374, 14268, 44463, 701, 304, 10826, 31184, 8260, 449, 279, 10748, 198, 804, 29720, 315, 9886, 13, 816, 6033, 66585, 420, 9886, 2115, 555, 1694, 439, 1790, 1093, 433, 198, 300, 2278, 72, 12704, 13, 1115, 18065, 701, 39375, 311, 80907, 6261, 439, 264, 198, 35214, 315, 8335, 51647, 279, 272, 389, 2400, 82, 499, 12876, 311, 8356, 13, 1102, 374, 304, 279, 198, 778, 26980, 367, 297, 282, 420, 2410, 430, 499, 3604, 1645, 11642, 384, 420, 2410, 662, 220, 432, 486, 329, 198, 9210, 5224, 3156, 433, 34240, 449, 499, 1093, 2307, 38561, 13, 816, 6033, 4250, 14794, 264, 198, 2050, 282, 477, 10695, 1234, 98388, 2911, 555, 79342, 279, 198, 318, 9007, 3225, 220, 315, 430, 12765, 13, 7570, 422, 499, 3207, 304, 279, 50079, 1174, 499, 617, 279, 198, 2091, 315, 3411, 520, 279, 9958, 13, 1115, 3445, 7422, 6917, 11555, 323, 48096, 287, 279, 4785, 315, 1884, 430, 9504, 279, 50079, 662, 816, 1057, 8335, 1486, 374, 264, 198, 12525, 18773, 430, 499, 8136, 7626, 449, 270, 22525, 82, 3235, 279, 5238, 315, 358, 1440, 433, 11, 358, 951, 404, 384, 198, 275, 11, 433, 529, 274, 389, 1202, 1648, 1174, 4400, 649, 3009, 433, 11, 323, 9139, 384, 529, 274, 4400, 369, 757, 311, 387, 23268, 198, 9274, 627, 2028, 453, 343, 308, 479, 690, 6724, 2543, 701, 1917, 2212, 13, 578, 29849, 374, 198, 31039, 389, 264, 7658, 315, 2468, 27523, 13, 816, 6033, 4805, 3240, 9298, 279, 29849, 220, 22236, 287, 198, 4291, 499, 220, 311, 9504, 279, 1314, 1069, 297, 698, 11, 279, 1314, 40382, 11, 323, 279, 220, 23490, 198, 82, 14445, 4633, 3721, 37952, 311, 2543, 701, 19226, 1139, 8903, 1174, 1618, 323, 1457, 662, 3277, 198, 9514, 3207, 24770, 449, 11555, 315, 76554, 420, 23915, 505, 279, 1917, 198, 1073, 328, 281, 7051, 11, 499, 264, 20864, 3210, 16988, 304, 12967, 433, 922, 13, 816, 6033, 3207, 384, 308, 4215, 287, 279, 198, 4238, 2136, 315, 1694, 304, 8335, 24129, 270, 279, 11782, 38556, 29720, 315, 2324, 13, 1102, 529, 274, 912, 5129, 198, 10236, 311, 2503, 2212, 42126, 477, 8430, 33630, 13, 816, 6033, 527, 38556, 342, 1534, 4999, 10445, 30, 9393, 499, 3207, 24770, 449, 279, 8922, 315, 682, 9886, 13, 1628, 1120, 198, 4908, 433, 11, 499, 1046, 4043, 28697, 555, 51647, 682, 430, 499, 1205, 449, 701, 198, 61665, 82, 13, 1102, 1120, 3250, 529, 259, 990, 422, 499, 3207, 304, 264, 1614, 315, 68331, 11, 42126, 345, 64275, 304, 8850, 1174, 477, 23132, 279, 12047, 627, 791, 1890, 12496, 315, 1972, 3615, 220, 369, 44463, 701, 8063, 665, 68, 436, 29720, 449, 198, 22479, 7446, 26870, 17208, 311, 904, 3245, 499, 3207, 13171, 315, 77724, 25, 4477, 198, 438, 17843, 701, 1866, 4731, 220, 8176, 11, 4967, 27928, 11, 48810, 264, 1716, 198, 1527, 459, 88398, 4363, 11, 1866, 6892, 701, 1866, 2162, 304, 279, 3224, 1174, 20948, 198, 1820, 2683, 430, 529, 274, 2744, 658, 38477, 499, 11, 3339, 279, 3169, 315, 3300, 270, 520, 690, 1949, 198, 9514, 505, 11897, 11, 4401, 264, 45796, 13, 662, 662, 662, 816, 6033, 836, 433, 11, 323, 422, 499, 649, 8063, 198, 275, 11, 379, 6033, 649, 264, 14946, 49996, 433, 13, 2030, 1193, 220, 422, 499, 5398, 701, 9358, 11782, 38556, 29720, 2345, 198, 22479, 11555, 2345, 779, 430, 814, 2489, 709, 14268, 449, 701, 12876, 274, 13, 61399, 198, 9210, 15601, 5457, 7015, 436, 8135, 26870, 430, 527, 28093, 911, 9373, 449, 701, 12876, 2011, 387, 198, 265, 37469, 449, 27210, 38556, 29720, 16853, 2822, 297, 841, 706, 1071, 433, 2731, 1109, 10811, 315, 29874, 57365, 25, 1054, 22404, 19704, 430, 499, 4985, 198, 42993, 323, 499, 4985, 5371, 2029, 3639, 529, 274, 279, 1486, 315, 5496, 264, 908, 1172, 35160, 287, 198, 21470, 304, 1481, 5085, 24278, 30, 88539, 47358, 198, 51, 4678, 40702, 18954, 5257, 61094, 91106, 198, 4940, 42, 1753, 8871, 12890, 435, 30751, 198, 33, 362, 445, 362, 452, 356, 358, 452, 480, 220, 816, 507, 549, 432, 220, 423, 469, 328, 358, 432, 469, 220, 350, 507, 220, 469, 452, 622, 507, 816, 220, 445, 358, 435, 469, 198, 54, 358, 350, 473, 220, 816, 507, 549, 432, 220, 452, 469, 469, 423, 220, 350, 507, 220, 362, 356, 473, 358, 469, 650, 469, 52050, 99799, 315, 279, 13803, 315, 459, 31047, 23418, 198, 9137, 2996, 374, 279, 16801, 430, 832, 753, 198, 1816, 374, 50136, 3062, 662, 662, 662, 89874, 2345, 94674, 2434, 4064, 117836, 100159, 198, 14305, 810, 499, 12178, 9017, 4359, 11, 279, 2753, 1283, 690, 198, 47530, 499, 97706, 22006, 311, 2804, 662, 662, 662, 89874, 2345, 22813, 12173, 49, 16849, 7476, 198, 51, 52050, 383, 597, 3999, 259, 297, 44463, 701, 12876, 311, 387, 520, 9096, 449, 701, 1205, 311, 198, 613, 19704, 11, 2804, 1174, 323, 7380, 264, 5496, 374, 304, 49183, 430, 1070, 529, 274, 912, 198, 21470, 3245, 439, 8631, 26, 1070, 527, 1193, 1274, 7422, 357, 417, 274, 1285, 198, 61665, 82, 13, 1102, 529, 274, 2216, 439, 4382, 439, 430, 13, 3277, 499, 2349, 279, 1648, 499, 198, 4734, 279, 1917, 11, 279, 1917, 499, 3207, 8863, 4442, 627, 626, 676, 374, 459, 1672, 72, 409, 2683, 13, 816, 6033, 649, 18217, 259, 5266, 264, 5593, 449, 433, 1606, 24408, 198, 285, 77, 529, 259, 264, 7106, 1537, 477, 1665, 13, 2684, 4536, 529, 259, 1063, 3245, 220, 430, 499, 649, 1486, 311, 198, 438, 2019, 1174, 23258, 384, 433, 374, 11, 430, 529, 274, 610, 4043, 0, 220, 1102, 5042, 3250, 529, 259, 3073, 304, 430, 1376, 13, 816, 1880, 198, 7261, 2606, 28772, 1274, 304, 5270, 1935, 24099, 369, 8631, 14228, 13803, 345, 8370, 304, 1206, 799, 2267, 259, 22711, 11, 4851, 75649, 31767, 11, 1280, 15505, 290, 11, 69393, 11, 272, 389, 267, 49686, 345, 77, 651, 788, 2136, 11, 27639, 12459, 11, 436, 14380, 11, 32095, 68196, 11, 4814, 315, 38575, 11, 83511, 345, 276, 16708, 1174, 30118, 2968, 1174, 22743, 11, 20247, 1918, 11, 5044, 51055, 288, 11, 279, 38550, 311, 198, 444, 1189, 7853, 11, 8725, 66, 55495, 11, 84132, 1824, 44025, 58921, 7865, 1174, 8430, 709, 743, 662, 662, 662, 323, 198, 263, 323, 389, 5900, 459, 4661, 55981, 15424, 1260, 1160, 13, 1628, 814, 3207, 682, 9057, 555, 198, 34431, 430, 3250, 529, 259, 3073, 304, 279, 7106, 1917, 627, 34242, 704, 315, 13081, 86345, 389, 420, 357, 594, 82, 6767, 3135, 304, 1694, 832, 315, 279, 198, 26064, 919, 315, 1274, 23537, 24099, 311, 10299, 279, 13803, 10212, 198, 49532, 13, 1102, 3445, 430, 499, 3629, 2733, 506, 33361, 660, 1606, 499, 2646, 2216, 198, 268, 4215, 279, 2324, 30596, 577, 990, 779, 2653, 220, 311, 11322, 13, 816, 6033, 1253, 14134, 2733, 439, 422, 198, 9514, 3207, 10374, 220, 701, 2324, 4401, 389, 459, 26762, 85746, 13, 2052, 315, 279, 198, 47074, 315, 3318, 323, 68727, 1253, 617, 1690, 97706, 21845, 11, 3686, 520, 279, 198, 25030, 892, 1070, 529, 274, 264, 8430, 315, 2133, 11112, 28211, 627, 2746, 420, 10578, 11537, 1174, 433, 529, 274, 264, 8450, 311, 3240, 40175, 287, 5627, 315, 198, 21315, 11555, 922, 701, 220, 2324, 323, 990, 11, 323, 1212, 34118, 11542, 198, 1527, 279, 13803, 315, 8631, 293, 379, 10671, 810, 24770, 13, 25531, 1139, 198, 22298, 4536, 529, 259, 14647, 922, 10223, 701, 7865, 662, 15663, 2192, 308, 398, 499, 649, 198, 79, 1759, 361, 8631, 5621, 1072, 6253, 7640, 1778, 439, 33862, 11, 10368, 11, 289, 453, 2857, 3235, 264, 198, 1395, 613, 11, 477, 8996, 4375, 369, 499, 13, 2030, 422, 499, 3136, 311, 5398, 6261, 449, 198, 45620, 4504, 810, 11, 54216, 279, 1023, 7564, 1174, 11230, 520, 682, 7194, 1174, 323, 2133, 198, 69, 2352, 1606, 499, 4510, 430, 529, 274, 1268, 311, 2567, 709, 11, 1243, 499, 3207, 19883, 311, 198, 266, 2193, 270, 384, 17358, 266, 220, 4001, 13890, 220, 315, 420, 7422, 1139, 701, 2324, 80078, 422, 499, 198, 3055, 27102, 323, 2559, 389, 701, 2010, 77674, 893, 13811, 1475, 1938, 0, 626, 676, 59200, 2209, 922, 8976, 3615, 198, 56, 6033, 3719, 1148, 499, 1781, 922, 682, 1938, 1317, 13, 816, 6033, 1101, 3719, 1268, 198, 9514, 1781, 220, 453, 326, 1938, 1317, 13, 350, 297, 6767, 279, 584, 220, 492, 315, 701, 11555, 11, 499, 1205, 311, 198, 27963, 304, 3878, 297, 282, 48913, 323, 38556, 29720, 662, 6914, 529, 274, 23289, 430, 499, 617, 264, 1579, 7058, 47621, 12876, 311, 387, 264, 1732, 889, 706, 912, 13803, 315, 8631, 13, 6914, 529, 274, 9993, 198, 576, 3463, 264, 220, 605, 389, 264, 5569, 315, 220, 16, 311, 220, 605, 11, 449, 279, 15821, 12, 804, 29720, 3463, 315, 220, 16, 198, 36369, 287, 264, 23418, 31085, 11, 323, 264, 220, 605, 14393, 82315, 345, 55225, 1285, 66763, 16853, 5971, 11, 30596, 577, 1205, 311, 5296, 279, 11555, 499, 617, 430, 1862, 701, 12876, 369, 198, 64, 281, 384, 580, 1285, 11, 8631, 12862, 2324, 13, 86471, 342, 427, 82, 1778, 439, 358, 4344, 43206, 11, 358, 2646, 617, 198, 268, 1409, 892, 11, 358, 617, 779, 1690, 281, 384, 1184, 19762, 2574, 1448, 8019, 757, 430, 358, 1541, 529, 259, 198, 17206, 617, 892, 311, 1781, 11, 358, 617, 779, 1790, 4411, 384, 389, 856, 12235, 1109, 358, 649, 3790, 345, 438, 358, 11307, 326, 550, 4043, 324, 1608, 555, 856, 1205, 311, 220, 1304, 3300, 311, 2343, 856, 19123, 220, 7784, 529, 259, 198, 59502, 323, 26733, 13, 4314, 11555, 527, 31785, 38556, 29720, 1174, 902, 32632, 198, 1820, 86588, 312, 369, 264, 26733, 11, 5527, 11107, 12862, 14209, 13, 763, 1023, 4339, 11, 814, 3207, 198, 6414, 48242, 323, 704, 315, 8335, 13, 816, 1057, 12876, 1253, 387, 264, 220, 605, 11, 719, 379, 1057, 10723, 198, 804, 29720, 304, 420, 6671, 374, 304, 264, 1790, 4827, 2134, 11, 8530, 264, 220, 17, 477, 220, 18, 627, 61346, 272, 21363, 701, 7865, 4536, 529, 259, 2133, 311, 636, 499, 1203, 1139, 8335, 627, 56, 6033, 3207, 274, 12222, 520, 2221, 272, 1303, 49648, 274, 315, 8631, 994, 499, 2019, 912, 311, 220, 1274, 323, 198, 50828, 18651, 11, 719, 348, 44192, 311, 264, 11900, 430, 529, 274, 7422, 11, 358, 436, 384, 750, 1288, 387, 198, 45359, 1148, 814, 2610, 315, 757, 11, 220, 477, 10926, 358, 649, 8330, 37443, 3059, 304, 872, 436, 384, 50277, 3010, 16853, 56, 6033, 1253, 617, 13541, 1203, 505, 459, 39532, 2539, 323, 47934, 89, 1142, 9899, 11, 3686, 198, 9514, 390, 259, 6364, 311, 220, 12164, 349, 11555, 315, 8850, 323, 82484, 430, 690, 20891, 279, 198, 39166, 315 ]
0xBreath/holistic-books
action, seek the help of a competent health professional. © Copyright W alter Last & Austpac Productions. All Rights Reserved. | W eb Design by Austpac.10/30/24, 11:31 AM Health-Science-Spirit - General Diet Rules https://health-science-spirit.com/Healing_Foods/General-Diet-Rules.html 6/6<|eot_id|><|begin_of_text|>WHEA T AND GLUTEN by W alter Last Have a closer look at wheat and gluten. In some form they can be beneficial, but as commonly used they tend to create a lot of problems for our health. Gluten is a mixture of two groups of proteins - gliadins and glutelins. Wheat has the highest content of gluten, especially hard wheat, and makes it possible to bake leavened bread and cakes. Under the conditions of baking, gluten forms a network of molecules, similar to a wire mesh. This molecule mesh traps small bubbles of carbon dioxide gas and prevents them from escaping. This makes the baked product light and easy to chew. However, in this way we create a problem for our digestion because the gluten network is more difficult to break down. The gluten network is only partly digested, especially if the food is not very well chewed; this is a main cause of intestinal inflammation and wheat allergy. MALABSORPTION Gluten seriously weakens the intestinal wall. Its effect on the tiny absorption villi in the small intestine may be compared to the action of sandpaper on wood. Animal experiments have shown that the intestinal absorption villi are long and slender before they come into repeated contact with wheat protein. Afterwards, they become blunt and broad, with a much-reduced ability to absorb. Therefore, people on wheat diets absorb nutrients less well than those reared on wheat-free diets. This greatly contributes to the widespread incidence in our society of people with problems of malabsorption and who are missing out on vital nutrients. In such people, not only are the absorption villi blunted, the irritation caused by the sandpaper effect of gluten produces a protective mucus coating over the intestinal wall and this makes it still more difficult for nutrients to pass through the intestinal wall. Thus we find gluten, and especially wheat gluten, implicated not only in the cause of typical malabsorption diseases, such as cystic fibrosis, celiac disease and sprue, but frequently also with arthritis, autoimmune diseases, cancer, diabetes, kidney problems, multiple sclerosis and schizophrenia. In addition, the irritation caused by gluten is a main factor in causing appendicitis, colitis and inflammation of the small intestines (for example Crohn's disease) as well as gastric and duodenal ulcers. The degree of damage to the intestinal wall is proportional to the amount of gluten used. Most affected are close relatives of those with gluten allergy. But even so-ca lled normal and healthy volunteers on high-gluten test diets showed a deterioration of their intestinal walls and that their ability to absorb nutrients had been reduced. Malabsorption is even more of a problem if white bread is used because it has lost about 80 per cent of its vitamin and mineral content compared to that of wholem eal bread. What makes it even worse is the modern fast-baking method: instead of fermenting the bread for four to seven hours, it is now whipped with chemicals for two minutes. Thus the few remaining minerals stay tightly bound to phytic acid and cannot be absorbed. GLUTEN ALLERGY When the intestinal wall deteriorates it becomes permeable so that molecules bigger than normal can pass through. This allows partly digested proteins and bacterial toxins to enter the bloodstream, causing allergies and a deterioration of the immune system. Thus gluten is actually the main agent causing allergies. Without a weakening of the intestinal wall, other potential food allergens would be prevented from reaching the bloodstream, except in the case of babies with intestinal walls that are still immature. Young babies also are unable to digest starches. Feeding them wheat products, which is very common indeed, almost automatically leads to the development of wheat allergy. Therefore cow's milk and wheat are the two primary food allergies in our society; not only do they precede the development of other allergies, but their initial appearance makes it so much easier for secondary allergies to develop. It has been estimated that about 90 million Americans suffer from gluten sensitivity, while celiac disease, a severe form of malabsorption caused by gluten, has now been found 50 times more prevalent than previously suspected. About 1.5 million Americans are thought to suffer from it. In its conclusions, the report states that celiac disease occurs frequently not only in patients with gastrointestinal symptoms, but also in relatives and others with numerous common disorders, even in the absence of gastrointestinal symptoms. All these problems caused by gluten are greatly intensified by the tough network of gluten molecules formed in baking with gluten-rich flour. In former centuries only low-glu ten wheat was available; high-gluten wheat is a modern achievement. In addition, the amount of Home About Diseases Healing the Body Healing Foods Healing the Mind Healing the Emotions Energies Science & Spirituality Spirituality Contact10/30/24, 2:43 PM Health-Science-Spirit - Wheat & Gluten https://health-science-spirit.com/Healing_Foods/Wheat-Gluten.html 1/2wheat baking, especially with high-gluten wheat, has greatly increased in our society compared to former centuries, while at the same time our digestive powers have very much declined. As this trend has existed already for several generations, most of us are by now sensitized to some degree against wheat gluten, and wheat-baking products have become problem foods for most individuals, including wholemeal wheat bread and not just the white variety. Our ancestors used mainly millet, rye and oats as staple grains in addition to low-gluten wheat and spelt. They also used grains more in the form of porridge or wafers than as leavened bread. However, when leavened bread was used, it was mainly as sourdough bread, except in the cities where yeast baking gradually dominated. Rye, barley and oats contain less gluten than wheat and the protein composition is slightly different in these grains; thus even if you have a wheat allergy, you may still be able to eat these grains. However this is often not the case and it is preferable that you avoid these for an extended period if you have a wheat allergy and use gluten-free grains instead. These are rice, millet and maize. Buckwheat is not a cereal grain - it belongs to the rhubarb family - but it contains a gluten-like protein that requires allergy testing before being used by individuals allergic to gluten. Processed food, including tablets and soy sauce, often contain added wheat starch or gluten. If you have a wheat allergy and use processed food, then read labels carefully. Wheat grass, however, is safe to use; wheat-germ oil needs to be tested. IRIS DIAGNOSIS Blue-eyed individuals with wheat or gluten intolerance usually have a whitish color in the area of the iris denoting the intestines. This reflex zone that surrounds the pupil indicates the irritation and mucus covering of the intestinal wall. Frequently, the white fans out to other parts of the iris, but especially to the head and brain reflex areas that are in the upper part of the iris (between 10 and 2 o'clock). This indicates gluten-induced mucus congestion of the head and irritation of the brain tissues. Such people are vulnerable to emotional irritability, bursts of temper and, in the case of brain allergy, to epilepsy and mental disease. They cannot relax easily, and attending emotional workshops or seeking psychiatric help will do little permanent good if the nutritional cause of the problem is not corrected. In addition, these individuals often have oversensitive sense organs and tend towards far-sightedness. As long as there is no serious mucus congestion in the head, the sharpened senses provide good eyesight and excellent hearing. The disadvantages are oversensitive taste buds, an oversensitive sense of smell, and distress caused by loud noise. Magnesium supplements will help but not remove the basic cause. In later life, mucus congestion may lead to deafness and eye diseases. If there is, in addition to wheat or gluten intolerance, difficulty in digesting fats, the white iris areas will become increasingly yellow. Baked wheat products, especially in combination with sugars, are the most 'fattening' food for susceptible individuals. The metabolism of such individuals becomes inefficient and the wheat starch is mainly converted into body fat instead of energy. Frequently individuals allergic to wheat, gluten and beer have a distended abdomen (potbelly). For many individuals, gluten products especially wheat and beer, are strongly mucus forming. Generally, the whiter the iris, the more mucus-forming is the gluten. Wheat and gluten are often a problem for those with asthma and hay fever. If you have any problem with mucus, avoid all gluten products initially together with all foods containing lactose. After sufficient improvement you may introduce small amounts of rye and oats and explore how much of these your body tolerates. Most 'improved' or 'health' breads contain added gluten, skim-milk powd er, or dried whole grain and are worse than plain wholemeal bread. Most recommended are rye sourdough bread and rye crispbread. However, rye sourdough bread often contains added wheat described
[ 1957, 11, 6056, 279, 1520, 315, 264, 40883, 2890, 6721, 627, 20644, 3028, 468, 11857, 8155, 612, 13222, 46051, 52964, 13, 2052, 10734, 15516, 13, 765, 468, 25470, 7127, 555, 13222, 46051, 13, 605, 14, 966, 14, 1187, 11, 220, 806, 25, 2148, 6912, 6401, 12, 36500, 6354, 53829, 482, 3331, 27304, 23694, 198, 2485, 1129, 12393, 31419, 1873, 1355, 53829, 916, 14, 1548, 6260, 1426, 9242, 14, 15777, 9607, 3978, 11151, 2482, 2628, 220, 21, 14, 21, 128009, 128000, 54, 1837, 32, 350, 3651, 70373, 965, 198, 1729, 468, 11857, 8155, 198, 12389, 264, 12401, 1427, 520, 34153, 323, 38455, 627, 644, 1063, 1376, 814, 649, 387, 20331, 171, 71831, 16158, 11, 719, 439, 17037, 1511, 814, 8541, 311, 1893, 264, 2763, 315, 5435, 369, 1057, 2890, 627, 32641, 13462, 374, 264, 21655, 315, 1403, 5315, 315, 28896, 482, 29032, 329, 1354, 323, 35169, 301, 1354, 13, 56738, 706, 279, 8592, 2262, 315, 38455, 11, 5423, 2653, 34153, 345, 438, 3727, 433, 3284, 311, 23360, 514, 5389, 291, 16385, 323, 48669, 13, 9636, 279, 4787, 315, 28915, 11, 38455, 7739, 264, 4009, 315, 35715, 345, 65387, 311, 264, 9244, 11546, 13, 1115, 43030, 11546, 45660, 2678, 44783, 315, 12782, 40589, 6962, 323, 29034, 1124, 505, 53754, 13, 1115, 3727, 198, 1820, 41778, 2027, 3177, 323, 4228, 311, 37433, 16853, 11458, 1174, 304, 420, 1648, 584, 1893, 264, 3575, 369, 1057, 74502, 1606, 279, 38455, 4009, 374, 810, 1422, 171, 71831, 93113, 311, 1464, 1523, 13, 578, 38455, 198, 17969, 374, 1193, 28135, 4170, 10185, 11, 5423, 422, 279, 3691, 374, 539, 1633, 1664, 37433, 291, 26, 420, 374, 264, 1925, 5353, 315, 63900, 304, 171, 120912, 8836, 367, 323, 198, 86, 20559, 60754, 16853, 89899, 1905, 40642, 6715, 198, 32641, 13462, 14243, 7621, 729, 279, 63900, 7147, 13, 11699, 2515, 389, 279, 13987, 44225, 9077, 72, 304, 279, 2678, 92234, 1253, 387, 7863, 311, 279, 1957, 198, 1073, 9462, 19716, 389, 7732, 13, 21995, 21896, 617, 6982, 430, 279, 63900, 44225, 9077, 72, 527, 1317, 323, 73342, 1603, 814, 2586, 1139, 198, 265, 43054, 3729, 449, 34153, 13128, 13, 87640, 11, 814, 3719, 49770, 323, 7353, 11, 449, 264, 1790, 5621, 54478, 5845, 311, 35406, 627, 55915, 11, 1274, 389, 34153, 41943, 35406, 37493, 2753, 1664, 1109, 1884, 312, 1636, 389, 34153, 12862, 41943, 13, 1115, 19407, 44072, 311, 279, 198, 86, 3422, 21376, 39775, 304, 1057, 8396, 315, 1274, 449, 5435, 315, 8811, 3518, 66181, 323, 889, 527, 7554, 704, 389, 16595, 37493, 13, 763, 1778, 198, 16455, 11, 539, 1193, 527, 279, 44225, 9077, 72, 1529, 28736, 11, 279, 66510, 9057, 555, 279, 9462, 19716, 2515, 315, 38455, 19159, 264, 29219, 296, 38601, 198, 1030, 1113, 927, 279, 63900, 7147, 323, 420, 3727, 433, 2103, 810, 1422, 171, 71831, 93113, 369, 37493, 311, 1522, 1555, 279, 63900, 7147, 627, 45600, 584, 33595, 71831, 303, 38455, 11, 323, 5423, 34153, 38455, 11, 69702, 539, 1193, 304, 279, 5353, 315, 14595, 8811, 3518, 66181, 19338, 11, 1778, 439, 63581, 292, 198, 171, 71831, 65, 63412, 11, 272, 95705, 8624, 323, 8314, 361, 11, 719, 14134, 1101, 449, 55652, 11, 88191, 19338, 11, 9572, 1174, 20335, 11, 39042, 5435, 345, 36773, 91357, 323, 58533, 662, 763, 5369, 11, 279, 66510, 9057, 555, 38455, 374, 264, 1925, 8331, 304, 14718, 8911, 19195, 285, 11, 1400, 20000, 323, 198, 258, 171, 120912, 8836, 367, 315, 279, 2678, 39408, 1572, 320, 2000, 3187, 25611, 25105, 596, 8624, 8, 439, 1664, 439, 89385, 323, 3930, 55836, 278, 8725, 17254, 627, 791, 8547, 315, 5674, 311, 279, 63900, 7147, 374, 55272, 311, 279, 3392, 315, 38455, 1511, 13, 7648, 11754, 527, 3345, 29658, 315, 1884, 198, 4291, 38455, 60754, 662, 2030, 1524, 779, 51877, 326, 839, 4725, 323, 9498, 23872, 389, 1579, 70750, 13462, 1296, 41943, 8710, 264, 82189, 315, 872, 198, 71558, 14620, 323, 430, 872, 5845, 311, 35406, 37493, 1047, 1027, 11293, 627, 30700, 3518, 66181, 374, 1524, 810, 315, 264, 3575, 422, 4251, 16385, 374, 1511, 1606, 433, 706, 5675, 922, 220, 1490, 824, 2960, 315, 1202, 28170, 323, 25107, 198, 1834, 7863, 311, 430, 315, 889, 3516, 384, 278, 16385, 13, 3639, 3727, 433, 1524, 11201, 374, 279, 6617, 5043, 1481, 1802, 1749, 25, 4619, 315, 68736, 287, 198, 1820, 16385, 369, 3116, 311, 8254, 4207, 11, 433, 374, 1457, 64357, 449, 26333, 369, 1403, 4520, 13, 14636, 279, 2478, 9861, 34072, 4822, 40069, 198, 11130, 311, 1343, 70504, 13935, 323, 4250, 387, 42101, 627, 3910, 1406, 965, 13398, 61541, 198, 4599, 279, 63900, 7147, 39436, 988, 433, 9221, 55424, 481, 779, 430, 35715, 11493, 1109, 4725, 649, 1522, 1555, 13, 1115, 6276, 198, 4581, 398, 4170, 10185, 28896, 323, 45964, 62186, 311, 3810, 279, 100216, 11, 14718, 58742, 323, 264, 82189, 315, 279, 22852, 1887, 627, 45600, 38455, 374, 3604, 279, 1925, 8479, 14718, 58742, 13, 17586, 264, 83526, 315, 279, 63900, 7147, 11, 1023, 4754, 3691, 25405, 729, 198, 41450, 387, 32098, 505, 19261, 279, 100216, 11, 3734, 304, 279, 1162, 315, 24869, 449, 63900, 14620, 430, 527, 2103, 86525, 627, 41672, 24869, 1101, 527, 12153, 311, 21552, 70181, 288, 13, 3926, 16490, 1124, 34153, 3956, 11, 902, 374, 1633, 4279, 13118, 11, 4661, 9651, 198, 99470, 311, 279, 4500, 315, 34153, 60754, 662, 15636, 19923, 596, 14403, 323, 34153, 527, 279, 1403, 6156, 3691, 58742, 304, 1057, 8396, 26, 539, 1193, 198, 3055, 814, 16599, 68, 279, 4500, 315, 1023, 58742, 11, 719, 872, 2926, 11341, 3727, 433, 779, 1790, 8831, 369, 14580, 58742, 311, 198, 16219, 627, 2181, 706, 1027, 13240, 430, 922, 220, 1954, 3610, 9053, 7831, 505, 38455, 27541, 1174, 1418, 272, 95705, 8624, 11, 264, 15748, 1376, 315, 198, 14991, 3518, 66181, 9057, 555, 38455, 11, 706, 1457, 1027, 1766, 220, 1135, 3115, 810, 46941, 1109, 8767, 24740, 13, 10180, 220, 16, 13, 20, 3610, 198, 92786, 527, 3463, 311, 7831, 505, 433, 13, 763, 1202, 31342, 11, 279, 1934, 5415, 430, 272, 95705, 8624, 13980, 14134, 539, 1193, 304, 6978, 198, 4291, 80311, 13803, 11, 719, 1101, 304, 29658, 323, 3885, 449, 12387, 4279, 24673, 11, 1524, 304, 279, 19821, 315, 198, 70, 23834, 71558, 13803, 627, 2460, 1521, 5435, 9057, 555, 38455, 220, 527, 19407, 25228, 72, 171, 71831, 291, 555, 279, 11292, 4009, 315, 38455, 35715, 14454, 304, 28915, 449, 38455, 41947, 198, 171, 120912, 414, 13, 763, 4846, 24552, 1193, 3428, 2427, 10036, 5899, 34153, 574, 2561, 26, 1579, 70750, 13462, 34153, 374, 264, 6617, 26501, 13, 763, 5369, 11, 279, 3392, 315, 198, 7778, 10180, 70674, 49741, 279, 14285, 49741, 40160, 49741, 279, 23754, 49741, 279, 5867, 41356, 75101, 552, 10170, 612, 17326, 10965, 17326, 10965, 9359, 605, 14, 966, 14, 1187, 11, 220, 17, 25, 3391, 5975, 6401, 12, 36500, 6354, 53829, 482, 56738, 612, 96012, 198, 2485, 1129, 12393, 31419, 1873, 1355, 53829, 916, 14, 1548, 6260, 1426, 9242, 22964, 20559, 12279, 75, 13462, 2628, 220, 16, 14, 17, 86, 20559, 28915, 11, 5423, 449, 1579, 70750, 13462, 34153, 11, 706, 19407, 7319, 304, 1057, 8396, 7863, 311, 4846, 24552, 11, 1418, 520, 279, 1890, 198, 1712, 1057, 60071, 13736, 617, 1633, 1790, 19284, 627, 2170, 420, 9327, 706, 25281, 2736, 369, 3892, 22540, 11, 1455, 315, 603, 527, 555, 1457, 74633, 1534, 311, 1063, 8547, 2403, 34153, 38455, 11, 323, 198, 86, 20559, 1481, 1802, 3956, 617, 3719, 3575, 15657, 369, 1455, 7931, 11, 2737, 4459, 42880, 34153, 16385, 323, 539, 1120, 279, 4251, 198, 30265, 2676, 662, 5751, 38618, 1511, 14918, 112455, 11, 436, 9188, 323, 85270, 439, 50056, 41936, 304, 5369, 311, 3428, 70750, 13462, 34153, 323, 993, 3903, 13, 2435, 1101, 1511, 198, 911, 1771, 810, 304, 279, 1376, 315, 4247, 11431, 477, 289, 2642, 388, 1109, 439, 514, 5389, 291, 16385, 13, 4452, 1174, 994, 514, 5389, 291, 16385, 574, 1511, 11, 433, 574, 14918, 439, 198, 82, 77492, 1409, 16385, 11, 3734, 304, 279, 9919, 1405, 41580, 28915, 27115, 30801, 627, 49, 9188, 11, 81817, 323, 85270, 6782, 2753, 38455, 1109, 34153, 323, 279, 13128, 18528, 374, 10284, 2204, 304, 1521, 41936, 26, 8617, 1524, 422, 499, 198, 19553, 264, 34153, 60754, 1174, 499, 1253, 2103, 387, 3025, 311, 8343, 1521, 41936, 13, 4452, 420, 374, 3629, 539, 279, 1162, 323, 433, 374, 70668, 430, 499, 5766, 198, 45010, 369, 459, 11838, 4261, 422, 499, 617, 264, 34153, 60754, 323, 1005, 38455, 12862, 41936, 4619, 13, 4314, 527, 20228, 11, 112455, 323, 93307, 627, 33, 1983, 86, 20559, 374, 539, 264, 62233, 24875, 482, 433, 17623, 311, 279, 22408, 45597, 65, 3070, 482, 719, 433, 5727, 264, 38455, 12970, 13128, 430, 7612, 60754, 7649, 198, 15145, 1694, 1511, 555, 7931, 57596, 311, 38455, 627, 83635, 3691, 11, 2737, 29679, 323, 29839, 19737, 11, 3629, 6782, 3779, 34153, 70181, 477, 38455, 13, 1442, 499, 617, 264, 34153, 60754, 323, 1005, 198, 35122, 3691, 11, 1243, 1373, 9382, 15884, 662, 56738, 16763, 11, 4869, 1174, 374, 6220, 311, 1005, 26, 34153, 12, 1414, 76, 5707, 3966, 311, 387, 12793, 627, 2871, 1669, 99267, 45, 3204, 1669, 198, 10544, 53613, 7931, 449, 34153, 477, 38455, 75431, 6118, 617, 264, 34799, 819, 1933, 304, 279, 3158, 315, 279, 65042, 3453, 11780, 279, 39408, 1572, 13, 1115, 198, 265, 171, 120912, 327, 10353, 430, 71374, 279, 61072, 15151, 279, 66510, 323, 296, 38601, 18702, 315, 279, 63900, 7147, 13, 93720, 1174, 279, 4251, 7359, 704, 311, 198, 1605, 5596, 315, 279, 65042, 11, 719, 5423, 311, 279, 2010, 323, 8271, 312, 171, 120912, 327, 5789, 430, 527, 304, 279, 8582, 961, 315, 279, 65042, 320, 42967, 220, 605, 323, 220, 17, 198, 78, 63510, 570, 1115, 15151, 38455, 38973, 296, 38601, 55146, 315, 279, 2010, 323, 66510, 315, 279, 8271, 39881, 13, 15483, 1274, 527, 20134, 311, 198, 336, 41964, 30118, 2968, 1174, 66801, 315, 6940, 323, 11, 304, 279, 1162, 315, 8271, 60754, 1174, 311, 70655, 323, 10723, 8624, 13, 2435, 4250, 12234, 6847, 1174, 323, 198, 1617, 2518, 14604, 35936, 477, 11125, 47657, 1520, 690, 656, 2697, 15690, 1695, 422, 279, 43226, 5353, 315, 279, 3575, 374, 539, 198, 20523, 291, 627, 644, 5369, 11, 1521, 7931, 3629, 617, 17918, 19245, 5647, 36853, 323, 8541, 7119, 3117, 1355, 65607, 2136, 13, 1666, 1317, 439, 1070, 374, 912, 6129, 198, 76, 38601, 55146, 304, 279, 2010, 11, 279, 57463, 291, 38207, 3493, 1695, 6548, 492, 323, 9250, 11011, 13, 578, 64725, 527, 198, 9146, 19245, 12945, 68543, 11, 459, 17918, 19245, 5647, 315, 22843, 11, 323, 35104, 9057, 555, 17813, 12248, 13, 20918, 41930, 33690, 690, 1520, 719, 198, 1962, 4148, 279, 6913, 5353, 13, 763, 3010, 2324, 11, 296, 38601, 55146, 1253, 3063, 311, 47842, 2136, 323, 8071, 19338, 13, 1442, 1070, 374, 11, 304, 5369, 311, 34153, 477, 198, 6200, 13462, 75431, 11, 1422, 171, 71831, 66, 15070, 304, 21552, 287, 50127, 11, 279, 4251, 65042, 5789, 690, 3719, 15098, 14071, 16853, 33, 7897, 34153, 3956, 11, 5423, 304, 10824, 449, 70913, 11, 527, 279, 1455, 364, 69, 1617, 6147, 6, 3691, 369, 47281, 7931, 13, 578, 198, 4150, 53904, 2191, 315, 1778, 7931, 9221, 304, 830, 171, 71831, 12575, 323, 279, 34153, 70181, 374, 14918, 16489, 1139, 2547, 8834, 4619, 315, 4907, 16853, 37, 70941, 7931, 57596, 311, 34153, 11, 38455, 323, 13179, 617, 264, 1612, 2954, 64772, 320, 19644, 9978, 398, 4390, 2520, 1690, 7931, 11, 38455, 3956, 5423, 34153, 323, 13179, 11, 527, 16917, 296, 38601, 30164, 13, 44493, 1174, 279, 421, 2058, 279, 65042, 11, 279, 810, 198, 76, 38601, 8627, 287, 374, 279, 38455, 13, 56738, 323, 38455, 527, 3629, 264, 3575, 369, 1884, 449, 51643, 323, 18137, 34653, 662, 1442, 499, 617, 904, 3575, 449, 198, 76, 38601, 11, 5766, 682, 38455, 3956, 15453, 3871, 449, 682, 15657, 8649, 51644, 974, 13, 4740, 56868, 171, 71831, 12575, 16048, 499, 1253, 19678, 198, 9181, 15055, 315, 436, 9188, 323, 85270, 323, 13488, 1268, 1790, 315, 1521, 701, 2547, 15230, 988, 627, 13622, 364, 318, 96608, 6, 477, 364, 12393, 6, 16385, 82, 6782, 3779, 38455, 11, 79669, 1474, 34263, 7019, 67, 2781, 11, 477, 32720, 4459, 24875, 323, 527, 11201, 1109, 14733, 4459, 42880, 198, 48616, 13, 7648, 11349, 527, 436, 9188, 20897, 67, 1409, 16385, 323, 436, 9188, 42954, 48616, 13, 4452, 1174, 436, 9188, 20897, 67, 1409, 16385, 3629, 5727, 3779, 34153, 198, 5919, 17890 ]
0xBreath/holistic-books
swelling, redness, and often copioussecretions of mucous and pus, such as colds, flu, a first time case of pneumonia,inflamed joints as in the early stages of arthritis, etc. These acute conditionsusually remedy in one to three weeks of fasting. Acute conditions are excellentcandidates for self-doctoring. Chronic degenerative conditions are more seriousand the patient usually requires supervision. These include conditions such ascancer, aids, chronic arthritis, chronic pneumonia, emphysema and asthma.Chronic degenerative conditions usually respond within a month to three monthsof fasting. The fasting should be broken up into two or three sessions if thecondition has not been relieved in one stint of supervised fasting. Each successivefast will produce some improvement and if a light, largely raw-food diet isadhered to between fasts the patient should not worsen and should be fairlycomfortable between fastings. If there has been major functional damage to an organ as a result of any of these degenerative conditions, healing will not be complete, or may be impossible. By organic damage, I mean that a vital part of the body has ceased to function due to some degenerative process, injury, or surgery—so badly damaged that thecells that make up the organ can not be replaced. I once had a twenty five year old man come to my spa to die in peace because he had been through enough diagnostic procedures in three hospitals to know thathis liver was beyond repair. He had been working on an apple farm in betweenterms at university when he was poisoned several times with insecticide from anaerial spray on the whole orchard. He absorbed so much insecticide that his liverincurred massive organic damage. When he came to me his body had reached the point where it was incapable of digesting, and because of lack of liver function, it was incapable of healingwhile fasting, a condition in which death is a certainty. He was a Buddhist, did notfear death and did not want to be kept alive in agony or in prolongedunconsciousness by any extraordinary means, nor did he want to die with tubes inevery orifice. I was honored to be a supportive participant in his passing. He diedfasting, in peace, and without pain, with a clear mind that allowed him toconsciously prepare for the experience. He was not in a state of denial or fear,and made no frantic attempts to escape the inevitable. He went quietly into thatstill dark night with a tranquil demeanor and a slight smile. Fortunately, in my many years of practice I had the pleasure of seeing the majority of the people totally regain their health or at least greatly improve it bymeans of the fasting and healing diets. Many cancer patients watched withamazement as their tumors disappeared before their eyes, many arthritics regainedtheir function, serious skin conditions such as psoriasis disappeared, mentalconditions improved, addictions vanished, fatigue was replaced by energy, and fatdissolved revealing the hidden sculpture beneath. I will talk more aboutprocedures and the particular reasons bodies develop specific conditions in laterchapters. Social/Cultural/Psychological Obstacles To Fasting Numerous attitudes make it difficult to fast or to provide moral support to friends or loved ones that are fasting. Many people harbor fears of losing weightbecause they think that if times were really tough, if there was a famine or theybecame ill and lost a lot of weight they would have no reserves and wouldcertainly perish. These people have no idea how much fat can be concealed on aneven skinny body, nor of how slowly a skinny body loses weight while fasting.Substantial fat reserves are helpful as heat-retaining insulation in those rareaccidents when someone is dropped into a cold ocean and must survive until therescue boat arrives. Being fat might keep a person alive longer who is lost in thewilderness awaiting rescue with no supplies, no means of procuring food, and nomeans of keeping warm. On the other hand, fat people would have a far hardertime walking out of the wilderness. And extensive fat deposits are merely fuel anddo not contain extensive nutritional reserves. An obese person fasting withoutsignificant nutritional supplementation would begin starving long before theybecame really skinny. On the balance, carrying excess weight is a far greaterliability than any potential pro-survival aspects it might have. There are other attitudes associated with weight loss that make it difficult for people to fast. People hold rather stereotypical notions about what constitutes anattractive person; usually it involves having some flesh on one’s bones. Hollywoodand Hugh Hefner have both influenced the masses to think that women shouldhave hourglass figures with large, upthrust, firm breasts. Since breasts are almostall useless fatty tissue supporting some milk-producing glands that do not give abreast much volume except when engorged, most women fasters loose a goodpercentage of their breast mass. If the fast is extensive, there should also developan impressive showing of ribs and hip bones; these are not soft and cuddly.Husbands, lovers, parents, and friends frequently point out that you don’t lookgood this way and exhort you to put on weight. Most people think pleasantlyplump is healthy. Skinny men, especially those who had lost a lot of weight during an illness, are pressured by associates to put on weight to prove that they are healthy. I had aclient who was formerly a college varsity football player. Before his illness he hadlifted weights and looked like a hunk. His family and friends liked to see him thatway and justifiably so. Then he got seriously ill. On a long extended healing diethe lost a significant amount of weight and seemed downright skinny, causing allwho knew him well and cared about him to tempt him with all kinds ofscrumptious delicacies from the best of kitchens. But this case was like LuigiCornaro, a man who never again could look like a hunk. His “friends” made anabsolutely necessary change in life style and appearance far more difficult than itwas already. My client was torn between a desire to please others, and a desireto regain and retain his health. This problem a sick person doesn’t need. If you have the independence to consider following an alternative medical program in a culture that highly values conformity and agreement, you are alsogoing to have to defend your own course of self-determined action based on thebest available data that you have. But fasters are usually in fragile emotionalcondition, so I advise my clients who are subjected to this kind of pressure to begtheir friends and associates to refrain from saying anything if they can’t support thecourse of action you have chosen. After this, if friends or relatives are stillincapable of saying nothing (even non-verbally), it is important to exclude themfrom your life until you have accomplished your health goals, have regained someweight and have returned to eating a maintenance diet, rather than getting skinnieron a healing one. The very worst aspect of our culture’s eating programming is that people have been wrongfully taught that when ill they must eat to keep up their strength.Inherent in this recommendation is an unstated belief that when the body isweakened by a disease state, the weakness can somehow be overcome withfood, and that the body needs this food to kill the virus, bacteria, or invadingyeast, and uses the protein to heal or rebuild tissue. Sadly, the exact opposite is the case. Disease organisms feed and multiply on the toxic waste products of misdigestion, and the body is unable to digest well when it is weak or ill. There’s an old saying about this: “feed a cold, starve a fever.” Most people think this saying means you should eat when you have a cold. What the sayingreally means is if you feed a cold then you will soon have to starve a fever.Chcken soup? Protein foods especially are not digested by a diseased body, andas mentioned before, the waste products of protein indigestion are especiallypoisonous. That is all the body needs when it is already down, another load ofpoison which it can’t eliminate due to weakness and enervation. Weight loss is usually associated with illness, as it should be! In times of acute illness an otherwise healthy body loses its appetite for food because it is pro-survival to stop eating. It is very hard to coax a sick animal to eat. Their bodies,not controlled by a mind full of complex learned responses and false ideas,automatically know that fasting is nature’s method of healing. Contrary to popularunderstanding, digestion, assimilation, and elimination require the expenditure ofconsiderable energy. This fact may contradict the reader’s experience becauseeveryone has become tired when they have worked a long time without eating,and then experienced the lift after eating. But an ill body cannot digest efficientlyso instead of providing energy extracted from foods, the body is further burdenedby yet another load of toxic material produced by fermented and putrefied food.This adds insult to injury in a sick body that is already drowning in its owngarbage. Worse, during illness most available vital force is already redirected into healing; it is not available for digestion. It is important to allow a sick body toproceed with healing and not to obstruct the process with unnecessary digestionor suppress the symptoms (which actually are the healing efforts) with drugs. Ifyou have an acute illness, and you stop all food intake except for pure water andherb teas, and perhaps some vegetable broth, or dilute non-sweet juice, you haverelieved your body of an immense effort. Instead of digesting, the body goes to work on catching up on healing. The body can and will almost inevitably heal itself if the sick person will have faith in it, cooperate with the body’s efforts by allowingthe symptoms of healing to exist, reduce or eliminate the intake of food to allowthe body
[ 55307, 11, 2579, 2136, 11, 323, 3629, 6293, 1245, 21107, 919, 315, 65104, 788, 323, 75676, 11, 1778, 439, 9439, 82, 11, 20236, 11, 264, 1176, 892, 1162, 315, 69329, 54788, 1517, 3690, 35358, 439, 304, 279, 4216, 18094, 315, 55652, 11, 5099, 13, 4314, 30883, 4787, 44066, 40239, 304, 832, 311, 2380, 5672, 315, 54560, 13, 6515, 1088, 4787, 527, 9250, 92445, 369, 659, 30659, 5009, 287, 13, 73782, 5367, 75989, 4787, 527, 810, 6129, 438, 279, 8893, 6118, 7612, 38217, 13, 4314, 2997, 4787, 1778, 14943, 11967, 11, 52797, 11, 21249, 55652, 11, 21249, 69329, 11, 991, 12989, 325, 1764, 323, 51643, 6487, 8535, 5367, 75989, 4787, 6118, 6013, 2949, 264, 2305, 311, 2380, 2305, 708, 69, 54560, 13, 578, 54560, 1288, 387, 11102, 709, 1139, 1403, 477, 2380, 16079, 422, 279, 9233, 706, 539, 1027, 51512, 304, 832, 61808, 315, 60089, 54560, 13, 9062, 50024, 9533, 690, 8356, 1063, 16048, 323, 422, 264, 3177, 11, 14090, 7257, 64567, 10173, 374, 329, 1964, 291, 311, 1990, 5043, 82, 279, 8893, 1288, 539, 47293, 268, 323, 1288, 387, 14470, 19975, 481, 1990, 5043, 826, 627, 2746, 1070, 706, 1027, 3682, 16003, 5674, 311, 459, 2942, 439, 264, 1121, 315, 904, 315, 198, 45010, 5367, 75989, 4787, 11, 21730, 690, 539, 387, 4686, 11, 477, 1253, 387, 12266, 627, 1383, 17808, 5674, 11, 358, 3152, 430, 264, 16595, 961, 315, 279, 2547, 706, 59477, 311, 734, 198, 24567, 311, 1063, 5367, 75989, 1920, 11, 11134, 11, 477, 15173, 2345, 708, 25587, 20727, 430, 279, 37791, 430, 1304, 709, 279, 2942, 649, 539, 387, 12860, 627, 40, 3131, 1047, 264, 17510, 4330, 1060, 2362, 893, 2586, 311, 856, 31493, 311, 2815, 304, 9096, 1606, 198, 383, 1047, 1027, 1555, 3403, 15439, 16346, 304, 2380, 24461, 311, 1440, 430, 26301, 26587, 574, 7953, 13023, 13, 1283, 1047, 1027, 3318, 389, 459, 24149, 8961, 304, 1297, 906, 1992, 1026, 520, 12374, 994, 568, 574, 71598, 3892, 3115, 449, 27080, 14842, 505, 41390, 2918, 23749, 389, 279, 4459, 41245, 569, 13, 1283, 42101, 779, 1790, 27080, 14842, 430, 813, 26587, 2910, 8293, 11191, 17808, 5674, 627, 4599, 568, 3782, 311, 757, 813, 2547, 1047, 8813, 279, 1486, 1405, 433, 574, 58271, 198, 1073, 21552, 287, 11, 323, 1606, 315, 6996, 315, 26587, 734, 11, 433, 574, 58271, 315, 21730, 3556, 54560, 11, 264, 3044, 304, 902, 4648, 374, 264, 44743, 13, 1283, 574, 264, 47841, 11, 1550, 539, 69, 686, 4648, 323, 1550, 539, 1390, 311, 387, 8774, 13989, 304, 79930, 477, 304, 44387, 359, 64589, 2136, 555, 904, 24674, 3445, 11, 6463, 1550, 568, 1390, 311, 2815, 449, 34083, 19661, 1225, 477, 22660, 13, 358, 574, 39377, 311, 387, 264, 33445, 25923, 304, 813, 12579, 13, 1283, 8636, 9533, 287, 11, 304, 9096, 11, 323, 2085, 6784, 11, 449, 264, 2867, 4059, 430, 5535, 1461, 311, 444, 71888, 10772, 369, 279, 3217, 13, 1283, 574, 539, 304, 264, 1614, 315, 35013, 477, 8850, 51526, 1903, 912, 89706, 13865, 311, 12731, 279, 31352, 13, 1283, 4024, 30666, 1139, 430, 44466, 6453, 3814, 449, 264, 68040, 94115, 323, 264, 8275, 15648, 627, 73055, 11, 304, 856, 1690, 1667, 315, 6725, 358, 1047, 279, 17069, 315, 9298, 279, 198, 37605, 488, 315, 279, 1274, 12756, 49655, 872, 2890, 477, 520, 3325, 19407, 7417, 433, 555, 47321, 315, 279, 54560, 323, 21730, 41943, 13, 9176, 9572, 6978, 15746, 449, 109931, 1133, 439, 872, 56071, 29496, 1603, 872, 6548, 11, 1690, 802, 339, 1018, 1233, 86025, 50828, 734, 11, 6129, 6930, 4787, 1778, 439, 4831, 93003, 29496, 11, 10723, 16902, 13241, 11, 923, 22155, 59581, 11, 36709, 574, 12860, 555, 4907, 11, 323, 8834, 67, 1056, 8905, 31720, 279, 8340, 51067, 24923, 13, 358, 690, 3137, 810, 922, 782, 54791, 323, 279, 4040, 8125, 13162, 2274, 3230, 4787, 304, 3010, 331, 17881, 627, 27414, 11547, 44547, 16744, 82, 5759, 5848, 4761, 75079, 2057, 435, 15067, 198, 68837, 788, 33726, 1304, 433, 5107, 311, 5043, 477, 311, 3493, 16033, 1862, 311, 198, 30562, 477, 10456, 6305, 430, 527, 54560, 13, 9176, 1274, 57511, 24087, 315, 13490, 4785, 28753, 814, 1781, 430, 422, 3115, 1051, 2216, 11292, 11, 422, 1070, 574, 264, 79054, 477, 814, 17106, 373, 5986, 323, 5675, 264, 2763, 315, 4785, 814, 1053, 617, 912, 30600, 323, 1053, 66, 7770, 398, 83217, 13, 4314, 1274, 617, 912, 4623, 1268, 1790, 8834, 649, 387, 44133, 389, 459, 17206, 48777, 2547, 11, 6463, 315, 1268, 14297, 264, 48777, 2547, 33291, 4785, 1418, 54560, 12672, 77057, 8834, 30600, 527, 11190, 439, 8798, 70210, 2101, 49117, 304, 1884, 9024, 4575, 7024, 994, 4423, 374, 12504, 1139, 264, 9439, 18435, 323, 2011, 18167, 3156, 9139, 3380, 361, 15688, 30782, 13, 21347, 8834, 2643, 2567, 264, 1732, 13989, 5129, 889, 374, 5675, 304, 279, 68974, 29668, 45088, 17629, 449, 912, 17135, 11, 912, 3445, 315, 13988, 1711, 3691, 11, 323, 17567, 598, 315, 10494, 8369, 13, 1952, 279, 1023, 1450, 11, 8834, 1274, 1053, 617, 264, 3117, 2653, 70841, 11689, 704, 315, 279, 49362, 13, 1628, 16781, 8834, 34751, 527, 16632, 10633, 323, 3055, 539, 6782, 16781, 43226, 30600, 13, 1556, 50320, 1732, 54560, 2085, 91645, 43226, 73796, 1053, 3240, 78501, 1317, 1603, 814, 17106, 373, 2216, 48777, 13, 1952, 279, 8335, 11, 15691, 13937, 4785, 374, 264, 3117, 7191, 747, 2968, 1109, 904, 4754, 463, 68806, 85, 4023, 13878, 433, 2643, 617, 627, 3947, 527, 1023, 33726, 5938, 449, 4785, 4814, 430, 1304, 433, 5107, 369, 198, 16455, 311, 5043, 13, 9029, 3412, 4856, 23473, 88167, 59682, 922, 1148, 42675, 459, 266, 70178, 1732, 26, 6118, 433, 18065, 3515, 1063, 26000, 389, 832, 753, 25896, 13, 17681, 438, 30206, 473, 830, 1215, 617, 2225, 28160, 279, 32738, 311, 1781, 430, 3278, 1288, 19553, 6596, 59536, 12678, 449, 3544, 11, 709, 339, 36888, 11, 7626, 37449, 13, 8876, 37449, 527, 4661, 543, 29948, 40085, 20438, 12899, 1063, 14403, 90375, 82375, 430, 656, 539, 3041, 67441, 561, 1790, 8286, 3734, 994, 2995, 1813, 291, 11, 1455, 3278, 5043, 388, 20784, 264, 1695, 41650, 315, 872, 17659, 3148, 13, 1442, 279, 5043, 374, 16781, 11, 1070, 1288, 1101, 2274, 276, 16358, 9204, 315, 56249, 323, 18638, 25896, 26, 1521, 527, 539, 8579, 323, 65245, 398, 3924, 25337, 2914, 11, 33218, 11, 6699, 11, 323, 4885, 14134, 1486, 704, 430, 499, 1541, 1431, 1427, 19045, 420, 1648, 323, 506, 22780, 499, 311, 2231, 389, 4785, 13, 7648, 1274, 1781, 82374, 501, 1538, 374, 9498, 627, 38286, 3919, 3026, 11, 5423, 1884, 889, 1047, 5675, 264, 2763, 315, 4785, 2391, 459, 17563, 11, 527, 198, 1911, 3149, 555, 40531, 311, 2231, 389, 4785, 311, 12391, 430, 814, 527, 9498, 13, 358, 1047, 264, 3045, 889, 574, 34833, 264, 7926, 20537, 488, 9141, 2851, 13, 13538, 813, 17563, 568, 1047, 36069, 291, 14661, 323, 7111, 1093, 264, 305, 3200, 13, 5414, 3070, 323, 4885, 15262, 311, 1518, 1461, 430, 3195, 323, 1120, 13215, 2915, 779, 13, 5112, 568, 2751, 14243, 5986, 13, 1952, 264, 1317, 11838, 21730, 10173, 383, 5675, 264, 5199, 3392, 315, 4785, 323, 9508, 71052, 48777, 11, 14718, 682, 14965, 7020, 1461, 1664, 323, 42777, 922, 1461, 311, 26032, 1461, 449, 682, 13124, 315, 2445, 10952, 418, 1245, 61353, 27121, 505, 279, 1888, 315, 66438, 13, 2030, 420, 1162, 574, 1093, 83183, 91641, 17606, 11, 264, 893, 889, 2646, 1578, 1436, 1427, 1093, 264, 305, 3200, 13, 5414, 1054, 30562, 863, 1903, 459, 3518, 9887, 5995, 2349, 304, 2324, 1742, 323, 11341, 3117, 810, 5107, 1109, 433, 16514, 2736, 13, 3092, 3016, 574, 21830, 1990, 264, 12876, 311, 4587, 3885, 11, 323, 264, 12876, 998, 49655, 323, 14389, 813, 2890, 13, 1115, 3575, 264, 14363, 1732, 3250, 1431, 1205, 627, 2746, 499, 617, 279, 24589, 311, 2980, 2768, 459, 10778, 6593, 198, 15252, 304, 264, 7829, 430, 7701, 2819, 90301, 323, 9306, 11, 499, 527, 10942, 24404, 287, 311, 617, 311, 10726, 701, 1866, 3388, 315, 659, 1773, 47737, 1957, 3196, 389, 279, 16241, 2561, 828, 430, 499, 617, 13, 2030, 5043, 388, 527, 6118, 304, 45350, 14604, 9233, 11, 779, 358, 32113, 856, 8403, 889, 527, 38126, 311, 420, 3169, 315, 7410, 311, 2197, 50828, 4885, 323, 40531, 311, 58608, 505, 5605, 4205, 422, 814, 649, 1431, 1862, 279, 12120, 315, 1957, 499, 617, 12146, 13, 4740, 420, 11, 422, 4885, 477, 29658, 527, 2103, 2910, 391, 481, 315, 5605, 4400, 320, 17206, 2536, 12, 23129, 750, 705, 433, 374, 3062, 311, 22429, 1124, 1527, 701, 2324, 3156, 499, 617, 27332, 701, 2890, 9021, 11, 617, 86025, 9179, 68632, 323, 617, 6052, 311, 12459, 264, 13709, 10173, 11, 4856, 1109, 3794, 1940, 6258, 40608, 264, 21730, 832, 627, 791, 1633, 12047, 13189, 315, 1057, 7829, 753, 12459, 15840, 374, 430, 1274, 617, 198, 82850, 5076, 3725, 15972, 430, 994, 5986, 814, 2011, 8343, 311, 2567, 709, 872, 8333, 5450, 38638, 304, 420, 28782, 374, 459, 65890, 660, 16801, 430, 994, 279, 2547, 374, 906, 3448, 291, 555, 264, 8624, 1614, 11, 279, 23948, 649, 17354, 387, 23075, 449, 14239, 11, 323, 430, 279, 2547, 3966, 420, 3691, 311, 5622, 279, 17188, 11, 24032, 11, 477, 83631, 9188, 561, 11, 323, 5829, 279, 13128, 311, 27661, 477, 32593, 20438, 13, 57243, 11, 279, 4839, 14329, 374, 198, 1820, 1162, 13, 31974, 44304, 5510, 323, 31370, 389, 279, 21503, 12571, 3956, 315, 198, 76, 21291, 15505, 290, 11, 323, 279, 2547, 374, 12153, 311, 21552, 1664, 994, 433, 374, 7621, 477, 5986, 627, 3947, 753, 459, 2362, 5605, 922, 420, 25, 1054, 11432, 264, 9439, 11, 6917, 588, 264, 34653, 2029, 7648, 1274, 198, 27963, 420, 5605, 3445, 499, 1288, 8343, 994, 499, 617, 264, 9439, 13, 3639, 279, 5605, 54760, 3445, 374, 422, 499, 5510, 264, 9439, 1243, 499, 690, 5246, 617, 311, 6917, 588, 264, 34653, 6487, 41288, 19724, 30, 49475, 15657, 5423, 527, 539, 4170, 10185, 555, 264, 6759, 1503, 2547, 11, 323, 300, 9932, 1603, 11, 279, 12571, 3956, 315, 13128, 1280, 15505, 290, 527, 5423, 5481, 3416, 788, 13, 3011, 374, 682, 279, 2547, 3966, 994, 433, 374, 2736, 1523, 11, 2500, 2865, 315, 5481, 3416, 902, 433, 649, 1431, 22472, 4245, 311, 23948, 323, 665, 8943, 627, 8459, 4814, 374, 6118, 5938, 449, 17563, 11, 439, 433, 1288, 387, 0, 763, 3115, 315, 30883, 198, 484, 2136, 459, 6062, 9498, 2547, 33291, 1202, 38575, 369, 3691, 1606, 433, 374, 463, 68806, 85, 4023, 311, 3009, 12459, 13, 1102, 374, 1633, 2653, 311, 91966, 264, 14363, 10065, 311, 8343, 13, 11205, 13162, 11, 1962, 14400, 555, 264, 4059, 2539, 315, 6485, 9687, 14847, 323, 905, 6848, 11, 28172, 7167, 1440, 430, 54560, 374, 7138, 753, 1749, 315, 21730, 13, 35341, 661, 311, 5526, 8154, 10276, 11, 74502, 11, 40054, 13763, 11, 323, 44032, 1397, 279, 45426, 315, 25742, 481, 4907, 13, 1115, 2144, 1253, 43561, 279, 6742, 753, 3217, 1606, 93057, 706, 3719, 19781, 994, 814, 617, 6575, 264, 1317, 892, 2085, 12459, 51526, 1243, 10534, 279, 12157, 1306, 12459, 13, 2030, 459, 5986, 2547, 4250, 21552, 30820, 708, 4619, 315, 8405, 4907, 28532, 505, 15657, 11, 279, 2547, 374, 4726, 23104, 291, 1729, 3686, 2500, 2865, 315, 21503, 3769, 9124, 555, 96080, 323, 2231, 1116, 1142, 3691, 29845, 11621, 27224, 311, 11134, 304, 264, 14363, 2547, 430, 374, 2736, 74537, 304, 1202, 15941, 983, 277, 21305, 627, 54, 11073, 11, 2391, 17563, 1455, 2561, 16595, 5457, 374, 2736, 50028, 1139, 198, 383, 6260, 26, 433, 374, 539, 2561, 369, 74502, 13, 1102, 374, 3062, 311, 2187, 264, 14363, 2547, 311, 782, 4739, 449, 21730, 323, 539, 311, 54292, 279, 1920, 449, 26225, 74502, 269, 28321, 279, 13803, 320, 8370, 3604, 527, 279, 21730, 9045, 8, 449, 11217, 13, 1442, 9514, 617, 459, 30883, 17563, 11, 323, 499, 3009, 682, 3691, 23730, 3734, 369, 10748, 3090, 323, 1964, 65, 30668, 11, 323, 8530, 1063, 36581, 45993, 11, 477, 19371, 1088, 2536, 1355, 4589, 23661, 11, 499, 305, 7403, 301, 32077, 701, 2547, 315, 459, 38883, 5149, 13, 12361, 315, 21552, 287, 11, 279, 2547, 5900, 311, 198, 1816, 389, 34168, 709, 389, 21730, 13, 578, 2547, 649, 323, 690, 4661, 40605, 27661, 5196, 198, 333, 279, 14363, 1732, 690, 617, 10082, 304, 433, 11, 47903, 449, 279, 2547, 753, 9045, 555, 10923, 1820, 13803, 315, 21730, 311, 3073, 11, 8108, 477, 22472, 279, 23730, 315, 3691, 311, 2187, 1820, 2547 ]
0xBreath/holistic-books
is willing to risk promoting Dr. Revici‘s discoveries. I n December of 1989, Professor Gerhard Schrauzer‘s picture appeared on the cover of Cancer Research: the Official Journal of the American Association for Cancer Research. He was also the expert the New York Times went to for an authoritative quote regarding Professor Will Taylor‘s AIDS research. To appreciate Schrauzer‘s standing in the scientific community, I asked another eminent scientist about the former University of California at San Diego professor and researcher. Stanford Professor Arthur Furst, wa s formerly the long -time president of the American College of Toxicology and a member of the editorial board of Biological Element Trace Research. (Professor Schrauzer is the founder and editor of that publication.) When 251 interviewed, Professor Furst, who is also a recognized pioneer in cancer research, commented, ―When it comes to selenium, I defer to Dr. Schrauzer. He probably knows more about selenium than anyone else in the world.‖ Considering Schrauzer‘s place in the U.S. and international scientific community, I was initially stunned by his remarks in a telephone interview, some of which he would share only off the record. Still, on the record, he suggested, in his typically rhetorical shortha nd, why Revici has met with resistance from many of his contemporaries: ―Revici designed his own drugs decades before anyone else thought of them. Anyone who does this is, therefore, unscientific.‖ As an eminent researcher with 300 peer review articles pu blished, Schrauzer described the compartmental wall of resistance the medical community has regarding Revici‘s discoveries, ―Even though my own research is in cancer, I am not a physician. Therefore, my advocacy is meaningless.‖ Despite Schrauzer‘s trepi dations about speaking freely on Revici‘s behalf, the reader will recall that it was Schrauzer who compared Revici to Hippocrates, Galen and Paracelsus. Schrauzer expanded on that comparison by recalling that Paracelsus was forced to flee for his safety mo re than once because he made his own medicines, ―It was the pharmacists who were after him.‖ One physician who suffered as a result of conducting studies on Revici‘s method was Leonard B. Goldman, M.D., a busy radiologist. In a letter written to the New York Board of Regents in January of 1986, Dr. Goldman said he became interested in Revici‘s work in the early 1950‘s. One of his former patients had responded spectacularly to Revici‘s method of treatment. Goldman visited a hospital where he saw other Revi ci cancer patients, ―Many of whom seemed better and were off their opiates.‖ Dr. Goldman received permission from Revici to conduct his own study with Revici‘s assistance. In the letter, he reported that a patient had a tumor that had put a hole in her s kull, ―[It] disappeared, and she was able to become active again.‖ Goldman presented his findings with his own patients at an AMA meeting. ―The only result was the suspension of my residency program at Queens General Hospital,‖ Goldman informed the Regents in 1986. We have already seen that Dr. John Heller was afraid of losing his job as the medical director of Sloan -Kettering if he were to suggest using Revici‘s medicines at that elite cancer center. His concern would indicate that the resistance to Revi ci‘s method came from the top of Sloan -Kettering. The tentacles of intimidation reach into many different areas. At the OPMC hearings, one of the hearing officers was overheard by Ruth Spector to threaten Dwight McKee, M.D., who worked with Dr. Revici at the time. ―We know who you are. We‘ll get you,‖ the panelist was heard to say. Dr. McKee recently verified the incident in a telephone interview and added that the remark, ―Had a threatening overtone to it.‖ Dr. Seymour Brenner was not totally immune ei ther. He informed me during a 252 visit to his home in Florida that when he began to investigate the case histories of some of Revici‘ s patients, calls were made to the hospital where he was affiliated questioning his competence. His comments echoed his 1988 testimony before Rep. Guy Molinari: Now I must tell you briefly my name has already surfaced, and one of the hospitals that I‘ve been associated with has already been questioned by the State as to whether I‘m a qualified doctor, and how come a doctor like me is on the staff. Brenner also reported during the Molinari hearing that when he talked to his fellow doctors about his research, they warned him, ―Brenner, what are you doing? You‘re going to get into trouble.‖ All of the above stories are the result of this amateur investigator‘s solitary research with limited resources into the Revici story. The possibility exists that the se stories are but a small part of a larger story with the same theme. It is not known how many other conversations have taken place that were variations on that theme. We do know that key players are afraid to act in Revici‘s behalf for non-medical reason s. It is also clear that the political climate of persecution and closed -mindedness within the medical industry is fixed in its determination to prevent you and me from benefiting from Revici‘s real medicine. Individual medical practitioners have been una ble to overcome the forces that control the fate of Dr. Revici‘s medicines. Whether it be the state, the ACS, JAMA, the Lehigh Valley Committee Against Health Fraud, or Dr. Victor Herbert, it is evident that the opponents of Dr. Revici are well funded. Confronted by powers much greater than any lone physician is equipped to take on, it is exceedingly difficult for any one of them to march triumphantly for Revici‘s cause. Yet, they are kept silent at our peril. Despite these long odds, over the years a few physicians could always be found to stick their necks out. It hasn‘t been enough to declare victory, but it has been enough to keep the promise alive, or at least to keep it barely breathing. You have already heard about quite a few of them. The next chap ter will introduce you to a few more who have popped their heads out of the fox hole. 1The study found that BNP accelerated cancer growth in rats and created vacuoles in the cells. Vacuoles appear in catabolic imbalances. BNP is a catabolic medication and contra -indicated for catabolic conditions. Therefore, Dr. Aungst‘s negative report on BNP was an unwitting vote of support for Revici‘s concept of dualism in cancer. 253 32. ―Wow!‖ “I‟ve seen the case reports. I agree with what Dr. Brenner says.” Rudy Falk, M.D., Director of Surgical Oncology, Toronto General Hospital, March 18, 1988 On March 18, 1988, a lone Congressman held a day -long hearing in order to learn more about Dr. Revici‘s therapies. Thirteen patients and four phy sicians came forward to tell Representative Guy Molinari about the positive results Dr. Revici had achieved, either for themselves or for their patients. Author and radio commentator Gary Null, two attorneys, and others also came forward to support Dr. Revici. A dozen letters of support were submitted into the record as well. Only Harvey Wachsman dissented. Wachsman‘s remarks aside, each person‘s testimony provided dramatic evidence that Dr. Revici was helping people with his medicines. For example, Dr. R udy Falk, Director of Surgical Oncology at Toronto General Hospital and a highly regarded cancer specialist, appeared at the hearing. At the time of his testimony, Dr. Falk had already authored 155 articles published in peer -review journals. In his testimo ny he directly corroborated Dr. Seymour Brenner‘s findings concerning Revici‘s patients: ―I‘ve seen the case reports. I agree with what Dr. Brenner says.‖ Brenner told a story about Joseph Ransohoff, M.D. Among his many accomplishments, Dr. Ransohoff was invited by Roy Selby, M.D., to be interviewed on videotape for the purpose of being included in the archives of the American Association of Neurosurgeons. According to Dr. Selby, that type of invitation is reserved for very select company. As you have d iscovered in Part III, Dr. Ransohoff had performed surgery on three patients who ended up in Revici‘s office. When the first patient told Ransohoff she was going to see Revici, he was not pleased. According to Brenner‘s testimony the patient told him that Ransohoff said, ―Oh, if you‘re going to that quack, I want nothing further to do with you.‖ But to his credit, Ransohoff changed his mind, at least privately, when presented with more evidence. Brenner sent him a letter inquiring about the three patients. He told Congressman Molinari, ―So, what I did was, I
[ 374, 10032, 311, 5326, 22923, 720, 9023, 13, 10315, 3457, 43741, 54098, 13, 358, 308, 6790, 315, 220, 3753, 24, 11, 17054, 20524, 19221, 5124, 969, 5308, 261, 43741, 6945, 9922, 389, 279, 720, 3773, 315, 26211, 8483, 25, 279, 23479, 10139, 315, 279, 3778, 10229, 369, 26211, 8483, 662, 1283, 720, 16514, 1101, 279, 6335, 279, 1561, 4356, 8691, 4024, 311, 369, 459, 65693, 12929, 9002, 220, 17054, 4946, 720, 68236, 43741, 46060, 3495, 13, 5996, 1271, 15763, 5124, 969, 5308, 261, 43741, 11509, 304, 279, 12624, 4029, 11, 358, 4691, 2500, 84629, 28568, 720, 9274, 279, 4846, 3907, 315, 7188, 520, 5960, 18842, 14561, 323, 32185, 13, 31788, 17054, 720, 60762, 435, 33712, 11, 10667, 274, 34833, 279, 1317, 482, 1712, 4872, 315, 279, 3778, 9304, 315, 67502, 2508, 323, 264, 720, 9792, 315, 279, 28144, 4580, 315, 63711, 8711, 28262, 8483, 662, 320, 48120, 5124, 969, 5308, 261, 374, 279, 720, 15456, 261, 323, 6576, 315, 430, 17009, 6266, 3277, 220, 220, 13860, 720, 30147, 11, 17054, 435, 33712, 11, 889, 374, 1101, 264, 15324, 54047, 304, 9572, 3495, 11, 29786, 11, 51753, 4599, 720, 275, 4131, 311, 37045, 11, 358, 18440, 311, 2999, 13, 5124, 969, 5308, 261, 13, 1283, 4762, 8964, 810, 922, 37045, 1109, 5606, 720, 1531, 304, 279, 1917, 13, 378, 244, 5996, 83896, 5124, 969, 5308, 261, 43741, 2035, 304, 279, 549, 815, 13, 323, 6625, 12624, 4029, 11, 358, 574, 15453, 720, 267, 39090, 555, 813, 24208, 304, 264, 21186, 7274, 11, 1063, 315, 902, 568, 1053, 4430, 1193, 1022, 279, 3335, 13, 720, 24205, 11, 389, 279, 3335, 11, 568, 12090, 11, 304, 813, 11383, 87068, 559, 2419, 64, 15953, 11, 3249, 10315, 3457, 706, 2322, 449, 720, 417, 4011, 505, 1690, 315, 813, 59504, 5548, 25, 51753, 37284, 3457, 6319, 813, 1866, 11217, 11026, 1603, 5606, 720, 1531, 3463, 315, 1124, 13, 33634, 889, 1587, 420, 374, 11, 9093, 11, 653, 85930, 13, 378, 244, 2355, 2170, 459, 84629, 32185, 449, 220, 3101, 14734, 3477, 9908, 18757, 1529, 3384, 11, 5124, 969, 5308, 261, 7633, 279, 720, 5807, 3275, 278, 7147, 315, 13957, 279, 6593, 4029, 706, 9002, 10315, 3457, 43741, 54098, 11, 51753, 13461, 720, 4636, 856, 1866, 3495, 374, 304, 9572, 11, 358, 1097, 539, 264, 28378, 13, 15636, 11, 856, 35954, 374, 57026, 13, 378, 244, 5996, 20397, 5124, 969, 5308, 261, 43741, 4353, 2554, 294, 811, 922, 12365, 26662, 389, 10315, 3457, 43741, 17981, 11, 279, 6742, 690, 19635, 430, 433, 720, 16514, 5124, 969, 5308, 261, 889, 7863, 10315, 3457, 311, 75463, 78046, 11, 10845, 268, 323, 4366, 582, 2053, 355, 13, 5124, 969, 5308, 261, 17626, 389, 720, 9210, 12593, 555, 89746, 430, 4366, 582, 2053, 355, 574, 9770, 311, 28500, 369, 813, 7296, 4647, 312, 1109, 3131, 1606, 720, 383, 1903, 813, 1866, 39653, 11, 51753, 2181, 574, 279, 36449, 1705, 889, 1051, 1306, 1461, 13, 378, 244, 5996, 4054, 28378, 889, 16654, 439, 264, 1121, 315, 31474, 7978, 389, 10315, 3457, 43741, 1749, 574, 41954, 426, 13, 720, 26509, 1543, 11, 386, 920, 2637, 264, 13326, 12164, 16549, 13, 763, 264, 6661, 5439, 311, 279, 1561, 4356, 8925, 315, 78777, 304, 6186, 315, 720, 3753, 21, 11, 2999, 13, 48428, 1071, 568, 6244, 8173, 304, 10315, 3457, 43741, 990, 304, 279, 4216, 220, 6280, 15, 43741, 13, 3861, 315, 813, 4846, 720, 81437, 1047, 16846, 28809, 398, 311, 10315, 3457, 43741, 1749, 315, 6514, 13, 48428, 12263, 264, 8952, 720, 2940, 568, 5602, 1023, 1050, 10176, 12088, 9572, 6978, 11, 51753, 8607, 315, 8884, 9508, 2731, 323, 1051, 1022, 872, 36558, 988, 13, 378, 244, 5996, 9023, 13, 48428, 4036, 8041, 505, 10315, 3457, 311, 6929, 813, 1866, 4007, 449, 10315, 3457, 43741, 13291, 13, 763, 279, 720, 9638, 11, 568, 5068, 430, 264, 8893, 1047, 264, 36254, 430, 1047, 2231, 264, 14512, 304, 1077, 274, 597, 620, 11, 51753, 58, 2181, 60, 29496, 11, 323, 1364, 720, 16514, 3025, 311, 3719, 4642, 1578, 13, 378, 244, 48428, 10666, 813, 14955, 449, 813, 1866, 6978, 520, 459, 52889, 720, 62349, 13, 51753, 791, 1193, 1121, 574, 279, 25288, 315, 856, 53966, 2068, 520, 28162, 3331, 15429, 11, 378, 244, 720, 26509, 1543, 16369, 279, 78777, 220, 304, 220, 3753, 21, 13, 5996, 1687, 617, 2736, 3970, 430, 2999, 13, 3842, 93893, 574, 16984, 315, 13490, 813, 2683, 439, 279, 6593, 7690, 315, 720, 50, 39429, 482, 42, 22120, 287, 422, 568, 1051, 311, 4284, 1701, 10315, 3457, 43741, 39653, 520, 430, 21342, 9572, 4219, 13, 5414, 4747, 720, 41450, 13519, 430, 279, 13957, 311, 1050, 10176, 12088, 43741, 1749, 3782, 505, 279, 1948, 315, 94193, 482, 42, 22120, 287, 13, 5996, 791, 16006, 18709, 315, 70159, 5662, 1139, 1690, 2204, 5789, 13, 2468, 279, 507, 93623, 45348, 11, 832, 315, 279, 720, 383, 3329, 9808, 574, 927, 55603, 555, 42893, 328, 19534, 311, 40250, 72845, 26718, 2176, 11, 386, 920, 2637, 889, 6575, 449, 2999, 13, 720, 37284, 3457, 520, 220, 279, 892, 13, 51753, 1687, 1440, 889, 499, 527, 13, 1226, 14336, 657, 636, 499, 11, 378, 244, 279, 7090, 380, 574, 6755, 311, 2019, 13, 2999, 13, 26718, 2176, 720, 47743, 398, 24884, 279, 10672, 304, 264, 21186, 7274, 323, 3779, 430, 279, 14162, 11, 51753, 56568, 264, 27903, 720, 78, 1653, 606, 311, 433, 13, 378, 244, 5996, 9023, 13, 94611, 44808, 1215, 574, 539, 12756, 22852, 30529, 9139, 13, 1283, 16369, 757, 2391, 264, 220, 220, 12326, 720, 4034, 311, 813, 2162, 304, 9784, 430, 994, 568, 6137, 311, 19874, 279, 1162, 53210, 315, 1063, 315, 10315, 3457, 14336, 274, 720, 81437, 11, 6880, 1051, 1903, 311, 279, 8952, 1405, 568, 574, 37506, 34685, 813, 58266, 13, 5414, 720, 15069, 55212, 813, 220, 3753, 23, 24365, 1603, 3402, 13, 26340, 33518, 258, 2850, 25, 5996, 7184, 358, 2011, 3371, 499, 27851, 856, 836, 706, 2736, 58646, 11, 323, 2355, 606, 315, 279, 24461, 430, 358, 14336, 588, 220, 1027, 5938, 449, 706, 2736, 2355, 82850, 29440, 555, 279, 3314, 439, 311, 3508, 358, 14336, 76, 264, 15337, 10896, 11, 2355, 438, 1268, 2586, 264, 10896, 1093, 757, 374, 389, 279, 5687, 13, 2355, 33, 1466, 1215, 1101, 5068, 2391, 279, 33518, 258, 2850, 11011, 430, 994, 568, 15243, 311, 813, 12637, 16410, 922, 813, 720, 61564, 11, 814, 19201, 1461, 11, 51753, 33, 1466, 1215, 11, 1148, 527, 499, 3815, 30, 1472, 14336, 265, 2133, 311, 636, 1139, 12544, 13, 378, 244, 2355, 2460, 315, 279, 3485, 7493, 527, 279, 1121, 315, 420, 19077, 49581, 43741, 58229, 3495, 449, 7347, 720, 13035, 1139, 279, 10315, 3457, 3446, 13, 578, 13336, 6866, 430, 279, 513, 7493, 527, 719, 264, 2678, 961, 315, 264, 8294, 720, 27583, 449, 279, 1890, 7057, 13, 1102, 374, 539, 3967, 1268, 1690, 1023, 21633, 617, 4529, 2035, 430, 1051, 720, 959, 17583, 389, 430, 7057, 13, 1226, 656, 1440, 430, 1401, 4311, 527, 16984, 311, 1180, 304, 10315, 3457, 43741, 17981, 369, 720, 6414, 45872, 950, 2944, 274, 13, 1102, 374, 1101, 2867, 430, 279, 5054, 10182, 315, 56529, 323, 8036, 482, 76, 17003, 2136, 720, 56950, 279, 6593, 5064, 374, 8521, 304, 1202, 26314, 311, 5471, 499, 323, 757, 505, 84015, 505, 720, 37284, 3457, 43741, 1972, 16088, 13, 2355, 44259, 6593, 43195, 617, 1027, 5203, 12704, 311, 23075, 279, 8603, 430, 2585, 279, 25382, 315, 2999, 13, 720, 37284, 3457, 43741, 39653, 13, 13440, 433, 387, 279, 1614, 11, 279, 79184, 11, 622, 39200, 11, 279, 2009, 12156, 13345, 10554, 30241, 720, 14884, 67047, 11, 477, 2999, 13, 33412, 58463, 11, 433, 374, 30576, 430, 279, 19949, 315, 2999, 13, 10315, 3457, 527, 1664, 24853, 13, 720, 1128, 7096, 291, 555, 13736, 1790, 7191, 1109, 904, 47766, 28378, 374, 19167, 311, 1935, 389, 11, 433, 374, 76821, 720, 13798, 3951, 369, 904, 832, 315, 1124, 311, 15572, 38586, 18007, 369, 10315, 3457, 43741, 5353, 13, 14968, 11, 814, 527, 8774, 21737, 520, 1057, 720, 716, 321, 13, 5996, 20397, 1521, 1317, 21448, 11, 927, 279, 1667, 264, 2478, 220, 35944, 1436, 2744, 387, 1766, 311, 9396, 872, 13272, 82, 720, 412, 13, 1102, 12775, 14336, 83, 1027, 3403, 311, 16292, 12845, 11, 719, 433, 706, 1027, 3403, 311, 2567, 279, 11471, 13989, 11, 477, 520, 720, 56371, 311, 2567, 433, 20025, 27027, 13, 1472, 617, 2736, 6755, 922, 5115, 264, 2478, 315, 1124, 13, 578, 1828, 38838, 2024, 720, 14724, 19678, 499, 311, 264, 2478, 810, 889, 617, 43333, 872, 14971, 704, 315, 279, 39935, 14512, 13, 2355, 16, 791, 4007, 1766, 430, 426, 27321, 49858, 9572, 6650, 304, 32510, 323, 3549, 9467, 84, 7298, 304, 279, 7917, 13, 720, 82889, 84, 7298, 5101, 304, 272, 2143, 7918, 737, 76527, 13, 426, 27321, 374, 264, 272, 2143, 7918, 24099, 323, 220, 32150, 482, 485, 10297, 369, 720, 66, 2143, 7918, 4787, 13, 15636, 11, 2999, 13, 362, 2234, 267, 43741, 8389, 1934, 389, 426, 27321, 574, 459, 95119, 7055, 315, 1862, 720, 2000, 10315, 3457, 43741, 7434, 315, 19091, 2191, 304, 9572, 13, 220, 220, 14022, 720, 220, 843, 13, 51753, 36981, 0, 378, 244, 2355, 10378, 378, 253, 588, 3970, 279, 1162, 6821, 13, 358, 7655, 449, 1148, 220, 2999, 13, 44808, 1215, 2795, 2029, 2355, 49, 18339, 72564, 11, 386, 920, 2637, 10783, 315, 71212, 77854, 2508, 11, 14974, 3331, 15429, 11, 720, 28623, 220, 972, 11, 220, 3753, 23, 2355, 1966, 5587, 220, 972, 11, 220, 3753, 23, 11, 264, 47766, 71483, 5762, 264, 1938, 482, 4930, 11011, 304, 2015, 311, 4048, 810, 922, 2999, 13, 720, 37284, 3457, 43741, 52312, 13, 666, 46004, 6978, 323, 3116, 37555, 274, 9818, 3782, 4741, 311, 3371, 38366, 26340, 720, 44, 37737, 2850, 922, 279, 6928, 3135, 2999, 13, 10315, 3457, 1047, 17427, 11, 3060, 369, 5694, 477, 369, 872, 6978, 13, 720, 7279, 323, 9063, 69836, 24765, 18576, 11, 1403, 31434, 11, 323, 3885, 1101, 3782, 4741, 311, 1862, 2999, 13, 720, 37284, 3457, 13, 362, 21030, 12197, 315, 1862, 1051, 14976, 1139, 279, 3335, 439, 1664, 13, 8442, 34422, 468, 87973, 1543, 720, 67, 1056, 16243, 13, 468, 87973, 1543, 43741, 24208, 16038, 11, 1855, 1732, 43741, 24365, 3984, 22520, 6029, 430, 2999, 13, 720, 37284, 3457, 574, 10695, 1274, 449, 813, 39653, 13, 5996, 2520, 3187, 11, 2999, 13, 432, 577, 10470, 72564, 11, 10783, 315, 71212, 77854, 2508, 520, 14974, 3331, 15429, 323, 264, 7701, 720, 1610, 21632, 9572, 24687, 11, 9922, 520, 279, 11011, 13, 2468, 279, 892, 315, 813, 24365, 11, 2999, 13, 72564, 1047, 720, 46584, 67213, 220, 9992, 9908, 4756, 304, 14734, 482, 19981, 42780, 13, 763, 813, 1296, 11620, 19541, 568, 6089, 720, 6133, 299, 9552, 660, 2999, 13, 94611, 44808, 1215, 43741, 14955, 18815, 10315, 3457, 43741, 6978, 25, 51753, 40, 14336, 588, 3970, 279, 1162, 720, 38006, 13, 358, 7655, 449, 1148, 2999, 13, 44808, 1215, 2795, 13, 378, 244, 5996, 33, 1466, 1215, 3309, 264, 3446, 922, 15466, 432, 598, 2319, 1885, 11, 386, 920, 13, 22395, 813, 1690, 53881, 11, 2999, 13, 432, 598, 2319, 1885, 720, 16514, 18719, 555, 11284, 24082, 1729, 11, 386, 920, 2637, 311, 387, 30147, 389, 72374, 2070, 369, 279, 7580, 315, 1694, 5343, 304, 720, 1820, 39104, 315, 279, 3778, 10229, 315, 32359, 20370, 713, 2439, 13, 10771, 311, 2999, 13, 24082, 1729, 11, 430, 955, 315, 720, 98630, 374, 4694, 369, 1633, 3373, 2883, 13, 5996, 2170, 499, 617, 294, 374, 21468, 304, 3744, 14767, 11, 2999, 13, 432, 598, 2319, 1885, 1047, 10887, 15173, 389, 2380, 6978, 889, 9670, 720, 455, 304, 10315, 3457, 43741, 5274, 13, 3277, 279, 1176, 8893, 3309, 432, 598, 2319, 1885, 1364, 574, 2133, 311, 1518, 10315, 3457, 11, 568, 574, 539, 720, 698, 1503, 13, 10771, 311, 44808, 1215, 43741, 24365, 279, 8893, 3309, 1461, 430, 432, 598, 2319, 1885, 1071, 11, 51753, 12174, 11, 422, 499, 14336, 265, 720, 9738, 311, 430, 934, 474, 11, 358, 1390, 4400, 4726, 311, 656, 449, 499, 13, 378, 244, 5996, 4071, 311, 813, 6807, 11, 432, 598, 2319, 1885, 5614, 813, 4059, 11, 520, 3325, 38171, 11, 994, 10666, 449, 810, 6029, 13, 720, 33, 1466, 1215, 3288, 1461, 264, 6661, 304, 71194, 922, 279, 2380, 6978, 662, 1283, 3309, 71483, 33518, 258, 2850, 11, 51753, 4516, 11, 1148, 358, 720, 23770, 574, 11, 358 ]
0xBreath/holistic-books
less realm of potential forms, the source and origin of the universe. Life as LOVE, compassion, JOY, equanimity, imagination, and CREATIVITY cannot be quantied by science.Just as we have a body, mind, and spirit, the universe has a physical, mental, and consciousness component. People don’t grow old; when they stop growing, they become old. Our sense of self determines our experience of the world. AWAKENING IS NOT WHO YOU ARE, BUT DISCARDING WHO YOU ARE NOT.Love is the EXPERIENCE and knowledge of one being in many appearances.Atoms die in waves of potentiality. Waves are born in atoms of actuality. The cosmos reincarnates eternally. Your physical form was conceived in a wave of desire. Desire is pure potentiality, seeking manifestation. Just as a wave is a movement of the whole ocean, you are the energy of the cosmos. Don’t underestimate your power. Your inner potential and cosmic potential are the same field. The field is you and the universe, just as wave and ocean are one.When you are balanced in body, mind, and spirit, you feel joyful, energetic, restful, alert, and experience lightness of being. Our body is poetry in form and motion. There is only one temple for the spirit, and it is our body. Keep it holy. We are the UNIVERSE dancing.Both mathematics and music are the language of the universe, expressing truth, harmony, and beauty. Science is a spiritual quest to know ourselves. What we do to the world, we do to ourselves. Science based on the objective world as separate from us is dangerous.Synchronicity, meaningful coincidence, good luck, creative response from the universe, and grace are synonymous terms.Humility, awe, wonderment, and delight are qualities of spirit, not just electrochemical events in synaptic networks. Nothing ever ceases to exist. Death is incubation in the field of potentiality until the next leap of creativity. Self-awareness is the window to cosmic consciousness. e simplest denition of spirituality is self-awareness.Every moment is a fork in the road. e road you take will shape your future. Choose love over fear. OceanofPDF.comLogic and rationality are the language of the scientific mind. Love and wisdom are the poetry of the spiritual soul. If your reality is only rational, and has no room for feelings and the irrational, then your humanity is incomplete. Love is a quality of AWARENESS that allows SOULS to commune with each other.Karma or choices in the past create the situations of the present. How we choose now is a function of free will. To witness yourself making choices is the beginning of karmic freedom. Between the banks of pleasure and pain, the river of life flows. The key is to let go and flow.If you sacrifice your health to make money today, you will have to sacrifice your money to get health tomorrow. If you sacrifice the present for the future, you will never enjoy life, for when the future arrives, you won’t be present.Being awake means that the best time of your life is neither behind you nor ahead of you, but now. Consciousness is the organizing principle that transforms chaos into cosmos. To BECOME the consciousness of that which you witness is LOVE.God is the inconceivable truth in which we and the universe are happening.I AM is all bodies and all minds in one consciousness, one spirit. The essence of our being is eternal possibility. The law of least effort: “Do less and achieve more.” Then graduate to “Do nothing and achieve everything.” The law of least effort works through choiceless awareness, plus subtle intention, leading to synchronicity. A religious experience encompasses transcendence, love, compassion, humility, reverence for life, and loss of the fear of death.Your ANCESTORS are alive in every cell of your body as your genetic activity.In every seed, there is the promise of thousands of forests. So, too, in desire is the seed of thousands of manifestations. As you witness yourself making choices, you begin the process of awakening. The ground of existence is not inert emptiness, but a dynamic field connecting all creation in a single totality. Random mutations in evolution are reminiscent of quantum uncertainty. Beyond chaos is a creative organizing principle.Sensations and feelings in the body are the KEYS to intuition.ILLNESS BEGINS WITH “I.” WELLNESS BEGINS WITH “WE.”The fruit takes time to ripen and then falls suddenly. Enlightenment works in a similar way. There is always preparation and awakening. We are the eyes of the universe, looking at itself. All this struggling to learn when we simply have to remember. No matter what the situation, there is a choice. You will never trust your intuition until you identify with it. Self-esteem enters here.Every event has innumerable causes and leads to innumerable effects. Events and objects are snapshots of the universe in motion.e only MADNESS that is sane is the intoxication of love.Stop playing small. You are divinity in motion. To own the world, see infinite potential in all situations at all times.All boundaries are conceptual. The universe boundless outward in the cosmos, boundless inward in the atom. Think cosmically, communicate globally, actlocally, but with global and cosmic impact. To be ALIVE is to be AWARE and PRESENT. en every moment, every BREATH, is BENEDICTION, GRACE, and a MIRACLE.At the moment of conception, you had neither body nor brain, but awareness was present.In the hall of mirrors, I can see for miles. Every demon, every enemy, every torturer is me in disguise. Through the mirror of relationship, I see myself.We are the human activity of the universe, and most of it is unknowable. We cannot step outside the universe to see it. Everything in the visible world has its roots in the formless invisible.Love can be our RELIGION beyond boundaries if we live it, BREATHE it, experience it, BECOME it.Self-awareness and compassion ease our own suffering. OceanofPDF.comWhen your awareness is free, you know the entire universe as your body.Consciousness alone is. It conceives, constructs, governs, and becomes the universe. The limits of our identity are the limits of our awareness. The more universal or cosmic your sense of self, the bigger your world will be. At all times, your world is a projection of yourself. Expansion of self to universal awareness is enlightenment.AWARENESS is a eld in which minds, bodies, and universes arise and SUBSIDE like waves in an ocean.Spirituality is not a contrived MOOD or behavior, but a simple, unaffected humanity.What we are looking for is the one who is looking. Only the witness of the mind can know the mind. Peace can only be created by those who are peaceful, and love by those who have loved. At all times, what we are aware of is the qualities of our own consciousness. The world is as we are. e only sane RESPONSE to our collective insanity is unconditional LOVE.God is the infinite potential in which galaxies and universes arise from nothingness and disappear into nothingness. Only God exists. Everything else is flux—the coming and going of God.LOVE is the ultimate TRUTH.Lightness of being, FLOW, and joy are the outcome of letting go of what never was.You are the master of your life, not the mechanisms in your brain or your body. Intention and desire alter the material landscape of the brain. Neurons and genes turn on and off, depending on your choices. Reclaiming consciousness is nothing other than reclaiming the power of choice.Angry people SHOUT, those in love WHISPER, those who are love become SILENT.EACH OF US IS THE ONE MINDReligion has an obligation not to contradict the known laws of science. Science has an obligation not to reduce rich human experience to raw data. Be a child, let go, allow the rhythms of nature to cradle you, and the universe will carry you wherever your dreams are cosmic consciousness.If you obsess over whether you are making the right decision, you are basically assuming that the universe will reward you for one thing and punish you for another.Atoms emerge from a void that is pure
[ 1752, 198, 70997, 315, 4754, 7739, 11, 279, 2592, 198, 438, 6371, 315, 279, 15861, 627, 26833, 439, 40835, 345, 31929, 290, 11, 10458, 56, 345, 26378, 16348, 488, 11, 28899, 345, 438, 356, 31832, 30211, 4250, 198, 1395, 10484, 72, 188, 291, 555, 8198, 3587, 592, 439, 584, 617, 264, 2547, 11, 4059, 11, 323, 198, 86390, 11, 279, 15861, 706, 264, 7106, 345, 93221, 11, 323, 25917, 198, 8739, 627, 16298, 1541, 1431, 3139, 2362, 26, 994, 814, 3009, 198, 70, 25156, 11, 814, 3719, 2362, 627, 8140, 5647, 315, 659, 27667, 1057, 198, 50659, 315, 279, 1917, 627, 14757, 12173, 965, 1753, 3507, 4276, 40312, 198, 57489, 16202, 11, 11155, 12244, 60319, 1753, 198, 78847, 15334, 16202, 4276, 1236, 1009, 374, 279, 81181, 57782, 323, 198, 90153, 315, 832, 1694, 304, 1690, 198, 41866, 3095, 15913, 7085, 2815, 304, 17301, 315, 4754, 488, 627, 54, 4798, 527, 9405, 304, 33299, 315, 198, 533, 10965, 13, 578, 83645, 95807, 1923, 988, 198, 295, 944, 750, 627, 7927, 7106, 1376, 574, 50178, 304, 198, 64, 12330, 315, 12876, 627, 5001, 556, 374, 10748, 4754, 488, 11, 11125, 198, 43415, 367, 627, 10156, 439, 264, 12330, 374, 264, 7351, 315, 279, 198, 67733, 18435, 11, 499, 527, 279, 4907, 315, 198, 1820, 83645, 627, 8161, 1431, 79583, 701, 2410, 627, 7927, 9358, 4754, 323, 55801, 198, 93036, 527, 279, 1890, 33595, 71831, 789, 627, 791, 33595, 71831, 789, 374, 499, 323, 279, 15861, 345, 4345, 439, 12330, 323, 18435, 527, 832, 51861, 499, 527, 24770, 304, 198, 2664, 11, 4059, 11, 323, 9090, 11, 499, 198, 57676, 83212, 11, 45955, 345, 4014, 1285, 11, 5225, 11, 323, 198, 50659, 3177, 2136, 315, 198, 35214, 627, 8140, 2547, 374, 32349, 304, 1376, 323, 11633, 13, 2684, 374, 198, 3323, 832, 27850, 369, 279, 9090, 11, 323, 433, 374, 1057, 2547, 627, 19999, 433, 27823, 627, 1687, 527, 279, 6781, 19323, 937, 198, 67, 9151, 13, 21279, 38696, 323, 4731, 527, 198, 1820, 4221, 315, 279, 15861, 345, 14107, 287, 8206, 11, 26348, 11, 323, 198, 1395, 59051, 627, 36500, 374, 264, 18330, 2271, 311, 1440, 198, 2530, 4372, 627, 3923, 584, 656, 311, 279, 198, 14957, 11, 584, 656, 311, 198, 2530, 4372, 13, 10170, 198, 31039, 389, 279, 16945, 198, 14957, 439, 8821, 505, 198, 355, 374, 11660, 815, 14445, 62791, 345, 57865, 1285, 198, 1030, 2910, 7232, 11, 1695, 15369, 345, 52817, 2077, 505, 198, 1820, 15861, 11, 323, 21507, 198, 548, 69593, 3878, 3924, 372, 1429, 11, 51517, 11, 5895, 479, 11, 323, 198, 9783, 492, 527, 29600, 315, 9090, 11, 539, 1120, 198, 19493, 299, 32056, 4455, 304, 99827, 198, 17969, 82, 627, 24714, 3596, 3846, 2315, 311, 3073, 13, 16290, 374, 198, 2910, 392, 367, 304, 279, 33595, 71831, 789, 315, 4754, 488, 198, 39830, 279, 1828, 32571, 315, 28697, 627, 12363, 66104, 2136, 374, 279, 3321, 311, 198, 9594, 21914, 25917, 627, 188, 68, 45648, 409, 188, 77, 684, 315, 198, 86390, 10965, 374, 659, 66104, 2136, 5253, 1225, 4545, 374, 264, 198, 45838, 304, 279, 5754, 13, 220, 188, 68, 198, 8714, 499, 1935, 690, 198, 12510, 701, 3938, 627, 25017, 3021, 927, 198, 69, 686, 627, 97283, 1073, 24317, 662, 884, 27849, 323, 25442, 488, 527, 279, 4221, 315, 279, 198, 56447, 72, 171, 71831, 66, 4059, 13, 10919, 323, 24278, 527, 279, 32349, 315, 198, 1820, 18330, 13836, 627, 2746, 701, 8903, 374, 1193, 25442, 11, 323, 706, 912, 3130, 369, 198, 57676, 826, 323, 279, 61754, 11, 1243, 701, 22706, 374, 198, 258, 15079, 627, 29351, 374, 264, 4367, 315, 198, 32, 7818, 7415, 430, 6276, 198, 14202, 1112, 50, 311, 79245, 449, 198, 9739, 1023, 11606, 20306, 477, 11709, 304, 279, 3347, 1893, 279, 15082, 198, 1073, 279, 3118, 13, 2650, 584, 5268, 1457, 374, 264, 734, 198, 1073, 1949, 690, 13, 2057, 11550, 6261, 3339, 11709, 374, 198, 1820, 7314, 315, 597, 2227, 292, 11542, 627, 26556, 279, 14286, 315, 17069, 323, 6784, 11, 279, 15140, 198, 1073, 2324, 33595, 120912, 4336, 13, 578, 1401, 374, 311, 1095, 733, 323, 33595, 120912, 363, 34001, 499, 11347, 462, 171, 71831, 346, 701, 2890, 311, 1304, 3300, 3432, 345, 9514, 690, 617, 311, 11347, 462, 171, 71831, 346, 701, 3300, 311, 636, 2890, 198, 38501, 7924, 627, 2746, 499, 11347, 462, 171, 71831, 346, 279, 3118, 369, 279, 3938, 11, 499, 690, 198, 37593, 4774, 2324, 11, 369, 994, 279, 3938, 30782, 11, 499, 198, 55767, 1431, 387, 3118, 1823, 32875, 35447, 3445, 430, 279, 1888, 892, 198, 1073, 701, 2324, 374, 14188, 4920, 499, 6463, 198, 43887, 315, 499, 11, 719, 1457, 627, 1128, 23995, 2136, 374, 279, 35821, 198, 652, 16379, 430, 29575, 28013, 1139, 198, 9594, 8801, 627, 1271, 7354, 48485, 279, 198, 64589, 2136, 315, 430, 198, 8370, 499, 11550, 374, 198, 1623, 4592, 1246, 347, 374, 279, 28093, 346, 43672, 198, 59677, 304, 902, 584, 323, 198, 1820, 15861, 527, 198, 71, 680, 6147, 2506, 6912, 374, 682, 13162, 323, 682, 20663, 304, 198, 606, 25917, 11, 832, 9090, 627, 791, 28591, 315, 1057, 1694, 374, 35825, 198, 9007, 3225, 627, 791, 2383, 315, 3325, 5149, 25, 1054, 5519, 2753, 323, 198, 613, 19704, 810, 49216, 12487, 19560, 311, 1054, 5519, 4400, 323, 198, 613, 19704, 4395, 49216, 791, 2383, 315, 3325, 5149, 4375, 198, 20322, 5873, 1752, 17985, 11, 5636, 198, 2008, 11489, 14944, 11, 6522, 311, 198, 82, 14445, 62791, 627, 32, 10597, 3217, 198, 268, 31929, 288, 198, 1485, 66, 408, 768, 11, 3021, 345, 31929, 290, 11, 75372, 345, 265, 424, 768, 369, 2324, 11, 323, 198, 9563, 315, 279, 8850, 315, 198, 63007, 7659, 414, 2147, 2152, 790, 10022, 527, 198, 52061, 304, 1475, 2849, 315, 701, 198, 2664, 439, 701, 19465, 198, 7323, 5450, 1475, 10533, 11, 1070, 374, 279, 11471, 315, 9214, 315, 198, 1348, 37379, 13, 2100, 11, 2288, 11, 304, 12876, 374, 279, 10533, 315, 9214, 198, 1073, 78167, 627, 2170, 499, 11550, 6261, 3339, 11709, 11, 499, 3240, 198, 1820, 1920, 315, 75149, 627, 791, 5015, 315, 14209, 374, 539, 81073, 198, 21643, 1918, 11, 719, 264, 8915, 33595, 71831, 789, 198, 91911, 682, 9886, 304, 264, 3254, 198, 5143, 488, 627, 14326, 34684, 304, 15740, 527, 198, 265, 1083, 285, 1189, 315, 31228, 27924, 627, 56441, 28013, 374, 264, 11782, 198, 8629, 4954, 17966, 815, 729, 811, 323, 16024, 198, 258, 279, 2547, 527, 279, 198, 4889, 50, 311, 57351, 13, 9410, 7415, 7354, 38, 9751, 4874, 1054, 40, 49216, 54, 19659, 7415, 7354, 38, 9751, 4874, 198, 2118, 12739, 2029, 791, 14098, 5097, 892, 311, 24169, 268, 323, 1243, 17503, 198, 82, 44806, 13, 92931, 4375, 304, 264, 4528, 1648, 627, 3947, 374, 2744, 18459, 323, 75149, 627, 1687, 527, 279, 6548, 315, 279, 15861, 345, 20986, 520, 5196, 627, 2460, 420, 20558, 311, 4048, 994, 584, 198, 15124, 2603, 617, 311, 6227, 627, 2822, 5030, 1148, 279, 6671, 11, 1070, 198, 285, 264, 5873, 627, 2675, 690, 2646, 7095, 701, 57351, 198, 39830, 499, 10765, 449, 433, 627, 12363, 65906, 29933, 1618, 5253, 1225, 1567, 706, 198, 258, 2470, 28057, 11384, 323, 198, 99470, 311, 304, 2470, 28057, 198, 68, 171, 105, 222, 115192, 13, 18093, 323, 6302, 198, 548, 62923, 315, 279, 198, 359, 8194, 304, 11633, 13, 188, 68, 1193, 76473, 7415, 198, 9210, 374, 62200, 374, 279, 198, 396, 5241, 20901, 315, 3021, 31313, 5737, 2678, 627, 2675, 527, 3512, 13797, 304, 11633, 627, 1271, 1866, 279, 1917, 11, 1518, 304, 171, 71831, 62664, 198, 93036, 304, 682, 15082, 520, 682, 3115, 17182, 23546, 527, 198, 69587, 940, 13, 578, 15861, 198, 11130, 1752, 52046, 304, 279, 198, 9594, 8801, 11, 6965, 1752, 63018, 304, 198, 1820, 19670, 627, 39787, 56754, 2740, 345, 26660, 349, 31550, 11, 1180, 1092, 750, 11, 719, 449, 3728, 323, 198, 9594, 21914, 5536, 627, 1271, 387, 8927, 6674, 374, 311, 387, 198, 32, 7818, 323, 198, 75899, 13, 220, 188, 268, 1475, 198, 29699, 11, 1475, 198, 33, 793, 4932, 11, 374, 198, 33, 965, 23988, 3664, 345, 8796, 5693, 11, 323, 264, 198, 44, 2871, 75801, 15913, 279, 4545, 315, 198, 444, 1010, 11, 499, 1047, 14188, 198, 2664, 6463, 8271, 11, 719, 198, 20111, 2136, 574, 3118, 5450, 279, 14321, 315, 41585, 11, 358, 649, 1518, 369, 198, 76, 3742, 13, 7357, 7097, 11, 1475, 9354, 345, 30115, 16831, 7889, 374, 757, 304, 65081, 627, 24798, 279, 18327, 315, 5133, 11, 358, 198, 4151, 7182, 23210, 527, 279, 3823, 5820, 315, 279, 198, 359, 8194, 11, 323, 1455, 315, 433, 374, 198, 3200, 3409, 481, 13, 1226, 4250, 3094, 198, 68090, 279, 15861, 311, 1518, 433, 627, 36064, 304, 279, 9621, 1917, 706, 198, 1220, 20282, 304, 279, 1376, 1752, 30547, 1236, 1009, 649, 387, 1057, 198, 50151, 1953, 1294, 7953, 198, 11130, 5548, 422, 584, 3974, 433, 345, 33, 31832, 1837, 433, 11, 3217, 198, 275, 11, 7354, 48485, 433, 815, 491, 66104, 2136, 323, 198, 31929, 290, 14553, 1057, 198, 785, 924, 171, 105, 222, 4776, 627, 97283, 1073, 24317, 662, 884, 4599, 701, 17985, 198, 285, 1949, 11, 499, 1440, 279, 198, 306, 556, 15861, 439, 701, 198, 2664, 95694, 66, 1245, 2136, 7636, 374, 627, 2181, 20245, 1924, 11, 57327, 11, 2633, 82, 11, 323, 9221, 279, 198, 359, 8194, 627, 791, 13693, 315, 1057, 9764, 527, 279, 13693, 315, 1057, 198, 20111, 2136, 627, 791, 810, 20789, 477, 55801, 701, 198, 98935, 315, 659, 11, 279, 11493, 701, 1917, 198, 14724, 387, 627, 1688, 682, 3115, 11, 701, 1917, 374, 264, 198, 61571, 315, 6261, 13, 55654, 315, 198, 726, 311, 20789, 17985, 374, 198, 268, 4238, 53061, 885, 7818, 7415, 374, 264, 220, 188, 789, 304, 198, 8370, 20663, 11, 13162, 11, 323, 198, 359, 1986, 288, 31889, 323, 198, 30138, 74773, 1093, 17301, 304, 459, 198, 78, 11455, 815, 53829, 10965, 374, 539, 264, 198, 8386, 2270, 11672, 2114, 477, 198, 56966, 11, 719, 264, 4382, 345, 8733, 171, 105, 222, 1599, 22706, 76241, 584, 527, 3411, 369, 374, 279, 832, 198, 14965, 374, 3411, 627, 7456, 279, 11550, 315, 279, 4059, 649, 1440, 198, 1820, 4059, 627, 85743, 649, 1193, 387, 3549, 555, 1884, 198, 14965, 527, 26733, 11, 323, 3021, 555, 1884, 198, 14965, 617, 10456, 627, 1688, 682, 3115, 11, 1148, 584, 527, 8010, 315, 198, 285, 279, 29600, 315, 1057, 1866, 198, 64589, 2136, 627, 791, 1917, 374, 439, 584, 527, 627, 188, 68, 1193, 62200, 77273, 198, 998, 1057, 22498, 73153, 374, 198, 359, 46468, 40835, 1246, 347, 374, 279, 304, 171, 71831, 62664, 4754, 304, 902, 198, 16876, 58088, 323, 11159, 288, 31889, 505, 198, 42312, 2136, 323, 32153, 1139, 198, 42312, 2136, 627, 7456, 4359, 6866, 13, 20696, 775, 374, 198, 171, 120912, 2249, 22416, 5108, 323, 2133, 315, 4359, 1236, 37855, 198, 285, 279, 17139, 5091, 9331, 51891, 2136, 315, 1694, 345, 47160, 11, 323, 16267, 527, 279, 198, 87294, 315, 20806, 733, 315, 198, 12840, 2646, 574, 39537, 527, 279, 7491, 315, 701, 2324, 11, 539, 279, 198, 2727, 5776, 13978, 304, 701, 8271, 477, 701, 198, 2664, 627, 1090, 3012, 323, 12876, 11857, 279, 3769, 198, 89491, 315, 279, 8271, 627, 8989, 54769, 323, 21389, 2543, 389, 323, 1022, 345, 81580, 389, 701, 11709, 627, 697, 8017, 287, 25917, 374, 4400, 198, 1605, 1109, 58583, 287, 279, 2410, 315, 198, 12008, 885, 983, 894, 1274, 6570, 3740, 345, 54719, 304, 3021, 8662, 1669, 9851, 345, 54719, 889, 527, 3021, 3719, 198, 50, 3015, 6542, 5253, 12137, 3083, 2326, 3507, 3247, 25002, 198, 44, 5358, 6882, 32718, 706, 459, 29672, 539, 311, 198, 8386, 329, 858, 279, 3967, 7016, 315, 198, 40657, 627, 36500, 706, 459, 29672, 539, 311, 198, 27369, 9257, 3823, 3217, 311, 198, 1059, 828, 627, 3513, 264, 1716, 11, 1095, 733, 11, 2187, 198, 1820, 81821, 315, 7138, 198, 998, 1589, 72455, 499, 11, 323, 279, 198, 359, 8194, 690, 6920, 198, 9514, 28578, 701, 198, 57291, 82, 527, 55801, 198, 64589, 2136, 34001, 499, 56359, 927, 198, 49864, 499, 527, 198, 28936, 279, 1314, 198, 65038, 11, 499, 527, 198, 18275, 2740, 26619, 430, 198, 1820, 15861, 690, 198, 50107, 499, 369, 832, 198, 1626, 323, 32151, 499, 198, 2000, 2500, 15913, 7085, 34044, 505, 264, 742, 430, 374, 10748 ]
0xBreath/holistic-books
), overlies the mass. At the sharp interface berween the "A" and ''B" zones, a 2 em long arcade (arrows) is seen. Close inspecrion suggests it is formed by a number of tiny arches, each 1-2 mm broad. Fig. Ill: 3. Squamous cell carcinoma,lef t upper lobe. (a) left anterjor oblique radiograph ·shows radiating struc* rures, including lamellae (arrows). "A.. and "B" zones arc corresponding ly labelled. (b) Left posterior oblique radi(}-Fig. I J I: 2. Poorly differenriated squamous cell carcinoma of the left lung, frontal radiograph. The tumour is surrounded by a radiolucent "A" zone, which isdiffu.sc, irregular, and 0.5-1 em broad. Jts outer margin is indistinct. grnph shows a 12 mm broad, rndiolucent "A" zone (A). Along: its superolateral ponion a radiopaque ''B" zone {B) has a well-defined margin against the"A" zone (arrowheads ). Elsew·hcre the margin of the "A" zone is ;poorly defined. Malignant and benign neoplasms 15 Fig.lll:4. Small ceU carcinoma, upper lobe, left lung, frontal radiograph. The "A" zone is about 5 mm wide. A "8" zone is seen as an irregular infiltration lateral to the tu~ mour. The border between the radiolucent ·• A" zone and the radiopaque ''8" zone is poorly defined. it reaches the level of the surrounding lung parenchy­ ma. A sharp outer border of the "A" zone, on the other hand, is observed characteristically only against a 148" zone situated between the tumour and the periphery of the lung (Figs. I: 2, III: I, 3, 9). Computerized tomo· graphy will occasionally be more sensitive than plain radiograph s in detecting these changes (Figs. III: 8, 34). No characteristic malignant cell type is associated with corona changes. An "A" zone can be seetr around different histological types of maligtzalll tumour> itz the Lung. For some time the author thought that an "A, zone was a radiographic sign of cancer. It is not so. An "A" zone can be found around some benign tumours as well as around primary and metastatic lung tumours of different types and degrees of differentiat.ioo. (As will be seen in the next chapter, corona structures may even develop around inflammator y lesions.) Two cases will now illustrate an "A" zone around a benign tu­ mour. In Fig. III: 6a, a hamartoma is seen surrounded by some discrete, 5~ mm long, radiating structures and an irregular circle of vessels 4-5 em in diameter. Six years later(Fig. III: 6b), a radiolucent zone, S-12 mm broad, surrounds the tumour. This zone is indistin­ guishable from an "A" zone as seen around a malig­ nant tumour. Confirmation of the marked radiolu­ cency of the "A" zone is shown by a densitometric recording across the lung, the "A" zone and the tu­ mour. 16 Malignant and benign neoplasms Fig.///: 5. Carcinoma of breast, metastatic to the upper lobe, left lung, frontal radiograph. The tumour is surround­ ed by a faint, radiolucent "A" zone medially, inferiorly, and laterally. The periphery of the "A" zone is poorly defmcd. Another hamartoma (Fig. III: 7) is illustrated sur­ rounded by a 1-8 mm broad "A" zone. A photograph­ ic "edge enhancement" and "Mach effect" (7, II) as possible sources of error can be excluded in this case because of the irregular and variable width of the "A" zone. Furthermore, comparab le differences of density, e.g., between ribs and lungs, do not show any edge enhancement artefacts in this radiograph. 1 Computerized tomograp hy may be more sensitive to "A" zone radiolucencies than plain radiographs. Fig. III: 8 a shows a plain radiograph of a metastatic mela­ noma in the right upper lobe. No clear "A" zone can be seen around the tumour. In the computerized tomo­ gram (Fig. III: 8 b), on the other hand, the rQdiolu­ ceot zone is easily recognized, as well as circular devi­ ation of vessels around the '"A" zone. 1 Evaluation of d~nsicy differences in photographic films is subjcc:t to several errors: the so<allcd adjacency effects and Mach effects mus1 bt considered. Tbe most common errors are the appearance of enhanced density along the «ige of a den$e area, known as the border effect ~ and dcxreased density outside the border effect. known as the fringe effect. The border effect is oflen referred to as the Mach line and the two effects together as the edge cffett. They are partly produced during film dt\'elopment because t.he devdoper affects not only the surface of the film but also 1he emulsion. Hori1.ontal diffusion of fresh developer within the emulsion en­ hances the developing prOttSs within a nearby area of higher expo­ !)ure. On the other hand, the reactive products of development also djffuse in tht opposjte direction through the boundary of diffe:rc:nt exposure. Such reactive products tend to inhibit development in the less e.xposcd side of the boundary. The edge effect occurs within a t'()atively restricted area adjacent to t.he boundary where the expo­ sure gndient is 5teep; usu.ally it is less than a millimetre wide. Tbe visual analogue to t.be photographic border and fringe effects is called the Mach effect. Ph)"$iologica lly an inu:nse stimulus of pan of the retina results in a lower signal from adjacent retinal ceiJs. This compensatory mechanim is called latenJ inhibition. The inu:n.se signal is on t.he ot.ber hand enhanced. Thil visual mechanism en­ hanclt'S cons.ider::ably the vi$u:al recognition of strue.tu.res. Fig./11:6. Hamartoma, right lung, frontal radiograph. (a) A radiolucent "A" zooe surrounding the tumour is suggested. (b) Six years later, the tumour has grown slightly. An "A*' zone: now definitely surrounds it. Tbe peripher·.tl margins of the "A" zone arc generally indis­ tinct. (c) A densitometric recording of the radiogr•ph b is shown, obtained at the level of the black horizon· tal line. Peaks of the tracing are obtained by the low at· tenuation for x-rays in the "A" zone. Fig. I II: 7. Hamartoma, right lung, frontal radiograph. A narrow "A'' zone of varying width surrounds the tumour. A pulmonary vessel (arrow) appears no1 to uaverse the '1 A, zone. Fig.ll/:8. Pulmonary metastasis from an cxtrathoracic rna· lign•nt melanoma. (a) Fronwl F3diogroph, right uppcF lobe. No definite.. A" zone is apparent. (b) Computerized tomo· graphy shows a radiolucent "A" zone around the rumour. Blood vessels appear devi.ared around the margin oft he "A" zone. Malignant and benign neoplasms 17 B. Small arches and arcades Before a gcncr•l description of the different appear· anccs of the "8" zone can be offered, sp<.-cific d<-scrip­ tion is appropriate for those parts of the interface of lhc.. A.. and "B.. zones which arc well defined, i.e., the arcades and small arches. Wherever the "A" zone sharply borders the "B" zone, small arches characterize the interface. Each arch is from one to five mm wide. The convexities of these arches are always directed away from the lesion. The 18 Malignant and benign neoplasms Fig. III: 9. Moderately well differentiated 5qWI· mous cell carcinoma, upper lobet left lung (same pa· tient as in Fig. Ill: 27.} A small arcade (arrows} formed by 1-2 mm wide arches is seen between
[ 705, 29204, 552, 279, 720, 27428, 13, 2468, 279, 17676, 3834, 10418, 1818, 279, 330, 32, 1, 323, 3436, 33, 1, 720, 68634, 11, 264, 220, 17, 991, 1317, 48312, 320, 277, 1849, 8, 374, 3970, 13, 13330, 1672, 1007, 81, 290, 720, 96861, 82, 433, 374, 14454, 555, 264, 1396, 315, 13987, 5438, 288, 11, 1855, 220, 16, 12, 17, 720, 3906, 7353, 13, 720, 30035, 13, 12799, 25, 220, 18, 13, 20685, 23333, 2849, 89468, 11, 60338, 259, 8582, 326, 15784, 13, 720, 2948, 8, 2163, 3276, 261, 73, 269, 1536, 37526, 12164, 3257, 9787, 60556, 12164, 1113, 610, 1791, 9, 720, 81, 1439, 11, 2737, 32703, 616, 6043, 320, 277, 1849, 570, 330, 32, 5354, 323, 330, 33, 1, 26467, 15952, 720, 6133, 6961, 287, 14869, 61336, 13, 320, 65, 8, 14043, 46000, 1536, 37526, 12164, 7, 20312, 30035, 13, 358, 622, 358, 25, 220, 17, 13, 45773, 398, 1782, 268, 462, 660, 8330, 23333, 2849, 89468, 315, 720, 1820, 2163, 21271, 11, 66746, 12164, 3257, 13, 578, 15756, 414, 374, 23712, 720, 1729, 264, 12164, 44906, 1189, 330, 32, 1, 10353, 11, 902, 374, 13798, 84, 7840, 11, 42408, 11, 323, 720, 15, 13, 20, 12, 16, 991, 7353, 13, 622, 2641, 16335, 4850, 374, 1280, 380, 7956, 662, 720, 911, 77, 764, 5039, 264, 220, 717, 9653, 7353, 11, 38293, 25947, 84, 1189, 330, 32, 1, 10353, 320, 32, 570, 720, 50909, 25, 1202, 2307, 337, 19715, 35023, 290, 264, 12164, 96580, 3436, 33, 1, 10353, 314, 33, 8, 720, 4752, 264, 1664, 39817, 4850, 2403, 279, 30233, 1, 10353, 320, 6172, 36910, 7609, 720, 23829, 86, 14260, 71, 846, 279, 4850, 315, 279, 330, 32, 1, 10353, 374, 2652, 5481, 269, 398, 4613, 13, 720, 44, 6750, 519, 323, 65309, 841, 454, 14833, 1026, 220, 868, 23966, 60098, 75, 25, 19, 662, 15344, 3846, 52, 89468, 11, 8582, 326, 15784, 11, 2163, 21271, 11, 720, 7096, 278, 12164, 3257, 13, 578, 330, 32, 1, 10353, 374, 922, 220, 20, 9653, 7029, 13, 362, 720, 1, 23, 1, 10353, 374, 3970, 439, 459, 42408, 98835, 45569, 311, 279, 9964, 93, 720, 84184, 13, 578, 3973, 1990, 279, 12164, 44906, 1189, 9787, 6806, 362, 1, 10353, 323, 720, 1820, 12164, 96580, 3436, 23, 1, 10353, 374, 31555, 4613, 13, 720, 275, 25501, 279, 2237, 315, 279, 14932, 21271, 39040, 59064, 5879, 198, 1764, 13, 720, 32, 17676, 16335, 3973, 315, 279, 330, 32, 1, 10353, 11, 389, 279, 1023, 720, 10888, 11, 374, 13468, 3752, 38210, 1193, 2403, 264, 220, 10410, 1, 720, 8855, 31183, 1990, 279, 15756, 414, 323, 279, 824, 94648, 315, 720, 1820, 21271, 320, 37, 14801, 13, 358, 25, 220, 17, 11, 14767, 25, 358, 11, 220, 18, 11, 220, 24, 570, 17863, 1534, 311, 6489, 14260, 720, 4539, 88, 690, 23781, 387, 810, 16614, 1109, 14733, 720, 70312, 3257, 274, 304, 54626, 1521, 4442, 320, 37, 14801, 13, 14767, 25, 220, 23, 11, 720, 1958, 570, 720, 2822, 29683, 94329, 2849, 955, 374, 5938, 720, 4291, 1867, 6863, 4442, 13, 1556, 330, 32, 1, 10353, 649, 387, 513, 17820, 2212, 720, 64750, 13034, 5848, 4595, 315, 8811, 18400, 89, 543, 75, 15756, 414, 29, 433, 89, 279, 720, 43, 2234, 13, 720, 2520, 1063, 892, 279, 3229, 3463, 430, 459, 330, 32, 11, 10353, 720, 16514, 264, 12164, 12968, 1879, 315, 9572, 13, 1102, 374, 539, 779, 13, 1556, 330, 32, 1, 720, 8855, 649, 387, 1766, 2212, 1063, 65309, 15756, 2530, 439, 720, 9336, 439, 2212, 6156, 323, 68370, 780, 21271, 15756, 2530, 315, 720, 64750, 4595, 323, 12628, 315, 2204, 10574, 4340, 78, 13, 320, 2170, 690, 720, 1395, 3970, 304, 279, 1828, 12735, 11, 1867, 6863, 14726, 1253, 720, 17206, 2274, 2212, 26288, 859, 379, 63324, 6266, 9220, 5157, 720, 14724, 1457, 41468, 459, 330, 32, 1, 10353, 2212, 264, 65309, 9964, 5879, 198, 84184, 13, 720, 644, 23966, 13, 14767, 25, 220, 21, 64, 11, 264, 13824, 472, 7942, 374, 3970, 23712, 555, 720, 15031, 44279, 11, 220, 20, 93, 9653, 1317, 11, 12164, 1113, 14726, 323, 720, 276, 42408, 12960, 315, 31080, 220, 19, 12, 20, 991, 304, 23899, 13, 19198, 720, 42820, 3010, 7988, 343, 13, 14767, 25, 220, 21, 65, 705, 264, 12164, 44906, 1189, 10353, 11, 328, 12, 717, 9653, 720, 65, 8714, 11, 71374, 279, 15756, 414, 13, 1115, 10353, 374, 1280, 380, 258, 5879, 198, 8890, 819, 481, 505, 459, 330, 32, 1, 10353, 439, 3970, 2212, 264, 8811, 343, 5879, 198, 52985, 15756, 414, 13, 69409, 315, 279, 13160, 12164, 44906, 5879, 198, 66, 2301, 315, 279, 330, 32, 1, 10353, 374, 6982, 555, 264, 39950, 275, 24264, 720, 2827, 2745, 4028, 279, 21271, 11, 279, 330, 32, 1, 10353, 323, 279, 9964, 5879, 198, 84184, 13, 720, 845, 386, 6750, 519, 323, 65309, 841, 454, 14833, 1026, 23966, 13, 2640, 25, 220, 20, 13, 3341, 18595, 7942, 315, 17659, 11, 68370, 780, 311, 279, 8582, 720, 64097, 11, 2163, 21271, 11, 66746, 12164, 3257, 13, 578, 15756, 414, 374, 9172, 5879, 198, 291, 555, 264, 38678, 11, 12164, 44906, 1189, 330, 32, 1, 10353, 1812, 34575, 11, 38279, 398, 11, 323, 720, 68676, 750, 13, 578, 824, 94648, 315, 279, 330, 32, 1, 10353, 374, 31555, 711, 76, 4484, 13, 720, 14364, 13824, 472, 7942, 320, 30035, 13, 14767, 25, 220, 22, 8, 374, 36762, 1765, 5879, 198, 45091, 555, 264, 220, 16, 12, 23, 9653, 7353, 330, 32, 1, 10353, 13, 362, 10512, 5879, 198, 292, 330, 7334, 27886, 1, 323, 330, 44, 613, 2515, 1, 320, 22, 11, 8105, 8, 439, 720, 10236, 8336, 315, 1493, 649, 387, 28544, 304, 420, 1162, 720, 28753, 315, 279, 42408, 323, 3977, 2430, 315, 279, 330, 32, 1, 720, 8855, 13, 24296, 11, 7809, 370, 514, 12062, 315, 17915, 11, 720, 68, 1326, 2637, 1990, 56249, 323, 45274, 11, 656, 539, 1501, 904, 6964, 720, 40967, 16887, 52448, 69153, 304, 420, 12164, 3257, 13, 220, 16, 720, 38432, 1534, 10390, 540, 4714, 6409, 1253, 387, 810, 16614, 311, 720, 30233, 1, 10353, 12164, 337, 1791, 6072, 1109, 14733, 12164, 67132, 13, 23966, 13, 720, 23440, 25, 220, 23, 264, 5039, 264, 14733, 12164, 3257, 315, 264, 68370, 780, 296, 8458, 5879, 198, 77, 7942, 304, 279, 1314, 8582, 326, 15784, 13, 2360, 2867, 330, 32, 1, 10353, 649, 387, 720, 29412, 2212, 279, 15756, 414, 13, 763, 279, 6500, 1534, 311, 6489, 5879, 198, 1549, 320, 30035, 13, 14767, 25, 220, 23, 293, 705, 389, 279, 1023, 1450, 11, 279, 436, 48, 8747, 44906, 5879, 198, 346, 354, 10353, 374, 6847, 15324, 11, 439, 1664, 439, 28029, 3567, 72, 5879, 198, 367, 315, 31080, 2212, 279, 7273, 32, 1, 10353, 13, 720, 16, 40388, 315, 294, 93, 4511, 2912, 12062, 304, 70164, 12631, 374, 81417, 641, 61877, 720, 998, 3892, 6103, 25, 279, 779, 27, 543, 4484, 74949, 6372, 323, 18798, 6372, 720, 38827, 16, 20164, 6646, 13, 350, 1395, 1455, 4279, 6103, 527, 279, 11341, 315, 720, 40967, 4979, 17915, 3235, 279, 12769, 7404, 315, 264, 3453, 3, 68, 3158, 11, 3967, 439, 279, 720, 9649, 2515, 4056, 323, 19966, 87, 265, 1503, 17915, 4994, 279, 3973, 2515, 13, 720, 5391, 439, 279, 55907, 2515, 13, 578, 3973, 2515, 374, 315, 2963, 14183, 311, 439, 720, 1820, 18798, 1584, 323, 279, 1403, 6372, 3871, 439, 279, 6964, 272, 544, 7211, 13, 2435, 720, 548, 28135, 9124, 2391, 4632, 7748, 10379, 108640, 1606, 259, 49135, 3567, 67, 3376, 720, 64, 41027, 539, 1193, 279, 7479, 315, 279, 4632, 719, 1101, 220, 16, 383, 991, 34003, 13, 720, 39, 13915, 16, 13, 546, 278, 58430, 315, 7878, 16131, 2949, 279, 991, 34003, 665, 5879, 198, 71, 3095, 279, 11469, 550, 46, 5683, 50, 82, 2949, 264, 14373, 3158, 315, 5190, 93416, 5879, 198, 16715, 554, 13, 1952, 279, 1023, 1450, 11, 279, 56563, 3956, 315, 4500, 1101, 720, 78604, 544, 817, 304, 270, 83, 8081, 111715, 5216, 1555, 279, 19254, 315, 1422, 1897, 25, 1310, 25, 406, 720, 327, 12313, 13, 15483, 56563, 3956, 8541, 311, 69033, 4500, 304, 279, 720, 1752, 384, 2036, 981, 4484, 3185, 315, 279, 19254, 662, 578, 6964, 2515, 13980, 2949, 264, 720, 83, 6, 368, 8046, 22486, 3158, 24894, 311, 259, 49135, 19254, 1405, 279, 93416, 5879, 198, 19643, 342, 303, 1188, 374, 220, 20, 668, 752, 26, 41388, 13, 750, 433, 374, 2753, 1109, 264, 2606, 318, 47987, 7029, 13, 350, 1395, 720, 30318, 91343, 311, 259, 8809, 70164, 3973, 323, 55907, 6372, 374, 720, 44982, 279, 18798, 2515, 13, 2405, 10143, 3, 72, 1640, 3074, 326, 398, 459, 304, 84, 19822, 325, 39535, 315, 7363, 315, 720, 1820, 84827, 3135, 304, 264, 4827, 8450, 505, 24894, 2160, 992, 3846, 72, 31580, 13, 1115, 720, 5807, 729, 5382, 7852, 318, 374, 2663, 93632, 41, 61478, 13, 578, 304, 84, 19822, 4624, 720, 27720, 374, 389, 259, 49135, 14479, 13, 655, 1450, 24872, 13, 666, 321, 9302, 17383, 665, 5879, 198, 10118, 566, 83, 13575, 1615, 1801, 261, 487, 2915, 279, 3355, 3, 84, 25, 278, 18324, 315, 610, 361, 739, 84, 4810, 13, 23966, 1761, 806, 25, 21, 662, 9777, 472, 7942, 1174, 1314, 21271, 11, 66746, 12164, 3257, 13, 720, 2948, 8, 362, 12164, 44906, 1189, 330, 32, 1, 42014, 68, 14932, 279, 15756, 414, 374, 720, 82, 54376, 13, 320, 65, 8, 19198, 1667, 3010, 11, 279, 15756, 414, 706, 15042, 720, 3306, 73048, 13, 1556, 330, 32, 92352, 10353, 25, 1457, 8659, 71374, 433, 13, 350, 1395, 720, 716, 10781, 14260, 13, 11805, 37682, 315, 279, 330, 32, 1, 10353, 15952, 8965, 83975, 5879, 198, 83, 7956, 13, 320, 66, 8, 362, 39950, 275, 24264, 14975, 315, 279, 12164, 74646, 6806, 764, 720, 65, 374, 6982, 11, 12457, 520, 279, 2237, 315, 279, 3776, 35174, 14260, 720, 51977, 1584, 13, 89370, 315, 279, 46515, 527, 12457, 555, 279, 3428, 520, 14260, 720, 83, 1509, 367, 369, 865, 82817, 304, 279, 330, 32, 1, 10353, 13, 720, 30035, 13, 358, 8105, 25, 220, 22, 13, 9777, 472, 7942, 11, 1314, 21271, 11, 66746, 12164, 3257, 13, 362, 720, 77, 6172, 330, 32, 4708, 10353, 315, 29865, 2430, 71374, 279, 15756, 414, 13, 362, 720, 79, 360, 55892, 27274, 320, 6172, 8, 8111, 912, 16, 311, 577, 23247, 279, 364, 16, 362, 11, 720, 8855, 13, 720, 30035, 60098, 11567, 23, 13, 35962, 55892, 68370, 10949, 505, 459, 21375, 376, 589, 269, 94257, 436, 3458, 14260, 720, 75, 625, 6806, 406, 68012, 7942, 662, 320, 64, 8, 435, 2298, 27515, 435, 18, 8747, 540, 22761, 11, 1314, 709, 4080, 37, 326, 15784, 13, 720, 2822, 44870, 5354, 362, 1, 10353, 374, 10186, 662, 320, 65, 8, 17863, 1534, 311, 6489, 14260, 720, 4539, 88, 5039, 264, 12164, 44906, 1189, 330, 32, 1, 10353, 2212, 279, 14322, 414, 13, 720, 52586, 31080, 5101, 3567, 72, 13, 1636, 2212, 279, 4850, 43146, 568, 330, 32, 1, 720, 8855, 13, 720, 44, 6750, 519, 323, 65309, 841, 454, 14833, 1026, 220, 1114, 426, 13, 15344, 5438, 288, 323, 15952, 3536, 720, 10438, 264, 22903, 1031, 81, 6806, 75, 4096, 315, 279, 2204, 5101, 14260, 720, 276, 641, 82, 315, 279, 330, 23, 1, 10353, 649, 387, 9076, 11, 993, 27, 12898, 66, 1104, 294, 46442, 11853, 79, 5879, 198, 28491, 374, 8475, 369, 1884, 5596, 315, 279, 3834, 315, 720, 75, 39152, 5354, 362, 5354, 323, 330, 33, 5354, 26467, 902, 15952, 1664, 4613, 11, 602, 1770, 2637, 720, 1820, 15952, 3536, 323, 2678, 5438, 288, 13, 720, 9241, 424, 279, 330, 32, 1, 10353, 46473, 24743, 279, 330, 33, 1, 720, 8855, 11, 2678, 5438, 288, 70755, 279, 3834, 13, 9062, 5438, 720, 285, 505, 832, 311, 4330, 9653, 7029, 13, 578, 67030, 1385, 315, 1521, 720, 1132, 288, 527, 2744, 15910, 3201, 505, 279, 93217, 13, 578, 720, 972, 386, 6750, 519, 323, 65309, 841, 454, 14833, 1026, 23966, 13, 14767, 25, 220, 24, 13, 44527, 2718, 1664, 89142, 220, 20, 80, 61295, 14260, 720, 76, 788, 2849, 89468, 11, 8582, 41253, 295, 2163, 21271, 320, 25030, 7251, 14260, 720, 83, 1188, 439, 304, 23966, 13, 12799, 25, 220, 1544, 662, 92, 362, 2678, 48312, 320, 277, 1849, 92, 720, 10365, 555, 220, 16, 12, 17, 9653, 7029, 5438, 288, 374, 3970, 1990 ]
0xBreath/holistic-books
. A spiral screw, I em long, is soldered to the tip of the cannula (Fig. XVII: 2a). The hub of the cannula is connected both to a surgical diathermia apparatus and via a electrode produces heat in the tumour. Saline solution in­ fused through the electrode maintains moisture and in­ creases the quantity of sodium chloride in the tumour, en­ hancing conductivity. The transmitted heat is measured by an electrothermometer (c), which is placed at the edge of the tumour. Teflon tube (50 em long and 2 mm wide) to a lympho­ graphy syringe. This syringe is filled with saline solu­ tion, which is slowly and evenly injected through the electrode during treatment. A large metal plate at­ tached to the patient's arm is used as an indifferent electrode. In order to avoid a large pneumothorax, which might easily displace an electrode, it was found useful to place percutaneously an ordinary pleural drainage tube in the pleural space two days before implantation of the electrode. Twenty minutes before the procedure the patient is administered a tranquilizer, such as Valium '~>, intra­ muscularly. Under local anaesthesia and biplane fluoroscopic control, the thin Teflon tube (Fig. XVII: 2 b) is inserted percutaneously into the tumour. Material for cytologic study is obtained via the cannula by means of a small screw needle inStrument (44, 45). The material is stained immediately and examined microscopically. In the meantime the electrode is in­ serted through the Teflon tube, screwed into the tu­ mour tissue and connected to the electrocoagulation apparatus and the lymphographic syringe. A forceful aspiration with the syringe must precede these ma­ noeuvres in order to make sure that the tip of the Teflon tube is not positioned in a pulmonary vein, which might possibly introduce spontaneous inflow of air into the left side of the heart. The tip of the electrothermometer needle (Fig. XVII: 2c) is placed in the tumour close to the surface. Accuracy is required for implanting the electrodes. This requirement led to cooperative work with repre­ sentatives of the x-ray industry, resulting in the devel­ opment of the so-called BINO and SINO' units (42). 1 Manufac:lured b)' Siemcns·Eicma, Stockhobn, under the trade name of Angioscope. Treatment of cancer 273 Fig. XV/1:4. Piece of meat (moosesteak ) after local diather­ mic production of heat over an electrode perfused with saline ~1ution. ~rhe cut surface through the bolted tissue is ap­ proximately 2.5 x 1.5 em and grey-white. Dia:hcrmia over a dry electrode produces a small, black region cf dry tissue, which easily breaks conductivity of the circuit. 274 Treatment of cancer Fig. XVII: 3. Biplane flu­ oroscopic unit, designed for separate positioning of two arch-suspended x-ray tubes and image intensifiers in any direction in relation to the subject. The patient table, suspended in a coordinate S)"tcm from 1he ceiling, al­ lows positioning of the pa­ tient independent of the arch construction. Elevation of the table top, rotation of the patient and movements of the arches are controlled by servo motors from a con· trol panel. This biplane equipment (Fig. XVII: 3) allows individ­ ual placements of two arch-suspended radiographic tubes and image intensifiers. The patient is examined on a roll sheet table suspended from the ceiling by telescopic stands, which are movable in a coordinate system. Nearly all the movements of the arches and of the patient table are performed remotely via servo motors from a control panel. About 2-3 drops of saline solution per second are injected during the electrocoagulat ion. In this way the tissue close ro rhe electrode tip is kept wet, securing a continued complete circuit over a prolonged time com­ pared with the use of dry electrodes. Evaporated water escapes as steam between the wall of the cannula and the inner wall of the Teflon rube. At the same time the amount of salt increases in the tumour tissue, enhanc­ ing conductivity. Usually the recorded temperature at the edge of the tumour was elevated to about 60"C for 4 to 5 minutes during each of these treatments. This level of heat means that the tissue is "boiled" rather than "fried", as with the dry electrode technique. The result of such a boiling of a piece of moosesteak is shown in Fig. XVII: 4. The tissue is opaque only in the coagulated area. The effe<:t in a lung tumour in vivo is difficult to predict, because it depends to a large extent on circula· tion of blood and ventilation, cooling the tissues. 3. Resuhs Twelve pulmonary metastaS(. 'S in eight patients as well as primary carcinoma of the breast in two patients have been treated by ele<:trodes perfused with liquid. Table XVII: I surveys relevant clinical data of these teo patients. Seven of the patiems were women and three men. Ages varied between nineteen and sixty-four years. The size of each tumour at the time of treatment varied between 6 and 37 (mean 18) mm in diameter. Eight of the rumours regressed after treatment, five showed progression and one was indeterminate. The Fig. XVII: 5. Electrocoa· gulation followed by de· crease in size of a metastatic fibroliposarcoma in lhe right lung. (a) ~fore treatment. (c) After 485 days. (d) After 1490 days. (b) Cytologic specimen obtained by per· cutaneous needle biopsy of lhe rumour before treat· ment. May-Grunewald· Giemsa stain. a two largest tumours showing regression had initial diameters of 29 to 30 mm. Longest observation time with persistent regression has been four years and eight months in one patient. No serious complications have occurred. In!our patients small to moderate asymptomatic pneumothoraces developed. Before electrocoagulation was performed, ten of the tumours had continued to grow in spite of cytostatic therapy. The courses of two patients with lung metastases and the rwo with breast rumours will now be described and illustrated in de~ail. Case /. A fibroliposarcoma of the uterus was excised from a 19-year-old woman. One year after operation a tumour 2 em in dianneter was found in the right lung (Fig. XVU: 5 a). The diagnosis of metastasis from the primary tumour was confirmed (Fig. XVII: 5 b) by a screw needle biopsy (44, 45) obtained under local anaesthesia. The Tef1lon tube (Fig. XVII: 2 b) was then . . ·;.v_~SO).Im fltia...,.._,......._,.._ Treatment of cancer 275 Table XVII: I. Rtsults of trtatmnrt by electrocoagu lation (liquid-perfused electrodes) of metastatic cancer in the lungs in eighr patinr (no. I~) and primary carcinoma of tht breasr in two patients (no. 9, /0) Date of electro· Obsen"'ltion coagulation time (da)~) Effecc on P2fit"nl l,rimary Si:r.e of TUmour Siu of tu· rreated No. Age tumour (mm) mour (mm) tumour Commenrs I. B.K. 'i' Fibroliposar· 912 1978 I 490 Regression ContinuQus growth of four pulmonary 19 coma of uterus 19XI9X 19 7xSx2 metastases during cytostatic therapy ReS«tion 1977 before electrocoagulation of one, and later elecuoehemical treatmen t of three of the metastases (set Table XVII: 2). 2. G.B. 'i' At.alignant 2714 1977 240 Regression Prt\·ious cytoStatic lhe-rapy, followed 32 melanoma of 29X29X30 nxzox2z by tumour srowth until elecrroooagula · s!Un tion. lXath from haemorrhage in one of Resection 1976 sen:ral cerebral mctastaSC$. Small pneumothorax during electrocoagulat ion. 3. A
[ 13, 362, 42197, 720, 82, 39717, 11, 358, 991, 1317, 11, 374, 60877, 291, 311, 279, 11813, 315, 279, 14068, 5724, 720, 7988, 343, 13, 53694, 5660, 25, 220, 17, 64, 570, 578, 19240, 315, 279, 14068, 5724, 374, 8599, 720, 21704, 311, 264, 34933, 1891, 1894, 91299, 41705, 323, 4669, 264, 72048, 19159, 8798, 304, 279, 15756, 414, 13, 8375, 483, 6425, 304, 5879, 198, 69, 2656, 1555, 279, 72048, 33095, 32257, 323, 304, 5879, 198, 846, 2315, 279, 12472, 315, 39695, 82882, 304, 279, 15756, 414, 11, 665, 5879, 198, 71, 9151, 98971, 13, 578, 34699, 8798, 374, 17303, 555, 720, 276, 25396, 700, 76, 21037, 320, 66, 705, 902, 374, 9277, 520, 279, 6964, 315, 279, 720, 83, 372, 414, 13, 720, 51, 830, 12490, 14019, 320, 1135, 991, 1317, 323, 220, 17, 9653, 7029, 8, 311, 264, 43745, 78, 5879, 198, 4539, 88, 6705, 85124, 13, 1115, 6705, 85124, 374, 10409, 449, 99107, 2092, 84, 5879, 198, 28491, 11, 902, 374, 14297, 323, 42147, 41772, 1555, 279, 720, 19493, 299, 451, 2391, 6514, 13, 362, 3544, 9501, 12235, 520, 5879, 198, 83, 3939, 311, 279, 8893, 596, 6916, 374, 1511, 439, 459, 80008, 720, 19493, 299, 451, 13, 763, 2015, 311, 5766, 264, 3544, 57223, 8942, 269, 710, 11, 720, 8370, 2643, 6847, 834, 2050, 459, 72048, 11, 433, 574, 1766, 720, 817, 1285, 311, 2035, 824, 10453, 20933, 459, 19664, 7245, 4269, 720, 3696, 467, 425, 14019, 304, 279, 7245, 4269, 3634, 1403, 2919, 1603, 720, 6517, 519, 367, 315, 279, 72048, 13, 720, 76896, 4520, 1603, 279, 10537, 279, 8893, 374, 720, 2953, 1601, 291, 264, 68040, 3213, 11, 1778, 439, 4196, 2411, 64570, 8226, 50938, 5879, 198, 38827, 22077, 398, 13, 9636, 2254, 41390, 63623, 323, 6160, 19563, 720, 27256, 269, 84667, 2585, 11, 279, 15792, 350, 830, 12490, 14019, 320, 30035, 13, 720, 55, 53, 5660, 25, 220, 17, 293, 8, 374, 22306, 824, 10453, 20933, 1139, 279, 15756, 414, 13, 720, 13721, 369, 79909, 39227, 4007, 374, 12457, 4669, 279, 14068, 5724, 720, 1729, 3445, 315, 264, 2678, 22733, 31409, 304, 2645, 1143, 320, 2096, 11, 220, 1774, 570, 720, 791, 3769, 374, 61152, 7214, 323, 25078, 720, 41543, 2445, 454, 2740, 13, 763, 279, 33953, 279, 72048, 374, 304, 5879, 198, 6175, 291, 1555, 279, 350, 830, 12490, 14019, 11, 57445, 1139, 279, 9964, 5879, 198, 84184, 20438, 323, 8599, 311, 279, 25396, 1030, 351, 2987, 720, 680, 277, 1015, 323, 279, 43745, 12968, 6705, 85124, 13, 362, 5457, 1285, 720, 300, 29579, 449, 279, 6705, 85124, 2011, 16599, 68, 1521, 7643, 5879, 198, 2201, 68, 12328, 417, 304, 2015, 311, 1304, 2771, 430, 279, 11813, 315, 279, 720, 51, 830, 12490, 14019, 374, 539, 35328, 304, 264, 70524, 54344, 11, 720, 8370, 2643, 11000, 19678, 54557, 4704, 363, 315, 720, 1334, 1139, 279, 2163, 3185, 315, 279, 4851, 13, 578, 11813, 315, 279, 720, 19493, 299, 700, 76, 21037, 31409, 320, 30035, 13, 53694, 5660, 25, 220, 17, 66, 8, 374, 9277, 304, 720, 1820, 15756, 414, 3345, 311, 279, 7479, 13, 720, 46922, 374, 2631, 369, 46460, 287, 279, 80390, 662, 720, 2028, 16686, 6197, 311, 48566, 990, 449, 312, 1762, 5879, 198, 25526, 5983, 315, 279, 865, 30630, 5064, 11, 13239, 304, 279, 90870, 5879, 198, 454, 479, 315, 279, 779, 19434, 426, 49075, 323, 328, 49075, 6, 8316, 320, 2983, 570, 720, 16, 2418, 127495, 89497, 3149, 293, 22367, 12095, 336, 66, 4511, 14260, 36, 292, 1764, 11, 12937, 71, 677, 77, 11, 1234, 279, 6696, 720, 609, 315, 7568, 3614, 2474, 13, 720, 99654, 315, 9572, 220, 15451, 23966, 13, 53694, 14, 16, 25, 19, 13, 30030, 315, 13339, 320, 6489, 974, 5455, 587, 883, 1306, 2254, 1891, 1894, 5879, 198, 21914, 5788, 315, 8798, 927, 459, 72048, 22535, 2656, 449, 99107, 720, 93, 16, 1516, 13, 4056, 81, 383, 4018, 7479, 1555, 279, 32942, 291, 20438, 374, 1469, 5879, 198, 42598, 7253, 220, 17, 13, 20, 865, 220, 16, 13, 20, 991, 323, 20366, 16237, 662, 66403, 70751, 62838, 689, 927, 264, 720, 54310, 72048, 19159, 264, 2678, 11, 3776, 5654, 25080, 9235, 20438, 11, 720, 8370, 6847, 18808, 98971, 315, 279, 16622, 13, 720, 16590, 31969, 315, 9572, 23966, 13, 53694, 5660, 25, 220, 18, 13, 426, 10567, 2194, 20236, 5879, 198, 269, 84667, 5089, 11, 6319, 369, 720, 325, 68698, 39825, 315, 1403, 720, 1132, 1355, 67449, 865, 30630, 34083, 720, 438, 2217, 25228, 12099, 304, 904, 720, 19612, 304, 12976, 311, 279, 720, 11760, 13, 578, 8893, 2007, 11, 720, 82, 67449, 304, 264, 16580, 720, 50, 10143, 83, 6358, 505, 220, 16, 383, 22959, 11, 453, 5879, 198, 75, 4336, 39825, 315, 279, 7251, 5879, 198, 83, 1188, 9678, 315, 279, 720, 1132, 8246, 13, 469, 44857, 720, 1073, 279, 2007, 1948, 11, 12984, 315, 720, 1820, 8893, 323, 19567, 720, 1073, 279, 5438, 288, 527, 14400, 720, 1729, 59412, 38424, 505, 264, 390, 14260, 720, 83, 1098, 7090, 13, 720, 2028, 6160, 19563, 7241, 320, 30035, 13, 53694, 5660, 25, 220, 18, 8, 6276, 23496, 5879, 198, 940, 89493, 315, 1403, 5438, 1355, 67449, 12164, 12968, 720, 83, 51725, 323, 2217, 25228, 12099, 662, 578, 8893, 374, 25078, 720, 263, 264, 6638, 11071, 2007, 22340, 505, 279, 22959, 555, 720, 668, 64631, 25847, 13656, 11, 902, 527, 83679, 304, 264, 16580, 720, 9125, 13, 49669, 682, 279, 19567, 315, 279, 5438, 288, 323, 315, 720, 1820, 8893, 2007, 527, 10887, 39529, 4669, 59412, 720, 47928, 1105, 505, 264, 2585, 7090, 13, 720, 10714, 220, 17, 12, 18, 21701, 315, 99107, 6425, 824, 2132, 527, 720, 258, 29403, 2391, 279, 25396, 1030, 351, 360, 266, 28772, 13, 763, 420, 1648, 279, 720, 83, 11407, 3345, 938, 68132, 72048, 11813, 374, 8774, 14739, 11, 41577, 264, 720, 86957, 4686, 16622, 927, 264, 44387, 892, 470, 5879, 198, 7360, 449, 279, 1005, 315, 9235, 80390, 13, 10641, 21374, 660, 3090, 720, 3380, 9521, 439, 20930, 1990, 279, 7147, 315, 279, 14068, 5724, 323, 720, 1820, 9358, 7147, 315, 279, 350, 830, 12490, 436, 3845, 13, 2468, 279, 1890, 892, 279, 720, 6173, 315, 12290, 12992, 304, 279, 15756, 414, 20438, 11, 8833, 1149, 5879, 198, 287, 98971, 13, 720, 71744, 279, 12715, 9499, 520, 279, 6964, 315, 279, 720, 83, 372, 414, 574, 32389, 311, 922, 220, 1399, 47416, 369, 220, 19, 311, 220, 20, 4520, 720, 82977, 1855, 315, 1521, 22972, 13, 1115, 2237, 315, 8798, 720, 47321, 430, 279, 20438, 374, 330, 754, 2230, 1, 4856, 1109, 330, 98625, 498, 720, 300, 449, 279, 9235, 72048, 15105, 13, 578, 1121, 315, 1778, 720, 64, 50937, 315, 264, 6710, 315, 4647, 974, 5455, 587, 374, 6982, 304, 23966, 13, 720, 55, 53, 5660, 25, 220, 19, 13, 578, 20438, 374, 47584, 1193, 304, 279, 1080, 351, 7913, 3158, 13, 578, 3369, 68, 27, 25, 83, 304, 264, 21271, 15756, 414, 304, 41294, 374, 5107, 311, 720, 35798, 11, 1606, 433, 14117, 311, 264, 3544, 13112, 389, 4319, 5724, 14260, 720, 28491, 315, 6680, 323, 56234, 11, 28015, 279, 39881, 13, 720, 18, 13, 1838, 84, 5104, 720, 23662, 21903, 70524, 2322, 14635, 50, 14960, 364, 50, 304, 8223, 6978, 439, 1664, 720, 300, 6156, 89468, 315, 279, 17659, 304, 1403, 6978, 720, 19553, 1027, 12020, 555, 10732, 27, 25, 33542, 5919, 22535, 2656, 449, 14812, 13, 720, 2620, 53694, 5660, 25, 358, 32313, 9959, 14830, 828, 315, 1521, 720, 668, 78, 6978, 13, 720, 60628, 315, 279, 3352, 72, 12116, 1051, 3278, 323, 2380, 3026, 13, 720, 32, 4282, 28830, 1990, 94935, 323, 53474, 42117, 1667, 13, 720, 791, 1404, 315, 1855, 15756, 414, 520, 279, 892, 315, 6514, 720, 959, 1142, 1990, 220, 21, 323, 220, 1806, 320, 14622, 220, 972, 8, 9653, 304, 23899, 13, 720, 60185, 315, 279, 66025, 1239, 14715, 1306, 6514, 1174, 4330, 720, 3528, 291, 33824, 323, 832, 574, 1280, 65324, 13, 578, 720, 30035, 13, 53694, 5660, 25, 220, 20, 13, 69390, 1030, 64, 14260, 720, 70, 2987, 8272, 555, 409, 14260, 720, 20542, 304, 1404, 315, 264, 68370, 780, 720, 76426, 1098, 575, 437, 277, 82945, 304, 326, 383, 1314, 720, 39049, 13, 320, 64, 8, 4056, 1348, 6514, 13, 720, 1361, 8, 4740, 220, 19773, 2919, 13, 320, 67, 8, 4740, 720, 10161, 15, 2919, 13, 320, 65, 8, 356, 16820, 39227, 720, 9727, 27236, 12457, 555, 824, 14260, 720, 10453, 18133, 31409, 99647, 315, 720, 75, 383, 14322, 414, 1603, 4322, 14260, 720, 479, 13, 3297, 12279, 6236, 365, 4852, 14260, 720, 38, 27960, 9258, 53064, 13, 264, 1403, 7928, 15756, 2530, 9204, 31649, 1047, 2926, 720, 67, 5038, 2481, 315, 220, 1682, 311, 220, 966, 9653, 13, 5843, 478, 22695, 892, 720, 4291, 26048, 31649, 706, 1027, 3116, 1667, 323, 720, 68632, 4038, 304, 832, 8893, 13, 2360, 6129, 36505, 720, 19553, 10222, 13, 763, 758, 414, 6978, 2678, 311, 24070, 720, 300, 1631, 418, 13795, 57223, 8942, 269, 2492, 8040, 662, 13538, 720, 19493, 299, 1030, 351, 2987, 574, 10887, 1174, 5899, 315, 279, 15756, 2530, 720, 32345, 8738, 311, 3139, 304, 34781, 315, 79909, 537, 780, 15419, 13, 720, 791, 14307, 315, 1403, 6978, 449, 21271, 68370, 2315, 720, 438, 279, 436, 1146, 449, 17659, 66025, 690, 1457, 387, 7633, 720, 438, 36762, 304, 409, 93, 607, 13, 720, 4301, 15093, 362, 16178, 1098, 575, 437, 277, 82945, 315, 279, 85656, 574, 3521, 4147, 720, 1527, 264, 220, 777, 4771, 6418, 5333, 13, 3861, 1060, 1306, 5784, 264, 720, 83, 372, 414, 220, 17, 991, 304, 1891, 1036, 1430, 574, 1766, 304, 279, 1314, 21271, 720, 7988, 343, 13, 53694, 52, 25, 220, 20, 264, 570, 578, 23842, 315, 68370, 10949, 505, 279, 720, 6682, 15756, 414, 574, 11007, 320, 30035, 13, 53694, 5660, 25, 220, 20, 293, 8, 555, 264, 720, 82, 39717, 31409, 99647, 320, 2096, 11, 220, 1774, 8, 12457, 1234, 2254, 720, 3444, 63623, 13, 578, 350, 830, 16, 12490, 14019, 320, 30035, 13, 53694, 5660, 25, 220, 17, 293, 8, 574, 1243, 720, 13, 720, 13, 9787, 79798, 85, 62, 93, 14202, 570, 1453, 720, 80309, 689, 61453, 497, 7022, 49711, 7022, 497, 62, 720, 99654, 315, 9572, 220, 14417, 6771, 53694, 5660, 25, 358, 13, 432, 2641, 122761, 315, 490, 68238, 22524, 3423, 555, 25396, 1030, 47820, 326, 367, 320, 54737, 17453, 69, 2656, 80390, 8, 315, 68370, 780, 9572, 304, 279, 45274, 304, 384, 1108, 81, 3352, 258, 81, 720, 40305, 13, 358, 93, 8, 323, 6156, 89468, 315, 270, 83, 5395, 300, 81, 304, 1403, 6978, 320, 2201, 13, 220, 24, 11, 611, 15, 8, 720, 1956, 315, 25396, 14260, 51541, 268, 21230, 4937, 290, 720, 1030, 351, 2987, 892, 320, 3315, 8, 93, 8, 469, 29069, 641, 389, 720, 47, 17, 6410, 1, 16017, 326, 16262, 3188, 12095, 68459, 1770, 315, 350, 45767, 414, 12095, 84, 315, 9964, 14260, 436, 2920, 720, 2822, 13, 13381, 15756, 414, 320, 3906, 8, 67683, 320, 3906, 8, 15756, 414, 1219, 5794, 5544, 720, 40, 13, 426, 11606, 13, 364, 72, 6, 43564, 1098, 575, 437, 277, 14260, 220, 22750, 220, 4468, 23, 358, 220, 18518, 48570, 20915, 84, 48, 355, 6650, 315, 3116, 70524, 720, 777, 70398, 315, 85656, 220, 777, 84214, 24, 55, 220, 777, 220, 22, 87, 50, 87, 17, 68370, 2315, 2391, 79909, 537, 780, 15419, 720, 697, 50, 24633, 28491, 220, 4468, 22, 1603, 25396, 1030, 351, 2987, 315, 832, 11, 323, 720, 68676, 10732, 20811, 78, 2701, 336, 950, 4322, 5794, 259, 315, 720, 28956, 315, 279, 68370, 2315, 320, 751, 6771, 720, 55, 53, 5660, 25, 220, 17, 570, 720, 17, 13, 480, 1823, 13, 364, 72, 6, 2468, 66500, 519, 220, 15828, 19, 220, 4468, 22, 220, 8273, 48570, 2394, 83, 59, 14260, 1245, 9693, 998, 11952, 326, 383, 3880, 9864, 11, 8272, 720, 843, 68012, 7942, 315, 220, 1682, 55, 1682, 55, 966, 25508, 89, 5241, 17, 89, 555, 15756, 414, 274, 19632, 3156, 10732, 5192, 299, 2689, 351, 5724, 9787, 720, 82, 0, 1844, 73352, 13, 326, 55, 589, 505, 6520, 336, 54308, 425, 304, 832, 315, 720, 1079, 12181, 220, 4468, 21, 6252, 25, 3545, 60745, 296, 302, 14635, 3624, 3, 662, 15344, 720, 79, 126261, 8942, 269, 710, 2391, 25396, 1030, 351, 360, 266, 28772, 13, 720, 18, 13, 362 ]
0xBreath/holistic-books
—where they are more and more unaffected by silly human gossip. You must be unaffected by all gossip, for it is of the human. As the Great Goddess of Liberty said in West Palm Beach: "It is well for each one to take an inventory of himself or herself. See wherein you can give Greater Obedience to the Law of your Life, for It is exacting, I assure you. The Law of Life is no respecter of persons! Whatever you create in your world, you will experience, even today"! We see the Expansion of the Light within the students and their firm—Oh, so much firmer determination to stand unyielding, even to listening to destructive experiences! It is the Mightiest Thing in human Beings' experience. DISCOURSE VIII 215 Any human Being who will take his or her stand; and refuse to listen to any discordant thing, will find that one's world flooded with Perfection and the good things of Life! It is why the Messengers have pounded, and pounded, and pounded, This One Mighty Truth to the Students from the beginning. They shall continue, until the Beloved Ones get this Point into their consciousness so powerfully, they will no longer be affected by discordant things. You must do it, if you wish ever to be Free! That is why, tonight, I am taking this opportunity, to prompt you once again, in the preparation for this Class; because a Power will be released never before known. Let Me prompt you! To every student who comes into the Shrine Auditorium, I say please, do not allow one thought or feeling of your own concept, to requalify the Release of This Mighty Energy! We must be firm! There is no reason why anyone should come into that Class and not feel a Power, a Joy, an Exhilaration, a Healing Presence, unparalleled on the face of this Earth! Don't let anyone come into the Auditorium and get faint or disturbed! Such things are going to cease! It only is the requalification, by one's own human feeling. Take your stand and don't do this! Then, you will receive the Fulness of the Healing Power. Any person coming into the room who will harmonize his or her feeling and sustain it sufficiently, will go forth healed of every condition which has ever beset that one. Now, do you wish to take advantage of it? I prompt you, 241 THE "I AM99 DISCOURSES don't either in your Individual Life or in this Class, allow one single human feeling to requalify the Release of this Powerful Energy, for It will come forth from your Presence as well as from Us. It cannot produce anything but Per- fection for you; Greater Harmony, Greater Joy, Greater Health and Strength! So do not let the human requalify It! Don't think I am criticizing you, Beloved Ones, tonight, but I refer you to Beloved Saint Germain's Words. A lady who was in the home of the Messengers in their early experiences, had the habit of fainting quite often; so during Beloved Saint Germain's Dictations of the "I AM" Dis- courses in their home, He took up the subject and sent word to the lady: "Now don't faint any more"! He said, "you don't have to faint unless you want to." Well the lady never fainted again. Precious Hearts, I wish to help you feel and see the re- qualification of the action of the energy, within your world, which produces these conditions. If any person, the mo- ment he or she feels some slight disturbance will say: "Here, stop that! I will not have it"! in ninety percent of the cases, they will stop the whole action. You know when you begin to feel faint, you get more and more faint. Do you know, alertness is a most magnificent thing? We are trying to convey to you—to be alert to all conditions, whether they be physical conditions and appearances in the outer world; or whatever it is that is affecting you or your world. If you will say, "STOP"! right then, you release the Power which is the controlling element of the condi-DISCOURSE VIII 217 tion whatever it may be. If it be an appearance as an out- side condition, if you will instantly take command of your- self and say: "Stop! you shall not enter my world! You shall not disturb me"! you will find yourself in FULL COMMAND of your world and the conditions which sur- round you. Beloved Ones, how do you suppose We control condi- tions? By that very identical thing! Naturally, We are able to release a Greater Power than you are; but still We must help you make a beginning; and the sooner We do, the quicker you are Master of your world. In the Fulness of the Love, the Power of Divine Love, which I am able to release to you; if you will do this, I will assist you to a Victory and Speed of Achievement which will delight you. We think the time has come, when the Beloved Students everywhere, must feel and make manifest This Dominion in their lives. There always comes a time in the Life and Expansion of the Light of every Individual, where after a certain amount of prompting, each one is left as you often term it—"upon his own, to sink or swim." Does that sound cruel? No! We often feel the Call of students, longing to lay their heads upon Our Chests and weep; to arouse Our Sympathy to take their defense. Well, you may lay your heads upon Our Chests, but not to weep; only to rejoice by the Power of your own Victory! Sometimes, when the feeling comes to Us—Oh, if the Ascended Masters are all this, why don't They do some- thing? They are doing plenty all the time, but let Me 218 THE "I AM99 DISCOURSES remind you, the Messengers did not have Us pick them up and carry them around! They had to apply the Law for their own Protection; for everything which they have, and when you will apply as dynamically as they have; and when you will refuse acceptance into your world of all foolish human gossip, you will have your Freedom then
[ 2345, 2940, 220, 814, 220, 527, 810, 220, 323, 720, 6518, 220, 78622, 220, 555, 30571, 220, 3823, 220, 58587, 13, 720, 2675, 2011, 220, 387, 78622, 220, 555, 682, 58587, 11, 220, 369, 433, 374, 315, 279, 720, 26380, 13, 720, 2170, 279, 8681, 220, 61785, 220, 315, 32492, 220, 1071, 220, 304, 4410, 220, 33578, 220, 13011, 25, 720, 12348, 374, 1664, 220, 369, 1855, 220, 832, 220, 311, 1935, 220, 459, 15808, 220, 315, 5678, 220, 477, 720, 71, 388, 491, 13, 220, 3580, 42418, 220, 499, 220, 649, 3041, 220, 33381, 220, 507, 2788, 1873, 220, 311, 279, 720, 39166, 220, 315, 701, 220, 9601, 11, 220, 369, 1102, 374, 4839, 287, 11, 220, 358, 36015, 220, 499, 13, 220, 578, 220, 7658, 720, 1073, 9601, 220, 374, 912, 5201, 261, 220, 315, 11434, 0, 220, 33739, 220, 499, 220, 1893, 220, 304, 720, 22479, 220, 1917, 11, 220, 499, 220, 690, 220, 3217, 11, 220, 1524, 220, 3432, 1, 0, 720, 1687, 1518, 279, 55654, 220, 315, 279, 8828, 220, 2949, 220, 279, 4236, 720, 438, 872, 220, 7626, 2345, 12174, 11, 220, 779, 1790, 220, 35092, 1195, 220, 26314, 220, 311, 2559, 720, 359, 30796, 287, 11, 220, 1524, 220, 311, 14624, 220, 311, 40652, 220, 11704, 0, 720, 2181, 374, 279, 34351, 13744, 220, 38300, 220, 304, 3823, 220, 2893, 826, 6, 220, 3217, 13, 12244, 34, 75008, 220, 58333, 220, 220, 12112, 720, 8780, 220, 3823, 220, 21347, 220, 889, 220, 690, 220, 1935, 220, 813, 477, 1077, 220, 2559, 26, 220, 323, 720, 1116, 817, 220, 311, 9020, 220, 311, 904, 220, 32141, 519, 220, 3245, 11, 220, 690, 220, 1505, 220, 430, 220, 832, 596, 720, 14957, 220, 49886, 220, 449, 220, 3700, 13421, 220, 323, 220, 279, 1695, 220, 2574, 220, 315, 9601, 0, 720, 2181, 374, 3249, 220, 279, 19234, 15232, 220, 617, 220, 95579, 11, 220, 323, 220, 95579, 11, 720, 438, 95579, 11, 220, 1115, 220, 3861, 220, 75268, 220, 30198, 220, 311, 279, 220, 20783, 720, 1527, 220, 279, 7314, 13, 220, 2435, 220, 4985, 220, 3136, 11, 220, 3156, 220, 279, 7984, 5047, 720, 1966, 288, 220, 636, 420, 220, 5236, 220, 1139, 220, 872, 220, 25917, 220, 779, 2410, 3725, 11, 720, 20670, 220, 690, 220, 912, 5129, 220, 387, 11754, 220, 555, 32141, 519, 220, 2574, 13, 220, 1472, 720, 25849, 220, 656, 433, 11, 422, 499, 220, 6562, 220, 3596, 220, 311, 387, 3658, 0, 220, 3011, 220, 374, 3249, 11, 220, 18396, 11, 720, 40, 1097, 4737, 220, 420, 220, 6776, 11, 220, 311, 10137, 220, 499, 220, 3131, 220, 1578, 11, 220, 304, 720, 1820, 18459, 220, 369, 420, 220, 3308, 26, 220, 1606, 220, 264, 7572, 220, 690, 220, 387, 720, 78038, 220, 2646, 220, 1603, 220, 3967, 13, 720, 10267, 2206, 10137, 220, 499, 0, 220, 2057, 1475, 220, 5575, 220, 889, 220, 4131, 220, 1139, 720, 1820, 94574, 220, 62492, 2411, 11, 220, 358, 2019, 220, 4587, 11, 220, 656, 539, 220, 2187, 220, 832, 720, 61665, 220, 477, 8430, 220, 315, 701, 220, 1866, 220, 7434, 11, 220, 311, 312, 1788, 1463, 220, 279, 720, 16464, 220, 315, 1115, 220, 75268, 220, 12634, 0, 220, 1226, 220, 2011, 220, 387, 7626, 0, 220, 2684, 720, 285, 912, 2944, 220, 3249, 220, 5606, 220, 1288, 220, 2586, 220, 1139, 220, 430, 220, 3308, 220, 323, 720, 1962, 2733, 264, 7572, 11, 220, 264, 28237, 11, 220, 459, 1398, 71, 3653, 367, 11, 220, 264, 49741, 220, 79723, 11, 720, 359, 68901, 220, 389, 279, 3663, 220, 315, 420, 220, 9420, 0, 220, 4418, 956, 220, 1095, 5606, 720, 2063, 220, 1139, 220, 279, 220, 62492, 2411, 220, 323, 220, 636, 220, 38678, 220, 477, 56507, 0, 720, 21365, 220, 2574, 220, 527, 2133, 220, 311, 32616, 0, 220, 1102, 1193, 220, 374, 279, 312, 73009, 11, 720, 1729, 832, 596, 220, 1866, 220, 3823, 220, 8430, 13, 220, 12040, 220, 701, 220, 2559, 220, 323, 220, 1541, 956, 720, 3055, 420, 0, 220, 5112, 11, 220, 499, 220, 690, 220, 5371, 220, 279, 48550, 2136, 220, 315, 279, 49741, 720, 15335, 13, 720, 8780, 220, 1732, 220, 5108, 220, 1139, 220, 279, 3130, 220, 889, 220, 690, 220, 18249, 553, 720, 26301, 477, 1077, 8430, 220, 323, 220, 14201, 220, 433, 40044, 11, 220, 690, 220, 733, 13544, 720, 383, 5962, 220, 315, 1475, 220, 3044, 220, 902, 220, 706, 220, 3596, 220, 9234, 295, 220, 430, 220, 832, 13, 720, 7184, 11, 220, 656, 499, 220, 6562, 220, 311, 1935, 220, 9610, 220, 315, 433, 30, 358, 10137, 220, 499, 11, 220, 13341, 3247, 220, 330, 40, 6912, 1484, 220, 12244, 34, 6934, 29095, 720, 15357, 956, 220, 3060, 220, 304, 701, 220, 30440, 220, 9601, 220, 477, 304, 420, 220, 3308, 11, 220, 2187, 720, 606, 3254, 220, 3823, 220, 8430, 220, 311, 312, 1788, 1463, 220, 279, 17836, 220, 315, 420, 720, 15335, 1285, 220, 12634, 11, 220, 369, 1102, 690, 220, 2586, 220, 13544, 220, 505, 220, 701, 220, 79723, 720, 300, 1664, 220, 439, 505, 220, 4073, 13, 220, 1102, 4250, 220, 8356, 220, 4205, 220, 719, 220, 3700, 7058, 13421, 220, 369, 499, 26, 220, 33381, 220, 66480, 11, 220, 33381, 220, 28237, 11, 220, 33381, 720, 14884, 220, 323, 220, 32937, 0, 220, 2100, 656, 539, 1095, 279, 3823, 220, 312, 1788, 1463, 720, 2181, 0, 4418, 956, 220, 1781, 220, 358, 1097, 69088, 220, 499, 11, 220, 7984, 5047, 220, 74933, 11, 220, 18396, 11, 720, 8248, 358, 8464, 220, 499, 220, 311, 7984, 5047, 220, 14539, 220, 20524, 3902, 596, 220, 28730, 13, 220, 362, 17240, 720, 14965, 220, 574, 220, 304, 279, 220, 2162, 220, 315, 279, 220, 19234, 15232, 220, 304, 872, 220, 4216, 720, 327, 69597, 11, 220, 1047, 220, 279, 14464, 220, 315, 38678, 287, 220, 5115, 220, 3629, 26, 220, 779, 2391, 720, 22404, 5047, 220, 14539, 220, 20524, 3902, 596, 220, 30226, 811, 220, 315, 279, 220, 330, 40, 6912, 1, 220, 4185, 7058, 42424, 220, 304, 872, 220, 2162, 11, 220, 1283, 3952, 220, 709, 279, 3917, 220, 323, 220, 3288, 720, 1178, 220, 311, 279, 17240, 25, 220, 330, 7184, 220, 1541, 956, 220, 38678, 220, 904, 220, 810, 1, 0, 220, 1283, 1071, 11, 720, 1, 9514, 220, 1541, 956, 220, 617, 220, 311, 38678, 220, 7389, 220, 499, 220, 1390, 220, 311, 1210, 220, 8489, 220, 279, 17240, 720, 37593, 220, 282, 31329, 220, 1578, 13, 720, 69933, 1245, 220, 53876, 11, 220, 358, 6562, 220, 311, 1520, 220, 499, 220, 2733, 220, 323, 220, 1518, 279, 312, 7058, 73009, 220, 315, 279, 1957, 220, 315, 279, 4907, 11, 220, 2949, 220, 701, 220, 1917, 11, 720, 8370, 220, 19159, 220, 1521, 220, 4787, 13, 220, 1442, 904, 220, 1732, 11, 220, 279, 220, 4647, 7058, 479, 220, 568, 477, 1364, 220, 11321, 220, 1063, 220, 8275, 220, 65858, 220, 690, 220, 2019, 25, 720, 1, 8586, 11, 220, 3009, 220, 430, 0, 220, 358, 690, 220, 539, 617, 220, 433, 1, 0, 304, 78976, 220, 3346, 220, 315, 720, 1820, 5157, 11, 220, 814, 220, 690, 220, 3009, 220, 279, 4459, 220, 1957, 13, 220, 1472, 220, 1440, 220, 994, 720, 9514, 3240, 220, 311, 2733, 220, 38678, 11, 220, 499, 220, 636, 810, 220, 323, 220, 810, 220, 38678, 13, 720, 5519, 499, 220, 1440, 11, 220, 5225, 2136, 220, 374, 264, 1455, 220, 41792, 220, 3245, 30, 720, 1687, 527, 4560, 220, 311, 20599, 220, 311, 499, 50617, 220, 387, 5225, 220, 311, 682, 4787, 11, 720, 49864, 220, 814, 220, 387, 7106, 220, 4787, 220, 323, 220, 27351, 220, 304, 720, 1820, 16335, 220, 1917, 26, 220, 477, 8996, 220, 433, 374, 430, 220, 374, 28987, 220, 499, 220, 477, 720, 22479, 220, 1917, 13, 220, 1442, 499, 220, 690, 220, 2019, 11, 220, 330, 51769, 1, 0, 220, 1314, 220, 1243, 11, 220, 499, 4984, 720, 1820, 7572, 220, 902, 220, 374, 279, 26991, 220, 2449, 220, 315, 279, 87556, 9607, 28729, 75008, 220, 58333, 220, 220, 13460, 720, 28491, 8996, 220, 433, 1253, 220, 387, 13, 1442, 433, 387, 459, 11341, 220, 439, 459, 704, 7058, 3002, 3044, 11, 220, 422, 499, 220, 690, 220, 22571, 220, 1935, 220, 3290, 220, 315, 701, 7058, 726, 323, 220, 2019, 25, 220, 330, 10903, 0, 220, 499, 220, 4985, 220, 539, 220, 3810, 220, 856, 220, 1917, 0, 220, 1472, 720, 19549, 220, 539, 220, 38323, 220, 757, 1, 0, 220, 499, 220, 690, 220, 1505, 220, 6261, 220, 304, 40841, 720, 61641, 220, 315, 701, 220, 1917, 220, 323, 220, 279, 4787, 220, 902, 220, 1765, 7058, 1067, 220, 499, 13, 720, 22404, 5047, 220, 74933, 11, 220, 1268, 220, 656, 499, 220, 23289, 220, 1226, 220, 2585, 220, 87556, 7058, 83, 919, 30, 220, 3296, 430, 220, 1633, 220, 20086, 220, 3245, 0, 220, 60842, 11, 220, 1226, 527, 3025, 720, 998, 4984, 220, 264, 33381, 220, 7572, 220, 1109, 220, 499, 220, 527, 26, 220, 719, 2103, 220, 1226, 2011, 720, 8823, 220, 499, 220, 1304, 220, 264, 7314, 26, 220, 323, 220, 279, 31373, 220, 1226, 220, 656, 11, 220, 279, 720, 447, 5327, 220, 499, 220, 527, 11060, 220, 315, 701, 220, 1917, 13, 220, 763, 279, 220, 48550, 2136, 220, 315, 720, 1820, 10919, 11, 220, 279, 7572, 220, 315, 43361, 220, 10919, 11, 220, 902, 220, 358, 1097, 3025, 220, 311, 720, 23859, 220, 311, 499, 26, 220, 422, 499, 220, 690, 220, 656, 420, 11, 220, 358, 690, 220, 7945, 220, 499, 220, 311, 264, 720, 37225, 683, 220, 323, 220, 15535, 220, 315, 66695, 220, 902, 220, 690, 220, 18454, 220, 499, 13, 720, 1687, 1781, 220, 279, 892, 220, 706, 2586, 11, 220, 994, 220, 279, 7984, 5047, 220, 20783, 720, 30115, 2940, 11, 220, 2011, 220, 2733, 220, 323, 220, 1304, 220, 14794, 220, 1115, 220, 76521, 720, 258, 872, 220, 6439, 13, 220, 2684, 220, 2744, 220, 4131, 220, 264, 892, 220, 304, 279, 9601, 220, 323, 720, 72742, 220, 315, 279, 8828, 220, 315, 1475, 220, 30440, 11, 220, 1405, 220, 1306, 220, 264, 720, 66, 7770, 220, 3392, 220, 315, 50745, 11, 220, 1855, 220, 832, 220, 374, 2163, 439, 499, 220, 3629, 720, 5098, 220, 433, 93830, 59723, 220, 813, 1866, 11, 220, 311, 19868, 220, 477, 16587, 1210, 220, 12838, 220, 430, 220, 5222, 720, 66, 2739, 301, 30, 220, 2360, 0, 220, 1226, 220, 3629, 220, 2733, 220, 279, 7290, 220, 315, 4236, 11, 220, 79422, 220, 311, 720, 6789, 872, 220, 14971, 220, 5304, 220, 5751, 220, 42871, 82, 220, 323, 220, 584, 752, 26, 220, 311, 66208, 325, 220, 5751, 720, 35767, 1331, 19682, 220, 311, 1935, 220, 872, 220, 9232, 13, 220, 8489, 11, 220, 499, 220, 1253, 220, 11203, 701, 720, 36910, 220, 5304, 220, 5751, 220, 42871, 82, 11, 220, 719, 220, 539, 220, 311, 584, 752, 26, 220, 1193, 220, 311, 92859, 720, 1729, 279, 7572, 220, 315, 701, 220, 1866, 220, 49427, 0, 720, 32148, 11, 220, 994, 220, 279, 220, 8430, 220, 4131, 220, 311, 4073, 2345, 12174, 11, 220, 422, 279, 720, 41203, 2954, 220, 34722, 220, 527, 682, 420, 11, 220, 3249, 220, 1541, 956, 220, 2435, 220, 656, 1063, 7058, 1626, 30, 220, 2435, 220, 527, 220, 3815, 220, 11510, 220, 682, 279, 220, 892, 11, 220, 719, 220, 1095, 2206, 220, 13302, 3247, 220, 330, 40, 6912, 1484, 220, 12244, 34, 6934, 29095, 720, 1864, 485, 220, 499, 11, 220, 279, 19234, 15232, 220, 1550, 220, 539, 220, 617, 220, 4073, 3820, 220, 1124, 720, 455, 323, 220, 6920, 220, 1124, 220, 2212, 0, 220, 2435, 220, 1047, 220, 311, 3881, 220, 279, 7658, 720, 2000, 872, 220, 1866, 220, 19721, 26, 220, 369, 4395, 220, 902, 220, 814, 220, 617, 11, 720, 438, 994, 220, 499, 220, 690, 220, 3881, 220, 439, 43111, 220, 439, 814, 220, 617, 26, 220, 323, 720, 9493, 220, 499, 220, 690, 220, 26122, 220, 26586, 220, 1139, 220, 701, 220, 1917, 220, 315, 682, 720, 831, 337, 819, 220, 3823, 220, 58587, 11, 220, 499, 220, 690, 220, 617, 220, 701, 220, 25320, 220, 1243, 720 ]
0xBreath/holistic-books
out that skulls from eras where children were universally breastfed rarely have small nasal apertures and conjectures that OSA may not have existed prior to the invention of artificial nipples. While the breast tissue is soft and shapes itself to the baby’ s mouth, bottle teats and pacifiers are firmer and require the mouth to adjust. Equally, the effort required for an infan t to express milk from the breast gives the muscles of the face a workout, promoting the development of good muscle tone and ensuring nasal breathing. This cannot be replicated by an artificial teat.52 Tongue-tie may also contribute to the enlar gement of the tonsil s that is so prevalent in OSA.53 The restrictive tissues can lead to mouth breathing, which increases upper airway resistance and causes inflamm ation to the back of the throa t. Swollen adenoids and tonsils further obstruct the airflow, exacerbate the need to breathe through the mouth, and contribute to abnormal oral-facial growth. T ongue-tie, left untreated, can therefore lead to SDB and OSA. A tongue-tie in a newborn shou ld be clipped to facilitate the necessary movement of the tongue during breastfeeding. I remember hearing a speaker at a sleep conference explain that sixteenth-century French midwives grew one fingernail extra long so they could use it to cut thetongue-ties of newborn babies. By today’ s standards, this may sound grotesque, but at a time when formula feeding was not an option, it may have saved the lives of those children. If you suspect that your child has a short lingual frenulum, seek advice from a healthcar e professional or myofunctional therapist trained in identifying tongue-tie. You can find a specialist in your area by visiting AomtInfo.or g. DEVELOPMENT OF POSTURE, SPEECH, AND LANGUAGE Mouth breathin g in children also has impacts on speech, auditory processing, and postural development. In a 2011 study of the effect of chronic nasal obstruction on speech in children aged between 4 and 12 years, it was found that 76.6% of children with nasal blockages suffered dysphonia—problems speaking due to anatomical disorders in the throat, mouth, tongue, or vocal cords.54 More than 68% of the children with blocked noses demonstrated vocal abuse, a behavioral condition that causes strain to the vocal cords. A 2013 paper that explored the correlation between oral breathing and speech disorders in children found that mouth breathing could affect socialization, academic perform ance, and the development of speech.55 Researchers underlined that early detection of mouth breathing is essential to reduc e or prevent its harm ful effects on development. Changes in posture, mobilit y, and muscle tone of the lips, cheeks, and tongue, when a child habitually mouth breathe s, lead to a loss of efficiency in basic functions like swallowing, chew ing, and speaking. This can encourage the development of flaccid jaw muscles, poor head posture, and speech disorders, including lisps and the inability to pronounce specific sounds. Children who mouth breathe may also have underdeveloped auditory processing. In 2014, scientists undertook a first-of-its-kind study looking at speech difficulties in children who had swollen adenoids and found a connection between adenoid hypertrophy and articulation errors during speech.56 The study compared 19 children with adenoid hypertrophy to a control group of33 children with functional articulation disorders but no physical symptoms. The mean age of the subject group was higher than that of the control group because the incidence of adenoid hypertrophy in children generally increases with age. They found that the kind of speech errors made by children with swollen adenoids were not the same as those present in children with speech disorders. Children with enlar ged adenoids were more likely to substitute one sound for anothe r and less likely to drop sounds, reflecting the fact that swollen adenoids, rather than the children’ s understanding of phonetics and language, were the cause of defects in speech. The sound “s” was particularly affected in these children. This sound requires a specific placement of the tongue, but children with swollen adenoids have reduced airway space and tend to drop their lower jaw and tongue to maximize their oral airway. As we’ve already seen, this affects the developmen t of the face and leads to poorly aligned teeth and jaws. It is also believed that enlar ged adenoids can lead to changes in voice quality. The children in the study were found to have frequent nasalization. This is consiste nt with previous research that found adenoid hypertrophy could lead to hypernasal speech, alter the resonance characteristics of the airways, and cause changes in the dimensions of the vocal tract that can manifest as roughness in the voice. Mouth breathing and SDB breathing in children has also been found to impact auditory processing—th e ability to understand speech, distinguish sounds from one another, concentrate against background noise, and enjoy music.57 Scientis ts in Brazil found that children with mouth breathing and OSA, as determined by polysomnography, displayed levels of auditory processing that were statistically significant when compared with children who had no airway problems.58 The children with OSA performed less well in tests to determine auditory processing and nonverbal sequence memory. We have already explored the impact of mouth breathing on the development of the face, jaws, and teeth. However, the problem extends further. Children with narrow or blocked airways tend to mouth breathe by default, and so they adjust the position of their head to get enough air in through their mouths. Information on the connection between mouth breathing and changes in postur e in children is limited, but one 2018 studyof children explains that problems in the positioning of the shoulders, including the shoulder blades and trapezius muscles, can occur in children who mouth breathe.59 While much research has focused on the position of the head, not looking any further down the spine, the fact is, the forward positioning of the head, which is necessary to draw air orally into the lower respiratory tract, will lead to further postu ral adaptations that can impact the whole body. Forward head posture requires the child to extend the upper cervical spine and flex the lower cervical and thoracic spine, leading to curvature in the lumbar spine. Over time, this causes muscle strain that pulls the lower jaw back, decreasing the airway even more. The 2018 study recorded a significant reduction in forward head position and poor shoulder posture after adenotonsillectomy.59 It woul d be interesting to see the results of a study that made the same comparison following upper airway development and nasal breathing training; it seems likely they would be similar and perhaps more sustainable. ADVICE T O PARENTS OF CHILDREN AND TEENAGERS It is important to monitor your child for signs of mouth breathing. Take the opportunity to observe the breathing when your child is concentrating on homework, watching TV, or sleeping. It can be helpful to monitor the breathing of younger children after they have eaten, particularly if you suspect specific foods such as dairy or wheat may be triggering overbreathing. Avoid overdressing your child, and keep your house cool and well ventilated. Enco urage your child to play outside and to breathe through their nose as much as possible during physically active play. Notice if your child maintains an open mouth posture for significant periods. If the mouth is open for 40% of the time or more, you must act. If your child’ s nose is blocked, try using the exercise to decongest the nose. (You will find this exercise in Chapter T wo.) Look at the follo wing list of questions. If your answer to any of these is “yes,” your child might be displaying the harmful ef fects of SDB:• Do you notice your child breathing through an open mouth? • Does your child wake up with tangled sheets in the morning after a night of twisting and turning during sleep? • Does your child hold his or her breath during sleep? • Does your child have a stuf fy nose on waking, or complain about his or her mouth being dry? • Do you hear your child snoring? • Does your child experience disrupted sleep? • Does your child have nightmares, wet the bed during sleep, or wake up needing to use the bathroom? • Is your child’ s breathing audible during sleep? • Is your child tired on waking, or fatigued and struggling to concentrate during the day? We have looked in detail at the many factors that lead to breathing pattern disorders. Nasal breathing not only prevents and relieves the many symptoms related to breathing pattern disorders and SDB but is also essential to the correct development of the jaws and face. The foundation of breathing reeducation for children and teenagers is restoring full-time nasal breathing with the lips closed, jaws relaxed, and tongue in the correct resting posture, both during wakefulness and sleep. As the many studies have shown, the growth of the face and airways in childhood is often directly related to the way a child breathes. Enlar ged adenoids or any other restriction of the airways causes the child to switch to mouth breathing because of the difficulty in getting enough air through the
[ 704, 430, 98712, 505, 2781, 300, 1405, 2911, 1051, 61528, 198, 21152, 561, 52223, 19029, 617, 2678, 72188, 1469, 531, 1439, 323, 87015, 1439, 430, 507, 7934, 1253, 198, 1962, 617, 25281, 4972, 311, 279, 28229, 315, 21075, 68212, 13, 6104, 279, 17659, 198, 83, 11407, 374, 8579, 323, 21483, 5196, 311, 279, 8945, 529, 274, 11013, 11, 16893, 1028, 1900, 323, 23744, 12099, 198, 548, 35092, 1195, 323, 1397, 279, 11013, 311, 7652, 13, 11964, 750, 1174, 279, 5149, 2631, 369, 198, 276, 4225, 276, 259, 311, 3237, 14403, 505, 279, 17659, 6835, 279, 24569, 315, 279, 3663, 264, 198, 1816, 412, 11, 22923, 279, 4500, 315, 1695, 16124, 16630, 323, 23391, 198, 46523, 278, 27027, 13, 1115, 4250, 387, 72480, 555, 459, 21075, 1028, 266, 13, 4103, 198, 51, 647, 361, 2442, 648, 1253, 1101, 17210, 311, 279, 665, 14115, 342, 1133, 315, 279, 20181, 321, 274, 430, 374, 198, 708, 46941, 304, 507, 7934, 13, 4331, 578, 58096, 39881, 649, 3063, 311, 11013, 27027, 345, 8370, 12992, 8582, 3805, 3195, 13957, 323, 11384, 26288, 520, 290, 311, 279, 198, 1445, 315, 279, 60187, 64, 259, 13, 4593, 33389, 100213, 17390, 323, 20181, 8839, 4726, 54292, 220, 279, 74120, 13801, 327, 51919, 349, 279, 1205, 311, 37397, 1555, 279, 11013, 11, 323, 17210, 311, 198, 370, 8416, 21308, 2269, 33211, 6650, 13, 350, 389, 38768, 2442, 648, 11, 2163, 83920, 11, 649, 9093, 3063, 311, 198, 50, 3590, 323, 507, 7934, 627, 32, 25466, 2442, 648, 304, 264, 46397, 559, 283, 27221, 387, 74159, 311, 28696, 279, 5995, 198, 62274, 315, 279, 25466, 2391, 65864, 13, 358, 6227, 220, 11011, 264, 198, 65576, 520, 264, 6212, 10017, 10552, 430, 4848, 46487, 34457, 8753, 198, 16497, 59488, 14264, 832, 39827, 944, 607, 5066, 1317, 779, 814, 1436, 1005, 433, 311, 4018, 279, 83, 647, 361, 2442, 552, 315, 46397, 24869, 662, 3296, 3432, 529, 274, 10886, 11, 420, 1253, 5222, 198, 42511, 2392, 593, 11, 719, 520, 264, 892, 994, 15150, 26040, 574, 539, 459, 3072, 11, 433, 1253, 198, 19553, 6924, 279, 6439, 315, 1884, 2911, 627, 2746, 499, 15562, 430, 701, 1716, 706, 264, 2875, 38172, 940, 47934, 16903, 11, 6056, 9650, 198, 1527, 264, 2890, 7063, 384, 6721, 477, 856, 1073, 600, 278, 42863, 16572, 304, 198, 1748, 7922, 25466, 2442, 648, 13, 1472, 649, 1505, 264, 24687, 304, 701, 3158, 555, 17136, 198, 32, 316, 83, 1767, 25268, 342, 627, 1170, 48882, 55759, 3083, 13165, 4622, 11, 68835, 93133, 11, 3651, 198, 82498, 198, 44, 2969, 11745, 258, 342, 304, 2911, 1101, 706, 25949, 389, 8982, 11, 83629, 198, 21315, 11, 323, 1772, 4269, 4500, 13, 763, 264, 220, 679, 16, 4007, 315, 279, 2515, 315, 198, 7562, 292, 72188, 61051, 389, 8982, 304, 2911, 20330, 1990, 220, 19, 323, 220, 717, 198, 42820, 11, 433, 574, 1766, 430, 220, 4767, 13, 21, 4, 315, 2911, 449, 72188, 2565, 1154, 16654, 198, 67, 1065, 764, 21947, 2345, 96440, 12365, 4245, 311, 75893, 950, 24673, 304, 279, 28691, 345, 33780, 11, 25466, 11, 477, 26480, 80717, 13, 4370, 4497, 1109, 220, 2614, 4, 315, 279, 2911, 449, 198, 62448, 97814, 21091, 26480, 11737, 11, 264, 36695, 3044, 430, 11384, 198, 78726, 311, 279, 26480, 80717, 627, 32, 220, 679, 18, 5684, 430, 36131, 279, 26670, 1990, 21308, 27027, 323, 198, 89325, 24673, 304, 2911, 1766, 430, 11013, 27027, 1436, 7958, 198, 23191, 2065, 11, 14584, 2804, 44260, 11, 323, 279, 4500, 315, 8982, 13, 2131, 198, 60210, 1234, 15472, 430, 4216, 18468, 315, 11013, 27027, 374, 7718, 198, 998, 3679, 66, 384, 477, 5471, 1202, 11682, 5716, 6372, 389, 4500, 13, 29240, 304, 198, 2252, 554, 11, 12881, 3748, 379, 11, 323, 16124, 16630, 315, 279, 23726, 11, 54888, 11, 323, 25466, 11, 994, 264, 198, 3124, 14464, 1870, 11013, 37397, 274, 11, 3063, 311, 264, 4814, 315, 15374, 304, 6913, 198, 22124, 1093, 91747, 11, 37433, 6892, 11, 323, 12365, 13, 1115, 649, 15253, 279, 198, 30671, 315, 1344, 4575, 307, 16942, 24569, 11, 8009, 2010, 48378, 11, 323, 8982, 198, 4338, 8076, 11, 2737, 41380, 1725, 323, 279, 38550, 311, 89082, 3230, 10578, 627, 11800, 889, 11013, 37397, 1253, 1101, 617, 1234, 16219, 291, 83629, 198, 21315, 627, 644, 220, 679, 19, 11, 14248, 19165, 1982, 264, 1176, 8838, 12, 1220, 60806, 4007, 3411, 520, 8982, 198, 13798, 3951, 552, 304, 2911, 889, 1047, 76193, 100213, 17390, 323, 1766, 264, 3717, 198, 42967, 100213, 590, 220, 48855, 58175, 323, 28664, 2987, 6103, 2391, 8982, 13, 3487, 578, 198, 56065, 7863, 220, 777, 2911, 449, 100213, 590, 48855, 58175, 311, 264, 2585, 1912, 315, 1644, 2911, 449, 16003, 28664, 2987, 24673, 719, 912, 7106, 198, 24738, 52273, 13, 578, 3152, 4325, 315, 279, 3917, 1912, 574, 5190, 1109, 430, 315, 279, 198, 2935, 1912, 1606, 279, 39775, 315, 100213, 590, 48855, 58175, 304, 2911, 198, 7642, 750, 12992, 449, 4325, 627, 7009, 1766, 430, 279, 3169, 315, 8982, 6103, 1903, 555, 2911, 449, 198, 2332, 33389, 100213, 17390, 1051, 539, 279, 1890, 439, 1884, 3118, 304, 2911, 449, 198, 89325, 24673, 13, 15394, 449, 665, 14115, 53293, 100213, 17390, 1051, 810, 4461, 311, 198, 2008, 7815, 832, 5222, 369, 39124, 1820, 436, 323, 2753, 4461, 311, 6068, 10578, 11, 42852, 198, 1820, 2144, 430, 76193, 100213, 17390, 11, 4856, 1109, 279, 2911, 529, 274, 8830, 315, 198, 52801, 25265, 323, 4221, 11, 1051, 279, 5353, 315, 42655, 304, 8982, 13, 578, 5222, 1054, 82, 89874, 16514, 8104, 11754, 304, 1521, 2911, 13, 1115, 5222, 7612, 264, 3230, 198, 16491, 315, 279, 25466, 11, 719, 2911, 449, 76193, 100213, 17390, 617, 11293, 198, 1334, 3195, 3634, 323, 8541, 311, 6068, 872, 4827, 16942, 323, 25466, 311, 35608, 872, 198, 10020, 3805, 3195, 13, 1666, 584, 4070, 2736, 3970, 11, 420, 22223, 279, 2274, 5794, 259, 315, 279, 3663, 198, 438, 11767, 311, 31555, 27210, 18311, 323, 82356, 627, 2181, 374, 1101, 11846, 430, 665, 14115, 53293, 100213, 17390, 649, 3063, 311, 4442, 304, 7899, 198, 10692, 662, 578, 2911, 304, 279, 4007, 1051, 1766, 311, 617, 21420, 72188, 2065, 627, 2028, 374, 6824, 68, 32512, 449, 3766, 3495, 430, 1766, 100213, 590, 48855, 58175, 198, 29177, 3063, 311, 17508, 46523, 278, 8982, 11, 11857, 279, 58081, 17910, 315, 279, 198, 1334, 2336, 11, 323, 5353, 4442, 304, 279, 15696, 315, 279, 26480, 42929, 430, 649, 198, 43415, 439, 11413, 2136, 304, 279, 7899, 627, 44, 2969, 27027, 220, 323, 328, 3590, 27027, 304, 2911, 706, 1101, 1027, 1766, 311, 198, 58400, 83629, 220, 8863, 2345, 339, 384, 5845, 311, 3619, 8982, 11, 33137, 198, 71631, 505, 832, 2500, 1174, 37455, 2403, 4092, 12248, 11, 323, 4774, 198, 32261, 13, 3226, 21302, 285, 10814, 304, 16327, 1766, 430, 2911, 449, 11013, 27027, 323, 198, 3204, 32, 11, 439, 11075, 555, 99919, 316, 77, 5814, 1174, 12882, 5990, 315, 83629, 198, 21315, 430, 1051, 47952, 5199, 994, 7863, 449, 2911, 198, 14965, 1047, 912, 3805, 3195, 5435, 13, 2970, 578, 2911, 449, 507, 7934, 10887, 2753, 1664, 198, 258, 7177, 311, 8417, 83629, 8863, 323, 2536, 424, 13616, 8668, 5044, 16853, 1687, 617, 2736, 36131, 279, 5536, 315, 11013, 27027, 389, 279, 198, 30671, 315, 279, 3663, 11, 82356, 11, 323, 18311, 13, 4452, 1174, 279, 3575, 2289, 198, 69, 4004, 662, 15394, 220, 449, 15376, 477, 19857, 3805, 2336, 8541, 311, 11013, 37397, 555, 198, 2309, 11, 323, 779, 814, 7652, 279, 2361, 315, 872, 2010, 311, 636, 3403, 3805, 304, 198, 20322, 872, 65609, 13, 8245, 389, 279, 3717, 1990, 11013, 198, 21152, 44661, 323, 4442, 304, 1772, 324, 384, 304, 2911, 374, 7347, 11, 719, 832, 220, 679, 23, 4007, 1073, 2911, 15100, 430, 5435, 304, 279, 39825, 315, 279, 28004, 345, 16564, 279, 17308, 42742, 323, 490, 2070, 8510, 355, 24569, 11, 649, 12446, 304, 2911, 198, 14965, 11013, 37397, 13, 2946, 198, 8142, 1790, 3495, 706, 10968, 389, 279, 2361, 315, 279, 2010, 11, 539, 198, 20986, 904, 4726, 1523, 279, 35776, 11, 279, 2144, 374, 11, 279, 4741, 39825, 315, 198, 1820, 2010, 1174, 902, 220, 374, 5995, 311, 4128, 3805, 98122, 1139, 279, 4827, 42631, 198, 2193, 11, 690, 3063, 311, 4726, 1772, 84, 436, 278, 77765, 430, 649, 5536, 279, 4459, 198, 2664, 662, 22952, 2010, 48378, 7612, 279, 1716, 311, 13334, 279, 8582, 67827, 198, 2203, 483, 323, 5882, 279, 4827, 67827, 323, 73833, 94257, 35776, 11, 6522, 311, 83233, 304, 198, 1820, 41263, 2308, 35776, 13, 6193, 892, 11, 420, 11384, 16124, 26800, 430, 34145, 279, 4827, 198, 75092, 1203, 11, 44649, 279, 3805, 3195, 1524, 810, 627, 791, 220, 679, 23, 4007, 12715, 264, 5199, 14278, 304, 4741, 2010, 198, 3571, 323, 8009, 17308, 48378, 1306, 100213, 354, 2439, 321, 772, 5650, 662, 2946, 1102, 289, 11206, 294, 387, 198, 88657, 311, 1518, 279, 3135, 315, 264, 4007, 430, 1903, 279, 1890, 12593, 198, 44018, 8582, 220, 3805, 3195, 4500, 323, 72188, 27027, 4967, 26, 433, 5084, 198, 14617, 814, 1053, 387, 4528, 323, 8530, 810, 22556, 627, 1846, 8688, 350, 507, 393, 29255, 50, 3083, 73620, 41992, 3651, 198, 2505, 965, 1929, 4419, 198, 2181, 374, 3062, 311, 8891, 701, 1716, 369, 12195, 315, 11013, 27027, 13, 12040, 279, 198, 454, 68164, 311, 23846, 279, 27027, 994, 701, 1716, 374, 76387, 389, 198, 35940, 2504, 11, 10307, 6007, 11, 477, 21811, 13, 1102, 649, 387, 11190, 311, 8891, 279, 198, 21152, 44661, 315, 14992, 2911, 1306, 814, 617, 35661, 11, 8104, 422, 499, 198, 86521, 1002, 3230, 220, 15657, 1778, 439, 34479, 477, 34153, 1253, 387, 52605, 198, 2017, 21152, 44661, 627, 53216, 40552, 57881, 701, 1716, 11, 323, 2567, 701, 3838, 7155, 323, 1664, 198, 688, 93583, 13, 2998, 1030, 4433, 425, 701, 1716, 311, 1514, 4994, 323, 311, 37397, 1555, 198, 50828, 19689, 439, 1790, 439, 3284, 2391, 22655, 4642, 1514, 13, 25773, 422, 701, 198, 3124, 33095, 459, 1825, 11013, 48378, 369, 5199, 18852, 13, 1442, 279, 11013, 198, 285, 1825, 369, 220, 1272, 4, 315, 279, 892, 477, 810, 11, 499, 2011, 1180, 13, 1442, 701, 1716, 529, 274, 19689, 374, 198, 62448, 11, 1456, 1701, 279, 10368, 311, 409, 444, 7114, 279, 19689, 13, 320, 2675, 690, 1505, 420, 198, 64562, 304, 15957, 350, 24670, 29275, 10596, 520, 279, 9630, 385, 20611, 1160, 315, 4860, 13, 1442, 701, 4320, 311, 904, 315, 1521, 374, 198, 2118, 9891, 2476, 701, 1716, 2643, 387, 29040, 279, 28856, 31469, 282, 115192, 315, 328, 3590, 25, 6806, 3234, 499, 5406, 701, 1716, 27027, 1555, 459, 1825, 11013, 5380, 6806, 12838, 701, 1716, 15508, 709, 449, 93941, 25112, 304, 279, 6693, 1306, 264, 3814, 315, 80654, 198, 438, 13353, 2391, 6212, 5380, 6806, 12838, 701, 1716, 3412, 813, 477, 1077, 11745, 2391, 6212, 5380, 6806, 12838, 701, 1716, 617, 264, 357, 1739, 53041, 19689, 389, 48728, 11, 477, 29011, 922, 813, 477, 1077, 11013, 198, 35214, 9235, 5380, 6806, 3234, 499, 6865, 701, 1716, 4224, 5620, 5380, 6806, 12838, 701, 1716, 3217, 69627, 6212, 5380, 6806, 12838, 701, 1716, 617, 75362, 11, 14739, 279, 4950, 2391, 6212, 11, 477, 15508, 709, 33921, 311, 198, 817, 279, 15197, 5380, 6806, 2209, 701, 1716, 529, 274, 27027, 80415, 2391, 6212, 5380, 6806, 2209, 701, 1716, 19781, 389, 48728, 11, 477, 8834, 343, 3340, 323, 20558, 311, 37455, 2391, 279, 198, 1316, 5380, 1687, 617, 7111, 304, 7872, 520, 279, 1690, 9547, 430, 3063, 311, 27027, 198, 14676, 24673, 662, 39322, 278, 27027, 539, 1193, 29034, 323, 1375, 39235, 279, 1690, 198, 24738, 52273, 5552, 311, 27027, 5497, 24673, 323, 328, 3590, 719, 374, 1101, 198, 49582, 311, 279, 4495, 4500, 315, 279, 82356, 323, 3663, 13, 578, 16665, 315, 198, 21152, 44661, 312, 37838, 369, 2911, 323, 37719, 374, 50203, 2539, 7394, 72188, 198, 21152, 44661, 449, 279, 23726, 8036, 11, 82356, 31467, 11, 323, 25466, 304, 279, 4495, 198, 4014, 287, 48378, 11, 2225, 2391, 15508, 31514, 323, 6212, 627, 2170, 279, 1690, 7978, 617, 6982, 11, 279, 6650, 315, 279, 3663, 323, 3805, 2336, 304, 198, 3124, 5812, 374, 3629, 6089, 5552, 311, 279, 1648, 264, 1716, 11745, 288, 13, 2998, 14115, 53293, 198, 21825, 17390, 477, 904, 1023, 20020, 220, 315, 279, 3805, 2336, 11384, 279, 1716, 311, 3480, 311, 198, 33780, 27027, 1606, 315, 279, 17250, 304, 3794, 3403, 3805, 1555, 279, 198 ]
0xBreath/holistic-books
And as a result, you will know joy. This process will bring far greater results than merely the pleasures of a lighter, healthier body. You will know the deep satisfaction of being in char ge of your own life. The subtlest changes in your thought-forms can radically transform the chemistry in your brain. While worldly voices might ar gue that only behavioral change produces “real change”—while spiritual change is hardly more than child’ s play—science itself is catching up to the most ancient wisdom regarding the powers of spirituality. The most prestigious academic institutions have conducted studies proving that those who are prayed for get out of intensive care units faster, that those who attend spiritual support groups survive longer after the diagnosis of a life-challenging illness, and so forth. Spirituality is more than simply an adjunct to what it really takes to lose weight. If you are serious about wanting the power of spiritual forces to aid you in your weight loss, to provide at the very least your “second engine” to liftyou miraculously above the forces of addiction and compulsion, then you must meet those forces with more than casual deference. Y ou wouldn’ t want a worldly doctor to rush through his or her appointment with you; similarly, the Divine Physician needs you to spend a little more time at your appointments with Him. Just as you wash your body daily, you need to purify your heart daily as well. When you neglect to pray and meditate on a regular basis—which means a daily basis—you leave your psychic door unlocked, and the thief will come in. Any day consciously and willingly given to God, praying that His guidance be with you and that you might be a conduit of love throughout the day, is a day when you are buf fered from the otherwise active power of your fear -mind. Your addictive impulses will be alert to the slightest for getfulness on your part, and they will take advantage of the slightest opening (“I don’ t have time to pray and meditate today,” “I don’ t need to reflect deeply on my behavior here; I know what I’m doing!” “I’m angry for a good reason; this is not about for giveness!”) to rush back in with full-gale negative force. The purpose of this lesson is (l) to establish the importance of “Spirit- time”—time taken every day to align your worldly self with your spiritual self, and (2) to help you establish this time as part of your daily routine. The most powerful aid to this is the practice of meditation. True meditation is not mere relaxation, for it involves an actual shift in consciousness. There are many dif ferent paths: Christian, Buddhist, Jewish, or other religious meditations; the W orkbook of A Course in Miracles; Transcendental, V edic, or V ipassana Meditation; and more. A serious meditation practice is one of the most powerful ways to disconnect from your fear -mind and its fearful dictates. Too much attention to the earth plane creates undue stress on the body. Meditation frees the mind from its attachment to the body, thus freeing the body to right itself. As you set your mind free of physical attachments for a period of time each day, you improve your relationship to the physical world. Some people claim they don’ t have time to meditate. But meditation slows down time. And in slowing down time, you slow down and rebalance your nervous system. Stress leads to frenetic ener gy, and frenetic ener gyleads to impulsive behavior. Meditation, by reducing stress, brings calm to both your body and your mind. Meditation is like a sealant, protecting your devotional ener gy so the light cannot slip out and the darkness cannot slip in. Emotionally, you will be lifted higher and higher, gaining a more and more consistent sense of joy. With that, the gravitational lure of self-destructive ur ges will decrease and ultimately cease. But meditation is more than lighting a candle and breathing deeply; it is more than walking through the woods or speaking a beautiful intention. I’ve heard many people say, “I do meditate. I meditate by journaling, by reading inspirational literature, by spending quiet time alone.” All those things are good—indeed, they’ve been recommended as a part of this course. But they are relaxation, inspiration, and contemplation; they are not of themselves meditation. Meditation is something deeper, something that actually changes your brain waves. And for that you need a serious meditation practice. There is a meditation path that will work for you, and you might even know what it is already. Whether or not you will avail yourself of this medicine of the gods is completely up to you. Just remember that meditation is so powerful that the fear -mind will tell you anything to make you believe it isn’ t powerful, or it isn’ t for you, or you just don’ t have time to do it. “I don’ t know how to meditate.” (But you could learn.) “I tried meditation, but I couldn’ t stick with it.” (Change “couldn’ t” to “didn’ t.”) It is your choice, of course, which voice in your head to listen to, which voice to believe, and most important of all, which voice to act on. If you have a meditation practice, then nothing could be more important to transforming your relationship to food than that you do it. And if you do not have a meditation practice but pray to be shown one, then books or flyers that lead to one that is best for you will begin to fall at your feet. Addiction is a spiritual disease; prayer and meditation boost the spiritual immune system. Y ou are not fighting the disease; you are simply opening your mind to so much truth that the diseased condition cannot dwell there. Every time you embrace a truth, you dismantle a lie. Y our goal is for the light to seep into the deepest recesses of your subconscious, erasing old patterns and releasing your mind to new ones.Overeating is an act of hysteria, and meditation is the most powerful antidote to hysteria. Hysteria occurs when you lose your conscious connection with the naturally ordered universe, and in that traumatic moment try to absorb the shock of cosmic disorder by grabbing for a bite- size piece of comfort. Enough has been said of your separation from love; our focus now is on your return to it. You have had moments, surely, when love has prevailed and you were not tormented by your compulsion. Y ou have had moments when you sailed through your kitchen and felt no insane need to eat inappropriately. The problem is that the insanity has always returned, sometimes when you would least expect it. V arious ef forts have given you temporary surcease from the overwhelming compulsion to reenact your pattern, but none have totally stopped the pattern. Only the hand of God can do that. Thus, this entire situation is an invitation to discipleship. It’ s time to give Him all of your time and all of your days and all of your thoughts. Y our mind is holy, yet you must stand on that knowledge. Y ou must actively embrace the truth in order to receive its blessing. For any moment not given to love will be used by fear as a breeding ground for its own purposes. Choose love, so fear will no longer be able to choose you. Discipleship is a sacred marriage. Only the arms of God can truly hold you and keep you and protect you from all harm. Once you’ve experienced the embrace of your Divine Beloved, perhaps you will choose to commit to Him. Y ou will promise to cleave to Him and “forsake all others.” Having made this holy commitment, you will break of f your relationship with the tyrant of compulsion that has masqueraded as your lover. And that is what discipleship is: a total commitment that leaves no room for anything else. Discipleship is much, much more than a sometimes thing; it’ s an ef fort to totally immerse yourself in the light of love. And this will do more than just transform your eating. It will transform your entire life. Take anything that symbolizes the meditation path that calls to you— from the phone number of a meditation teacher you have heard about but not yet called, to the W orkbook of A Course in Miracles, to a set of prayer beads—and place it on your altar for consecration to the divine. Reflection and PrayerClose your eyes and relax into your sacred place. See yourself in your inner temple, a beautiful and holy room. See yourself lying in the center of it, on a lar ge white slab. The slab looks like cold marble—but when you lie down, it feels like warm, soft pillows. Now see the Divine Physician standing above you with His hands over your body. The Divine being is drawing from your body all the ener gy that does not belong there, both physical and nonphysical. Breathe deeply into this image and allow it to be real for you. Such imagery is no idle fantasy. Spirit is always present, not just metaphorically but literally. Now continue with an exercise from A Course in Miracles. With your eyes closed, say slowly to yourself, “Into His presence would I enter now.” Repeat the sentence over and over to yourself as you fall more and more deeply into a
[ 1628, 439, 264, 1121, 345, 9514, 690, 1440, 16267, 662, 1115, 1920, 690, 4546, 3117, 7191, 3135, 1109, 16632, 198, 1820, 72974, 315, 264, 30673, 1174, 39345, 2547, 662, 1472, 690, 1440, 279, 5655, 198, 82, 52370, 315, 1694, 304, 1181, 3980, 315, 701, 1866, 2324, 627, 791, 27545, 267, 4442, 304, 701, 3463, 8627, 82, 649, 61127, 5276, 279, 198, 52755, 304, 701, 8271, 13, 6104, 97706, 24196, 2643, 802, 342, 361, 430, 1193, 198, 56966, 278, 2349, 19159, 1054, 8110, 2349, 63750, 3556, 18330, 2349, 374, 20781, 198, 6518, 1109, 1716, 529, 274, 1514, 2345, 40657, 5196, 374, 34168, 709, 311, 279, 1455, 14154, 198, 49143, 5717, 9002, 279, 13736, 315, 75456, 662, 578, 1455, 41385, 14584, 198, 258, 93778, 617, 13375, 7978, 39858, 430, 1884, 889, 527, 67797, 369, 198, 456, 704, 315, 37295, 2512, 8316, 10819, 1174, 430, 1884, 889, 9604, 18330, 1862, 198, 17171, 18167, 5129, 1306, 279, 23842, 315, 264, 2324, 11843, 34869, 287, 17563, 11, 323, 198, 708, 13544, 13, 17326, 10965, 374, 810, 1109, 5042, 459, 90695, 311, 1148, 433, 2216, 220, 5097, 198, 998, 9229, 4785, 627, 2746, 499, 527, 6129, 922, 19762, 279, 2410, 315, 18330, 8603, 311, 12576, 499, 198, 258, 701, 4785, 4814, 11, 311, 3493, 520, 279, 1633, 3325, 701, 1054, 5686, 4817, 863, 311, 10345, 1919, 283, 66066, 38662, 3485, 279, 8603, 315, 27471, 323, 1391, 34003, 11, 1243, 499, 198, 25849, 3449, 1884, 8603, 449, 810, 1109, 16736, 18440, 768, 13, 816, 6033, 8434, 529, 259, 198, 53757, 264, 97706, 10896, 311, 13270, 1555, 813, 477, 1077, 18101, 449, 499, 280, 65387, 398, 1174, 279, 43361, 88298, 3966, 499, 311, 8493, 264, 2697, 810, 892, 520, 701, 198, 11933, 1392, 449, 21058, 627, 10156, 439, 499, 11623, 701, 2547, 7446, 1174, 499, 1205, 311, 4087, 1463, 701, 4851, 7446, 439, 198, 9336, 13, 3277, 499, 39332, 311, 24739, 323, 1812, 20227, 389, 264, 5912, 8197, 50004, 198, 47321, 264, 7446, 8197, 71480, 5387, 701, 50217, 6134, 36718, 11, 323, 279, 58835, 198, 14724, 2586, 304, 13, 5884, 1938, 70903, 323, 73652, 2728, 311, 4359, 11, 52232, 430, 198, 16366, 19351, 387, 449, 499, 323, 430, 499, 2643, 387, 264, 77635, 315, 3021, 198, 20322, 412, 279, 1938, 1174, 374, 264, 1938, 994, 499, 527, 6745, 282, 12616, 505, 279, 6062, 198, 3104, 2410, 315, 701, 8850, 482, 38824, 627, 7927, 57407, 87633, 690, 387, 5225, 311, 279, 60147, 369, 636, 31514, 389, 198, 22479, 961, 11, 323, 814, 690, 1935, 9610, 315, 279, 60147, 8736, 27179, 40, 1541, 529, 259, 198, 19553, 892, 311, 24739, 323, 1812, 20227, 3432, 1174, 863, 1054, 40, 1541, 529, 259, 1205, 311, 8881, 17693, 389, 856, 198, 56966, 1618, 26, 358, 1440, 1148, 358, 4344, 3815, 18319, 1054, 40, 4344, 19021, 369, 264, 1695, 2944, 26, 420, 198, 285, 539, 922, 369, 2728, 434, 18319, 8, 311, 13270, 1203, 304, 449, 2539, 2427, 1604, 8389, 5457, 627, 791, 7580, 315, 420, 18228, 374, 320, 75, 8, 311, 5813, 279, 12939, 315, 1054, 87475, 7058, 1712, 63750, 1712, 4529, 1475, 1938, 311, 5398, 701, 97706, 659, 449, 701, 18330, 198, 726, 11, 323, 320, 17, 8, 311, 1520, 499, 5813, 420, 892, 439, 961, 315, 701, 7446, 14348, 13, 578, 198, 3646, 8147, 12576, 311, 420, 374, 279, 6725, 315, 33862, 627, 2575, 33862, 374, 539, 17983, 43685, 11, 369, 433, 18065, 459, 5150, 6541, 304, 198, 64589, 2136, 13, 2684, 527, 1690, 1422, 18728, 306, 13006, 25, 9052, 11, 47841, 11, 13653, 345, 269, 1023, 10597, 1812, 31767, 26, 279, 468, 477, 74, 2239, 315, 362, 17026, 304, 14603, 18709, 280, 3246, 66, 408, 6430, 11, 650, 1608, 292, 11, 477, 650, 6125, 395, 3444, 77571, 26, 323, 810, 13, 362, 6129, 198, 2106, 7709, 6725, 374, 832, 315, 279, 1455, 8147, 5627, 311, 30069, 505, 198, 22479, 8850, 482, 38824, 323, 1202, 63757, 80330, 627, 32346, 1790, 6666, 311, 279, 9578, 11277, 11705, 91642, 8631, 389, 279, 2547, 16853, 44, 3671, 367, 72555, 279, 4059, 505, 1202, 20581, 311, 279, 2547, 1174, 8617, 67817, 279, 198, 2664, 311, 1314, 5196, 13, 1666, 499, 743, 701, 4059, 1949, 315, 7106, 34779, 369, 264, 198, 19862, 315, 892, 1855, 1938, 1174, 499, 7417, 701, 5133, 311, 279, 7106, 198, 14957, 627, 8538, 1274, 3802, 814, 1541, 529, 259, 617, 892, 311, 1812, 20227, 13, 2030, 33862, 198, 3306, 4336, 1523, 892, 13, 220, 1628, 304, 48408, 1523, 892, 11, 499, 6435, 1523, 323, 12646, 5085, 198, 22479, 23418, 1887, 13, 51568, 11767, 311, 47934, 5411, 38556, 29720, 11, 323, 47934, 5411, 38556, 342, 982, 7819, 311, 3242, 58921, 7865, 662, 77571, 11, 555, 18189, 8631, 11, 12716, 19858, 311, 198, 21704, 701, 2547, 323, 701, 4059, 627, 44, 3671, 367, 374, 1093, 264, 26418, 519, 11, 22973, 701, 3567, 41964, 38556, 29720, 779, 279, 3177, 198, 34360, 21818, 704, 323, 279, 27394, 4250, 21818, 304, 13, 5867, 6082, 750, 1174, 499, 690, 387, 198, 36069, 291, 5190, 323, 5190, 1174, 30240, 264, 810, 323, 810, 13263, 5647, 315, 16267, 16853, 2409, 430, 11, 279, 71019, 57683, 315, 659, 97322, 535, 4433, 14748, 690, 18979, 323, 198, 495, 7253, 32616, 627, 4071, 33862, 374, 810, 1109, 18186, 264, 38899, 323, 27027, 17693, 26, 433, 374, 198, 6518, 1109, 11689, 1555, 279, 33633, 477, 12365, 264, 6366, 14944, 13, 358, 4070, 198, 55603, 1690, 1274, 2019, 1174, 1054, 40, 656, 1812, 20227, 13, 358, 1812, 20227, 555, 8486, 287, 11, 555, 5403, 198, 1354, 5682, 1697, 17649, 11, 555, 10374, 11594, 892, 7636, 2029, 2052, 1884, 2574, 527, 198, 19045, 2345, 28074, 291, 11, 814, 4070, 1027, 11349, 439, 264, 961, 315, 420, 3388, 13, 2030, 814, 198, 548, 43685, 11, 20343, 11, 323, 39471, 367, 26, 814, 527, 539, 315, 5694, 198, 2106, 7709, 13, 77571, 374, 2555, 19662, 1174, 2555, 430, 3604, 198, 19926, 701, 8271, 17301, 13, 1628, 369, 430, 499, 1205, 264, 6129, 33862, 198, 60621, 627, 3947, 374, 264, 33862, 1853, 430, 690, 990, 369, 499, 11, 323, 499, 2643, 1524, 198, 33134, 1148, 433, 374, 2736, 662, 13440, 477, 539, 499, 690, 39011, 6261, 315, 420, 198, 83543, 315, 279, 29913, 374, 6724, 709, 311, 499, 627, 10156, 6227, 430, 33862, 374, 779, 8147, 430, 279, 8850, 482, 38824, 690, 3371, 198, 9514, 4205, 311, 1304, 499, 4510, 433, 4536, 529, 259, 8147, 11, 477, 433, 4536, 529, 259, 369, 499, 11, 477, 198, 9514, 1120, 1541, 529, 259, 617, 892, 311, 656, 433, 13, 1054, 40, 1541, 529, 259, 1440, 1268, 311, 1812, 20227, 2029, 320, 4071, 499, 198, 29177, 4048, 6266, 1054, 40, 6818, 33862, 11, 719, 358, 7846, 529, 259, 9396, 449, 433, 2029, 320, 4164, 198, 2118, 92062, 529, 259, 863, 311, 1054, 97849, 529, 259, 2029, 8, 1102, 374, 701, 5873, 11, 315, 3388, 11, 902, 7899, 304, 701, 198, 2025, 311, 9020, 311, 11, 902, 7899, 311, 4510, 11, 323, 1455, 3062, 315, 682, 11, 902, 198, 10063, 311, 1180, 389, 627, 2746, 499, 617, 264, 33862, 6725, 11, 1243, 4400, 1436, 387, 810, 3062, 198, 998, 46890, 701, 5133, 311, 3691, 1109, 430, 499, 656, 433, 13, 1628, 422, 499, 656, 198, 1962, 617, 264, 33862, 6725, 719, 24739, 311, 387, 6982, 832, 11, 1243, 6603, 477, 198, 22374, 388, 430, 3063, 311, 832, 430, 374, 1888, 369, 499, 690, 3240, 311, 4498, 520, 701, 7693, 627, 2261, 2538, 374, 264, 18330, 8624, 26, 23788, 323, 33862, 7916, 279, 18330, 198, 70155, 1887, 13, 816, 6033, 527, 539, 11039, 279, 8624, 26, 499, 527, 5042, 8736, 198, 22479, 4059, 311, 779, 1790, 8206, 430, 279, 6759, 1503, 3044, 4250, 44935, 1070, 627, 11769, 892, 499, 27830, 264, 8206, 11, 499, 95158, 264, 10457, 13, 816, 1057, 5915, 374, 369, 279, 198, 4238, 311, 513, 752, 1139, 279, 51621, 47862, 288, 315, 701, 84951, 11, 2781, 4522, 2362, 198, 27061, 323, 28965, 701, 4059, 311, 502, 6305, 13, 1959, 91955, 374, 459, 1180, 315, 98766, 11, 323, 33862, 374, 279, 1455, 8147, 198, 519, 307, 1295, 311, 98766, 13, 473, 22604, 689, 13980, 994, 499, 9229, 701, 17371, 198, 7898, 449, 279, 18182, 11713, 15861, 11, 323, 304, 430, 54286, 198, 29699, 1456, 311, 35406, 279, 10988, 315, 55801, 19823, 555, 50030, 369, 264, 23556, 7058, 2190, 6710, 315, 6981, 13, 62692, 706, 1027, 1071, 315, 701, 25768, 505, 3021, 280, 414, 5357, 1457, 374, 389, 701, 471, 311, 433, 627, 2675, 617, 1047, 14269, 11, 22225, 1174, 994, 3021, 706, 85814, 323, 499, 1051, 198, 1962, 5801, 28078, 555, 701, 1391, 34003, 13, 816, 6033, 617, 1047, 14269, 994, 499, 76844, 198, 20322, 701, 9979, 323, 6612, 912, 35118, 1205, 311, 8343, 304, 76571, 2718, 662, 578, 198, 35686, 374, 430, 279, 73153, 706, 2744, 6052, 11, 7170, 994, 499, 198, 41450, 3325, 1755, 433, 13, 650, 264, 84718, 31469, 75652, 617, 2728, 499, 13643, 1765, 346, 521, 198, 1527, 279, 22798, 1391, 34003, 311, 312, 268, 533, 701, 5497, 11, 719, 7000, 617, 198, 28879, 750, 10717, 220, 279, 5497, 13, 8442, 279, 1450, 315, 4359, 649, 656, 430, 627, 45600, 11, 420, 4553, 6671, 374, 459, 29788, 311, 49260, 2200, 13, 1102, 529, 274, 892, 311, 3041, 198, 39, 318, 682, 315, 701, 892, 323, 682, 315, 701, 2919, 323, 682, 315, 701, 11555, 13, 816, 1057, 198, 38824, 374, 27823, 1174, 3686, 499, 2011, 2559, 389, 430, 6677, 13, 816, 6033, 2011, 22815, 198, 336, 32337, 279, 8206, 304, 2015, 311, 5371, 1202, 40149, 13, 1789, 904, 4545, 539, 2728, 198, 998, 3021, 690, 387, 1511, 555, 8850, 439, 264, 40308, 5015, 369, 1202, 1866, 10096, 627, 25017, 3021, 11, 779, 8850, 690, 912, 5129, 387, 3025, 311, 5268, 499, 627, 24374, 38558, 2200, 374, 264, 32442, 11103, 13, 8442, 279, 11977, 315, 4359, 649, 9615, 3412, 198, 9514, 323, 2567, 499, 323, 6144, 499, 505, 682, 11682, 13, 9843, 499, 4070, 10534, 198, 1820, 27830, 315, 701, 43361, 7984, 5047, 11, 8530, 499, 690, 5268, 311, 5379, 311, 198, 39, 318, 13, 816, 6033, 690, 11471, 311, 11551, 525, 311, 21058, 323, 1054, 69, 1105, 731, 682, 3885, 2029, 20636, 198, 28010, 420, 27823, 15507, 11, 499, 690, 1464, 315, 282, 701, 5133, 449, 279, 198, 1919, 35534, 315, 1391, 34003, 430, 706, 9427, 16339, 14589, 439, 701, 31657, 662, 1628, 430, 374, 1148, 198, 17242, 38558, 2200, 374, 25, 264, 2860, 15507, 430, 11141, 912, 3130, 369, 4205, 775, 627, 24374, 38558, 2200, 374, 1790, 11, 1790, 810, 1109, 264, 7170, 3245, 26, 433, 529, 274, 459, 31469, 12108, 311, 198, 28879, 750, 26612, 325, 6261, 304, 279, 3177, 315, 3021, 13, 1628, 420, 690, 656, 810, 1109, 1120, 198, 4806, 701, 12459, 13, 1102, 690, 5276, 701, 4553, 2324, 627, 18293, 4205, 430, 7891, 4861, 279, 33862, 1853, 430, 6880, 311, 499, 2345, 198, 1527, 279, 4641, 1396, 315, 264, 33862, 11326, 499, 617, 6755, 922, 719, 198, 1962, 3686, 2663, 11, 311, 279, 468, 477, 74, 2239, 315, 362, 17026, 304, 14603, 18709, 11, 220, 311, 264, 743, 315, 23788, 198, 1395, 7819, 17223, 2035, 433, 389, 701, 51943, 369, 20503, 2214, 311, 279, 30467, 627, 45338, 323, 56060, 8084, 701, 6548, 323, 12234, 1139, 701, 32442, 2035, 13, 3580, 6261, 304, 701, 198, 4481, 27850, 11, 264, 6366, 323, 27823, 3130, 13, 3580, 6261, 21078, 304, 279, 4219, 315, 198, 275, 11, 389, 264, 45555, 3980, 4251, 55791, 13, 578, 55791, 5992, 1093, 9439, 42390, 38542, 994, 499, 10457, 198, 2996, 11, 433, 11321, 1093, 8369, 11, 8579, 67026, 627, 7184, 1518, 279, 43361, 88298, 11509, 3485, 499, 449, 5414, 6206, 927, 198, 22479, 2547, 662, 578, 43361, 1694, 374, 13633, 505, 701, 2547, 682, 279, 38556, 29720, 430, 198, 28156, 539, 9352, 1070, 11, 2225, 7106, 323, 2536, 47692, 13, 426, 1244, 383, 17693, 1139, 198, 576, 2217, 323, 2187, 433, 311, 387, 1972, 369, 499, 13, 15483, 41545, 374, 912, 28747, 18884, 16853, 87475, 374, 2744, 3118, 11, 539, 1120, 46450, 2740, 719, 16280, 16853, 7184, 3136, 449, 459, 10368, 505, 362, 17026, 304, 14603, 18709, 13, 220, 3161, 701, 198, 58331, 8036, 11, 2019, 14297, 311, 6261, 11, 1054, 27689, 5414, 9546, 1053, 358, 3810, 1457, 662, 89874, 39818, 279, 11914, 927, 323, 927, 311, 6261, 439, 499, 4498, 810, 323, 810, 198, 33980, 398, 1139, 264 ]
0xBreath/holistic-books
, al- cohol, and foodless food. In the spread of Natural Hygiene lies the hope of the future. Article #2: What Is Health? Various States of Existence Delineating Health Health does notconsist merely oftheabsence ofsymptoms ofillness. Itisastate of positive well-being thatisevidenced byaconstant state ofeuphoria. Itisrarely,ifever, experienced by humans today. Various States of Existence We could well divide the people we meet into the following categories:1.People who are definitely sick. 2.People who are on the borderline of sickness. 3.People who are apparently healthy. 4.People who enjoy high-level health. Thefirst three groups constitute thevast majority ofourpopulation. Perhaps only a mere handful ofouryouth could fallwithin thelastcategory.Great vigour andthebuoy- ant feeling of well-being are extremely rare in our populace. Delineating Health Health isastate ofsoundness andintegrity oforganism; vigour andefficiency of function; andexcellence ofmental faculties. Much ofthiswell-being springs from an- tecedent heredity butthatismerely thebase requisite tobuilding andmaintaining health. Health manifests itself bysuch afeeling oftone intheentire organism thatthebody fairly glows with itandbespeaks itatevery turn. There iscleanliness andsparkle tothe eyes, clearness andfinecolor totheskin, vigor andactivity andbounce tothestep, and an evident feeling of joy of living that is infectious. Wewitness traces ofthepristine vigor andwell-being inouryoungest children. Rarely doweobserve exuberant physiological excellence beyond theageofsix.Ifwe really want to see vigor we must watch the young of animals. This vigor is possible to humans throughout most of their lives.Lesson 2 - The Nature And Purpose Of Disease 2.1. What is Disease? 2.2. Purposes of Disease 2.3. T oxemia Is The Universal Cause Of Disease 2.4. Natural Hygiene Or Life Science Care Of The Ailing 2.5. The Character Of Disease 2.6. Questions & Answers Article #1: A T rue Perspective Of Health And Disease by Dr. Herbert M. Shelton Article #2:TheNature OfDisease: ItsCause And Purpose byDr.Hereward Carring- ton Inasmuch aswe’re having only onelesson specifically onthesubject ofdisease, I bidyoutostudy hard andabsorb itwell, fornearly allyour clientele willsufferdisease in one form or another. Inthislesson wewillascertain what disease is,what brings itabout, what purposes itserves, andwhy itends atallinview ofthefactthatitissupposed tobeanoccasion when malevolent microbial entities have gained adestructive foothold inourbodies. We willexplore how abody indescendancy (asitissaid tobeindisease) andmicrobes in ascendancy reverse these tendencies. 2.1. What is Disease? 1.Disease, asaword, means very simply notatease—a person isuncomfortable orsuffer- ingdifficulties inmaintaining energies forthefunctions hewishes todischar geandin keeping operative those faculties he wishes to exercise. Inphysiological terminology,disease means deviation from normal. That means that thebody hasdeviated from regular functions. Inastate ofdisease thebody hasrechan- neled orredirected itsenergiessothatithaslessthan usual energyforfunctions normal- ly engaged in. 2.There aretwodistinct types ofdisease. Thefirsttype ofdisease serves apurpose andthe second type serves none. Discerning these twotypes inyour clients willbenoproblem at all. These two types of disease are as follows: 1.The first type is constructive disease, often called acute disease. 2.The second type ofdisease isdegenerative. This results from organic impairment in which organs, tissues, bones, orother faculties have under gone destruction, distortion, or irreversible impairment. Yourservice toyour clients willlargely depend onyour ability torecognize whether adisease isconstructive ordegenerative. Irepeat: thisisnotdifficult. Youwill, regard- lessofthese conditions ofdisease, stillproceed byguiding your client into healthful practices, healthful practices being the universal panacea. Ifdiseases areremediable andreversible asmost ofthem are,itisconstructive. When disease cannolonger bereversed through body remediable processes, itisdegen- erative. Forinstance, anarthritic’ sbony deposits canusually beautolyzed andrestored tonear normal. Butwhen ankylosis hasoccurred duetodestruction ofbone andcartilage andsubsequent fusing, healthful practices willrestore health except fortheankylosis—it israrely reversible. However,many diseases commonly regarded asdegenerative canbe corrected by the body, most cases of arthritis being among them. 2.2. Purposes of Disease 2.2.1 Disease Is Started by the Body2.2.2 Disease Is an Eliminative Process Disease affects thewhole body,notjustapart. Disease serves animportant body purpose. Thebody initiates remedial diseases toaccomplish agoal. Thegoal serves the whole body,notjustanorgan, area, orpart. Forinstance, wecanknow wehave diseased kidneys. But, inactuality,thewhole body isdiseased. The factthatthesymptoms are noticeable only inthekidneys does notmean thattherestofthebody isunaffected—it means thatthekidneys arethefocal point fortheeliminative effort, thepoint atwhich toxic matters are put out of the body. Everything thataffects anypartofthebody affects thewhole organism. Ifwehave abadback, thewhole body isaffected. Weareconcerned about thewelfare ofourtoes, fingers, ears, legs, eyes, arms—we defend ourwhole being because ourwhole body is asingle unit. There arenoisolated parts about which weareunconcerned, either atthe conscious orunconscious level ofintelligence. Wedefend itallatalllevels because itis all of us. Wedon’thave adisease here oradisease there. It’ssuffered allover.Aninflamed ap- pendix hasbeen overloaded with toxic materials because thebody isoverloaded. Body intelligence puts theoverload outthrough allchannels ofelimination, butdespite this theload issogreat theappendix isburdened with more than itcanhandle. This condi- tionisthesame inallremedial diseases where alocal organseems tobetheonly thing affected. 2.2.1 Disease Is Started by the Body Thebody itself institutes thecrisis known asdisease. Life Scientists callthisprocess a“housecleaning” orhealing crisis. Such aprocedure bythebody isinstituted when bodily integrity iscompromised orthreatened byanaccumulation ofuneliminated toxic materials. Thelevel ofvitality andtheextent oftheoverload determine thetype ofcri- sis.Given high vitality asinaninfant, avery lowlevel oftoxicity istolerated. Ininfants, colds arefrequent. Given lowvitality asinmost older people inoursociety,colds area rarity.Because sofewolder people maintain vital bodies, thetoxic overload drags them down intochronic diseases, degenerative diseases, andunsuspected pathology thatleads to unexpected death or a “sudden onset” of cancer. Thebody must beinatoxic state before itwillinstitute acrisis. Neither bacteria nor anything elsestarts andsustains acrisis. Microor ganisms areincapable ofunified action; infactthey cannot exist where there isnofood (soil) forthem, andliving cells arenot soil for bacteria. Bacteria arehelpless against living cells. An“invasion” bybacteria such asweimag- ineincontagion never takes place. Thebacteria thatproliferate inacrisis arewith usall thetime. Weharbor uncounted billions ofmicroor ganisms inourintestinal tract, onour skin, inourmouth andnose andother body cavities. Thus, thebody istheONL Y,actor in the crisis of elimination or cleansing called a disease. Bacteria and viruses cannot be blamed for disease. Blaming disease onviruses orbacteria isaneasy copout. It’snotgood business totellaclient thatthey have caused their own miseries, sothemedical profession has blamed suf fering on everything but the individual’ s own failure in the game of living. 2.2.2 Disease Is an Eliminative Process Thebody creates acrisis inresponse toabody need tofreeitself oftoxic matters and repair damages. Consequently,thebody withdraws energyfrom normal body activities and redirects them to the healing crisis. Icould tellyouthatIamsuffering adisease atthismoment. I’mnotatease with mylarynx asyou’ve noticed inmytrying toclear myvoice
[ 11, 453, 7058, 11353, 11, 323, 3691, 1752, 3691, 13, 763, 279, 9041, 315, 18955, 10320, 43312, 15812, 279, 3987, 315, 279, 3938, 627, 17064, 674, 17, 25, 3639, 2209, 6401, 5380, 73741, 4273, 315, 62909, 768, 198, 35, 4939, 1113, 6401, 198, 14884, 1587, 539, 6387, 380, 16632, 315, 1820, 3518, 768, 315, 24738, 52273, 315, 484, 2136, 13, 1102, 285, 561, 349, 315, 198, 31587, 1664, 33851, 430, 1082, 1325, 5886, 555, 64, 18568, 1614, 315, 68, 455, 96729, 13, 1102, 285, 81, 548, 398, 1174, 1643, 424, 345, 327, 45933, 555, 12966, 3432, 16853, 73741, 4273, 315, 62909, 768, 198, 1687, 1436, 1664, 22497, 279, 1274, 584, 3449, 1139, 279, 2768, 11306, 25, 16, 61971, 1184, 889, 527, 8659, 14363, 627, 17, 61971, 1184, 889, 527, 389, 279, 89614, 315, 54950, 627, 18, 61971, 1184, 889, 527, 14132, 9498, 16853, 19, 61971, 1184, 889, 4774, 1579, 11852, 2890, 627, 791, 3983, 2380, 5315, 35256, 279, 85, 561, 8857, 315, 414, 45541, 13, 19292, 1193, 264, 198, 61031, 23810, 315, 414, 88, 2969, 1436, 4498, 56950, 279, 4354, 5588, 662, 22111, 21466, 414, 323, 1820, 20218, 2303, 7058, 519, 8430, 315, 1664, 33851, 527, 9193, 9024, 304, 1057, 94920, 627, 35, 4939, 1113, 6401, 198, 14884, 374, 561, 349, 315, 28632, 2136, 323, 396, 68312, 315, 8629, 2191, 26, 21466, 414, 323, 6581, 10603, 315, 198, 1723, 26, 323, 327, 5997, 768, 315, 93221, 98083, 13, 24191, 315, 576, 9336, 33851, 42242, 505, 459, 7058, 668, 2041, 306, 1077, 291, 488, 719, 339, 3689, 1195, 989, 279, 3231, 82780, 311, 24177, 323, 67913, 2101, 2890, 627, 14884, 84332, 5196, 555, 21470, 264, 1897, 20659, 43146, 606, 304, 1820, 306, 556, 47120, 430, 1820, 2664, 198, 42000, 398, 2840, 4336, 449, 433, 438, 9620, 375, 10011, 433, 349, 1225, 2543, 13, 2684, 374, 18883, 49958, 323, 54882, 273, 311, 1820, 198, 58331, 11, 2867, 2136, 323, 63157, 3506, 311, 6509, 8148, 11, 56022, 323, 7323, 323, 65402, 311, 61943, 752, 11, 323, 198, 276, 30576, 8430, 315, 16267, 315, 5496, 430, 374, 50600, 627, 54, 71996, 35483, 315, 1820, 652, 54165, 56022, 323, 9336, 33851, 304, 414, 82279, 478, 2911, 627, 67511, 398, 294, 24665, 49133, 506, 30970, 519, 53194, 38656, 7953, 279, 425, 37181, 953, 34001, 906, 198, 54760, 1390, 311, 1518, 56022, 584, 2011, 3821, 279, 3995, 315, 10099, 627, 2028, 56022, 374, 3284, 311, 12966, 6957, 1455, 315, 872, 6439, 1236, 72505, 220, 17, 482, 578, 22037, 1628, 30145, 5046, 31974, 198, 17, 13, 16, 13, 3639, 374, 31974, 5380, 17, 13, 17, 13, 14874, 8449, 315, 31974, 198, 17, 13, 18, 13, 350, 19488, 22689, 2209, 578, 26581, 45446, 5046, 31974, 198, 17, 13, 19, 13, 18955, 10320, 43312, 2582, 9601, 10170, 10852, 5046, 578, 362, 8138, 198, 17, 13, 20, 13, 578, 16007, 5046, 31974, 198, 17, 13, 21, 13, 24271, 612, 38343, 198, 17064, 674, 16, 25, 362, 350, 56949, 70288, 5046, 6401, 1628, 31974, 555, 2999, 662, 58463, 386, 13, 37940, 783, 198, 17064, 674, 17, 75145, 79519, 5046, 35, 56407, 25, 11699, 62012, 1628, 30145, 555, 9023, 3924, 261, 24998, 356, 20450, 7058, 783, 198, 644, 10753, 1412, 439, 906, 3207, 3515, 1193, 832, 28595, 11951, 389, 6509, 392, 585, 315, 67, 56407, 11, 358, 198, 21301, 88, 412, 537, 18339, 2653, 323, 3518, 30986, 433, 9336, 11, 57109, 22928, 31953, 414, 97272, 690, 82, 2084, 67, 56407, 198, 258, 832, 1376, 477, 2500, 16853, 644, 576, 28595, 289, 365, 484, 5171, 7770, 1148, 8624, 374, 11, 12840, 12716, 433, 9274, 11, 1148, 10096, 198, 1220, 13583, 11, 323, 35734, 433, 1438, 520, 543, 258, 1068, 315, 339, 830, 533, 9210, 275, 1056, 455, 3950, 311, 17937, 94411, 198, 9493, 8762, 72137, 75418, 15086, 617, 18661, 17546, 1257, 535, 79463, 820, 304, 414, 65, 10233, 13, 1226, 198, 65736, 2635, 79, 20763, 1268, 671, 1094, 1280, 3380, 408, 6709, 320, 300, 275, 1056, 3864, 311, 1395, 485, 56407, 8, 323, 41543, 9620, 304, 198, 5171, 408, 6709, 10134, 1521, 61555, 627, 17, 13, 16, 13, 3639, 374, 31974, 5380, 16, 920, 56407, 11, 439, 675, 541, 11, 3445, 1633, 5042, 539, 349, 521, 29096, 1732, 374, 359, 19975, 481, 477, 82, 2084, 7058, 287, 13798, 3951, 552, 304, 67913, 2101, 49969, 13544, 830, 600, 82, 305, 365, 21168, 311, 4338, 1799, 3980, 51701, 198, 33494, 64885, 1884, 98083, 568, 25223, 311, 10368, 627, 644, 42305, 41314, 57726, 1174, 67, 56407, 3445, 38664, 505, 4725, 13, 3011, 3445, 430, 198, 1820, 2664, 706, 3667, 10234, 505, 5912, 5865, 13, 763, 561, 349, 315, 67, 56407, 279, 2664, 706, 265, 5776, 7058, 818, 839, 477, 8280, 291, 1202, 804, 8376, 434, 8942, 266, 411, 300, 645, 267, 10118, 13783, 4907, 2000, 22124, 4725, 7058, 398, 17045, 304, 627, 17, 53407, 527, 15930, 347, 380, 7956, 4595, 315, 67, 56407, 13, 578, 3983, 1337, 315, 67, 56407, 17482, 1469, 30349, 323, 1820, 198, 5686, 955, 17482, 7000, 13, 11997, 944, 287, 1521, 4483, 22583, 304, 22479, 8403, 690, 8123, 47026, 10329, 198, 266, 682, 13, 4314, 1403, 4595, 315, 8624, 527, 439, 11263, 512, 16, 11829, 1176, 955, 374, 54584, 8624, 11, 3629, 2663, 30883, 8624, 627, 17, 11829, 2132, 955, 315, 67, 56407, 374, 451, 7642, 1413, 13, 1115, 3135, 505, 17808, 53317, 304, 198, 8370, 36853, 11, 39881, 11, 25896, 11, 477, 1605, 98083, 617, 1234, 8208, 19814, 11, 50971, 345, 269, 93294, 53317, 627, 56, 2530, 1033, 22068, 414, 8403, 690, 27995, 989, 6904, 389, 22479, 5845, 311, 34551, 553, 3508, 198, 329, 56407, 374, 7750, 535, 477, 451, 7642, 1413, 13, 14216, 11221, 25, 420, 285, 1962, 13798, 3951, 13, 1472, 14724, 11, 5363, 7058, 645, 708, 69, 45010, 4787, 315, 67, 56407, 11, 2103, 782, 4739, 555, 24343, 287, 701, 3016, 1139, 2890, 1285, 198, 652, 90290, 11, 2890, 1285, 12659, 1694, 279, 20789, 7363, 83682, 627, 2746, 67, 1082, 2315, 802, 261, 16809, 2205, 60772, 65398, 439, 3646, 315, 49818, 527, 11, 20000, 7750, 535, 627, 4599, 8624, 14068, 337, 647, 261, 28031, 44876, 1555, 2547, 34630, 2205, 11618, 11, 433, 285, 451, 4469, 7058, 261, 1413, 13, 1789, 4956, 11, 459, 47601, 50308, 529, 8057, 3633, 34751, 649, 44066, 5017, 5849, 16284, 323, 4014, 3093, 198, 59029, 277, 4725, 13, 2030, 9493, 459, 8050, 2353, 285, 706, 14310, 8293, 3930, 295, 347, 69802, 315, 20337, 323, 11707, 88076, 198, 438, 2008, 72457, 282, 985, 11, 2890, 1285, 12659, 690, 31904, 2890, 3734, 369, 1820, 92916, 2353, 285, 44603, 198, 285, 81, 548, 398, 81193, 13, 4452, 1174, 35676, 19338, 17037, 27458, 439, 451, 7642, 1413, 649, 1395, 198, 20523, 291, 555, 279, 2547, 1174, 1455, 5157, 315, 55652, 1694, 4315, 1124, 627, 17, 13, 17, 13, 14874, 8449, 315, 31974, 198, 17, 13, 17, 13, 16, 31974, 2209, 36912, 555, 279, 14285, 17, 13, 17, 13, 17, 31974, 2209, 459, 43420, 258, 1413, 8773, 198, 35, 56407, 22223, 279, 67733, 2547, 1174, 1962, 4345, 391, 472, 13, 31974, 17482, 459, 15693, 2547, 198, 77763, 13, 578, 2664, 12961, 988, 34630, 532, 19338, 311, 73087, 501, 819, 4227, 278, 13, 578, 35039, 17482, 279, 198, 67733, 2547, 1174, 1962, 4345, 276, 8629, 11, 3158, 11, 477, 4581, 13, 1789, 4956, 11, 584, 66, 1201, 3409, 584, 19553, 6759, 1503, 198, 64381, 36371, 13, 2030, 11, 304, 533, 10965, 1174, 16142, 31520, 2547, 374, 67, 1082, 1503, 13, 578, 2144, 9210, 6509, 1631, 52273, 527, 198, 24467, 481, 1193, 304, 339, 1247, 307, 36371, 1587, 539, 14622, 430, 700, 478, 1073, 1820, 2664, 374, 359, 32157, 44603, 198, 47321, 430, 339, 1247, 307, 36371, 527, 339, 830, 3768, 1486, 369, 1820, 40895, 258, 1413, 5149, 11, 279, 2837, 520, 8370, 198, 998, 14668, 13146, 527, 2231, 704, 315, 279, 2547, 16853, 36064, 430, 64, 41027, 904, 4581, 1073, 1820, 2664, 22223, 279, 67733, 47120, 13, 1442, 906, 19553, 198, 28447, 1445, 11, 279, 67733, 2547, 374, 32157, 13, 1226, 548, 444, 29644, 291, 922, 279, 86, 19806, 315, 414, 998, 288, 345, 69, 14437, 11, 25212, 11, 14535, 11, 6548, 11, 11977, 86319, 10726, 1057, 67733, 1694, 1606, 1057, 67733, 2547, 374, 198, 300, 2222, 5089, 13, 2684, 527, 2201, 61023, 660, 5596, 922, 902, 584, 548, 359, 444, 29644, 291, 11, 3060, 520, 1820, 198, 64589, 477, 359, 64589, 2237, 315, 93375, 13, 468, 4313, 408, 433, 543, 266, 543, 43664, 1606, 433, 285, 198, 543, 315, 603, 627, 27601, 263, 529, 339, 525, 1008, 56407, 1618, 477, 329, 56407, 1070, 13, 1102, 753, 82, 2084, 291, 453, 57597, 8794, 258, 1517, 3690, 1469, 7058, 3825, 953, 706, 82850, 75691, 449, 21503, 7384, 1606, 279, 2664, 374, 2017, 15961, 13, 14285, 198, 93375, 9711, 279, 2017, 1096, 704, 20322, 682, 33525, 315, 40895, 2617, 11, 719, 5919, 6100, 420, 198, 339, 77997, 2425, 540, 1244, 279, 5200, 953, 374, 11490, 5294, 291, 449, 810, 1109, 433, 4919, 8355, 13, 1115, 87556, 7058, 28491, 380, 17082, 373, 304, 543, 1864, 291, 532, 19338, 1405, 264, 2497, 2942, 325, 12116, 25410, 19030, 3323, 3245, 198, 32157, 627, 17, 13, 17, 13, 16, 31974, 2209, 36912, 555, 279, 14285, 198, 791, 2664, 5196, 94812, 279, 5192, 9667, 3967, 439, 67, 56407, 13, 9601, 57116, 1650, 576, 4734, 198, 64, 2118, 7830, 18883, 287, 863, 477, 383, 6260, 11501, 13, 15483, 264, 21826, 555, 1820, 2664, 374, 258, 3781, 2844, 994, 198, 65, 347, 1570, 17025, 374, 5807, 442, 4147, 30299, 1244, 6901, 555, 276, 40031, 2987, 315, 359, 40895, 15846, 21503, 198, 78672, 13, 578, 3374, 315, 85, 2223, 488, 323, 1820, 71272, 315, 1820, 2017, 1096, 8417, 279, 1337, 315, 745, 7058, 14744, 1246, 2116, 1579, 75716, 439, 74276, 13885, 519, 11, 264, 1225, 3428, 3374, 315, 998, 14668, 488, 6127, 22847, 660, 13, 763, 13885, 1821, 345, 66, 18938, 527, 69, 70791, 13, 16644, 3428, 85, 2223, 488, 439, 258, 3646, 9191, 1274, 304, 2530, 6180, 1174, 66, 18938, 3158, 198, 81, 10981, 662, 18433, 779, 71830, 2061, 1274, 10519, 16595, 13162, 11, 279, 998, 14668, 43284, 1377, 2076, 1124, 198, 2996, 1139, 7562, 292, 19338, 11, 5367, 75989, 19338, 11, 323, 11099, 355, 4136, 77041, 430, 99470, 198, 998, 16907, 4648, 477, 264, 1054, 82, 39095, 42080, 863, 315, 9572, 16853, 791, 2664, 2011, 387, 258, 4428, 14668, 1614, 1603, 433, 14724, 258, 7815, 1645, 6091, 285, 13, 25215, 24032, 6463, 198, 73254, 775, 66976, 323, 82, 592, 1771, 1645, 6091, 285, 13, 18654, 269, 25893, 13978, 527, 2910, 391, 481, 315, 359, 1908, 1957, 280, 13885, 533, 20670, 4250, 3073, 1405, 1070, 374, 2201, 14239, 320, 708, 321, 8, 13544, 336, 11, 323, 64275, 7917, 527, 1962, 198, 708, 321, 369, 24032, 627, 33, 78852, 527, 8823, 1752, 2403, 5496, 7917, 13, 1556, 2118, 258, 59093, 863, 555, 65, 78852, 1778, 439, 906, 29116, 7058, 483, 258, 778, 351, 290, 2646, 5097, 2035, 13, 578, 65, 78852, 430, 782, 75, 11691, 349, 304, 582, 6091, 285, 527, 4291, 603, 543, 198, 339, 4199, 13, 1226, 13279, 9552, 653, 1868, 291, 33151, 315, 41543, 269, 25893, 13978, 304, 414, 71558, 42929, 11, 389, 414, 198, 37282, 11, 304, 414, 33780, 323, 77, 974, 323, 1605, 2547, 57709, 1385, 13, 14636, 11, 279, 2664, 6127, 383, 715, 43, 816, 11, 5739, 198, 258, 279, 11501, 315, 44032, 477, 60052, 2663, 264, 8624, 627, 33, 78852, 323, 42068, 4250, 387, 36197, 369, 8624, 627, 5028, 6605, 8624, 389, 46957, 4881, 37466, 78852, 374, 2194, 6539, 6293, 412, 13, 1102, 753, 1962, 19045, 2626, 198, 28879, 6985, 3045, 430, 20670, 617, 9057, 872, 1866, 5906, 4804, 11, 779, 339, 16809, 950, 4913, 706, 198, 2067, 3690, 56868, 282, 4776, 389, 4395, 719, 279, 3927, 529, 274, 1866, 8060, 304, 279, 1847, 315, 5496, 627, 17, 13, 17, 13, 17, 31974, 2209, 459, 43420, 258, 1413, 8773, 198, 791, 2664, 11705, 1645, 6091, 285, 304, 2376, 311, 370, 1094, 1205, 311, 10816, 275, 726, 315, 998, 14668, 13146, 323, 198, 77539, 26186, 13, 53123, 1174, 1820, 2664, 15142, 82, 4907, 1527, 4725, 2547, 7640, 198, 438, 72271, 1124, 311, 279, 21730, 11501, 627, 40, 29177, 259, 12160, 2969, 266, 40, 4214, 2084, 287, 1008, 56407, 520, 576, 29699, 13, 358, 4344, 1962, 349, 521, 449, 198, 2465, 75, 661, 24244, 439, 9514, 4070, 14000, 304, 2465, 85134, 311, 7574, 856, 10063 ]
0xBreath/holistic-books
abasement under askylight andacool, pinkish, white fluorescent light, itwas noticed thatthefemale pumpkin-producing flower turned yellow,then black andfinally dried upanddropped offthevine. Consequently,thevine didnotproduce fruit. When these lights were replaced with tubes containing more blue inthem, thefemale buds de- veloped bountifully,while themale buds dried up,turned black anddropped offthevine atanearly stage. Theusual ratio ofmale tofemale buds onapumpkin vine isseven to onerespectively; however,inthese artificially-lighted plants, normal reproduction could not take place. Ingeneral, ithasbeen observed thatplants grown inartificial light lack therugged constitution ofplants grown under natural lighting conditions. Their growth may be stimulated bysubjecting them tolonger hours oflight, ascompared tothenatural light cycle oftherevolving earth. Butthisforced growth produces plants bearing flowers and fruit of lesser quality and color appeal than those grown in sunlight. Theanimal world isalso adversely affected byvariance oflight wavelengths. Inan experiement conducted todetermine theeffects ofdifferent light onanimals, 1000 mice were used anddivided among three different light environments: Those receiving natur- aldaylight produced anequal amount ofmale andfemale offspring; those under white fluorescent bulbs produced 70% females and30% males; andthose under pink fluores- cent bulbs produced 30% females and70% males. This latter group didnotthrive as well aseither ofthetwoother groups. Allthose exposed tothepink light quitbreeding two months earlier and died one month earlier than those exposed to the white light. Asthese experiments were made with astrain ofmice inwhich malignancy develops in98% ofthem, almost allthemice didsuccumb tocancer.However,those mice under natural daylight developed cancer twomonths later than those under thewhite fluores- cent bulbs, andthree months later than those under thepink fluorescent bulbs. Anaddi- tional effectwasnoticed: Those mice receiving thepink light gave birth toyoung which were smaller in number and size than those mice receiving natural light. Other investigations have shown that light definitely affects thepituitary gland, aswell asother areas inthemidbrain andhypothalamic regions. Intheearly 1920’ s, William Rowan demonstrated thatthevarying seasonal lengths ofthedaylight wasre- sponsible forthemigration ofbirds. Inother studies conducted byBochenek, Marbur g andGudden, itwasshown thatlight may occasion reaction ontheentire endocrine sys- temofananimal vianerve impulses originating intheretina andreaching other areas ofthebrain byway ofaccessory optic pathways. Thus, artificial light, notbeing ofthe same quality as natural light, can play havoc with the endocrine system via the nerves. Astudy was conducted involving some elderly men atanursing home who spent most oftheir time indoors under theinfluence ofunnatural lighting. They found that these men suffered aseverely diminished ability toabsorb calcium; yetwhen thelightswere replaced with special bulbs designed tosimulate sunlight, their calcium absorption wasincreased by15% within amonth. Even more disturbing research conducted bysci- entists hasindicated thatfluorescent lighting cancause genetic mutations, cancer and death in the cells of many life forms, including humans. Aside from thefacts concerning thedirect negative effects ofunnatural lighting; we must also consider their more indirect effectonourbody rhythms. Their presence, by turning night into day,tend toimbalance thecircadian rhythms—the regular cycles of rising andfalling body temperature, variations inbody chemicals, etc., thatnaturally oc- curapproximately once every 24hours. Theresult may bewhat three WestGerman pho- tobiologists have called “light stress.” Allplants andanimals require alternating periods oflight anddark sothatsome vital processes may restwhile others become activated. The anabolic activities during the night cantake place efficiently only when notinterfered with bylighting, which will continue tooccasion activity intheliving cells. Theresult isthattheprocesses ofgrowth andrepair areinterrupted, resulting inthenecessity fordisease, andthebody isrobbed of a certain degree of life force. Experiments testing theinfluence ofartificial light onfishrevealed that, when ex- posed totoomany hours oflight, thefishceased toreproduce. When time exposed to light wascutdown gradually over aperiod ofweeks, thefishresumed reproduction if exposed topink light, butnotunder theslightly bluish white light. Also, under thepink light, theratio offemale tomale offspring was80to20respectively andthedevelop- ment of the secondary sex characteristics of the male of fspring was retarded. Regarding humans, some scientists suspect thattheageatwhich girls reach sexual maturity might beinfluenced bytheartificial illumination ofnighttime. Ithasbeen no- ticed thatincountries experiencing long winter nights, girls arenow reaching sexual maturity months oryears younger than their grandmothers did.Apparently,their normal maturation cycle isbeing interfered with bytheintroduction ofartificial lighting into their lives, thereby increasing the rate at which they mature. From thisinformation, wemay understand theimportance lighting plays inourdaily lives andwemay also suspect thatalltheeffects ofartificial lighting have yettobeun- covered. Atruescience ofhealth must endeavor toascertain allaspects oflifeandliving and their ultimate ef fects on human health. 13.3. Air And Breathing Airisthegaseous substance thatmakes uptheatmosphere oftheearth andprovides every living thing with itsbreath oflife.Plants receive oxygen through their leaves; in- sects breathe through tiny openings intheir bodies; frogs breathe partly through their skin; fishabsorb oxygen outofthewater asitpasses over their gills; andhumans receive their supply ofoxygen partly through theskin, butlargely through thelungs. Theinde- pendent lifeofabody does notbegin until ittakes itsfirst breath andthisfunction of breathing continues until theendoflife.This istheprocess ofrespiration, anditmust be considered theprimary function oftheliving organism. Wecanlivemany weeks with- outfood andsome days without water,butifthefunction ofbreathing isinterfered with for only a few minutes, our life quickly ends. Respiration isanautomatic, involuntary process, being regulated according tothe body’ sinternal needs. Withhealthy lungs, webreathe normally andrhythmically,yet unconsciously,astheprocess isbeyond ourconscious control. Atrestwebreathe slowly andlessdeeply.Asactivity isincreased, breathing becomes more rapid, with greater ex- cursions of the diaphragm and chest to allow for increased oxygen intake. Buttherespiratory movements arenotconfined tothechest alone; they aresystemic motions pervading thewhole trunk. Itisknown thattherhythmic pulsations oftheheart synchronize with themovements ofthechest inrespiration. These breathing movements alsoconstitute animportant factor inthecirculation oftheblood, aswemay experienceinthecase ofadrowned person being resusitated byartificial respiration, bywhich cir- culation and heart action are restored. Byfar,thelargest organs inthebody arethelungs, designed andadapted totheir work ofreceiving airandnothing else. They fillthethorax from thecollarbone tothe lowermost ribsandfrom thesternum infront tothespine inback. When thechest wall israised through theaction ofthemuscles ofthechest, andwhen thediaphragm isde- pressed, thechest cavity expands, thisforms avacuum, andtheairrushes intoit.Con- versely,when thechest wall contracts andthediaphragm israised, theairisforced out ofthelungs. Coincidentally with thisprocess, theblood flows through thelungs, pick- ingupoxygen, carrying ittotheceils andgiving offcarbon dioxide thatithasbrought from thecells. This whole process isautomatic andisregulated bythebody’ sneed for oxygen. Anormal pair oflungs contain approximately abillion tiny aircells. Ifthese cells were allspread outonaflatsurface, they would cover anarea 40x50feet. Theaverage man inhales daily approximately 777,000 cubic inches ofair,andinthissame time 125 barrels ofblood arepurified inthelungs. Here thepoisons andimpurities ofthebody arebrought bytheblood andcastoff.Also, theblood absorbs afresh supply ofoxygen, nitrogen, hydrogen andtheessence ofsunlight tobeconveyed toallparts ofthebody to furnish thetrillions ofcells with thenormal stimulation toactivate itsvarious functions. This isacontinuous process, andifitisinterfered with, theresult could befatal. When respiration isobstructed, thelipsquickly turn bluish-purple duetotherapid collection ofcarbon dioxide gasintheblood. Inonly afewseconds,
[ 370, 300, 1133, 1234, 2610, 4010, 492, 323, 582, 1786, 11, 18718, 819, 11, 4251, 74864, 3177, 11, 433, 16514, 198, 75375, 430, 339, 830, 12011, 50625, 90375, 23153, 6656, 14071, 1174, 3473, 3776, 323, 40276, 198, 67, 4588, 709, 438, 11513, 7069, 1022, 1820, 62301, 13, 53123, 1174, 1820, 62301, 1550, 1962, 98374, 14098, 13, 3277, 198, 45010, 13001, 1051, 12860, 449, 34083, 8649, 810, 6437, 304, 49818, 11, 279, 43734, 68543, 409, 7058, 1851, 291, 293, 632, 5092, 398, 1174, 3556, 1124, 1604, 68543, 32720, 709, 11, 42286, 3776, 323, 11513, 7069, 1022, 1820, 62301, 198, 16623, 22928, 6566, 13, 578, 81324, 11595, 315, 37576, 311, 43734, 68543, 389, 391, 1538, 8148, 30050, 374, 81285, 311, 198, 263, 13213, 1002, 3210, 26, 4869, 1174, 258, 45010, 78220, 18179, 291, 11012, 11, 4725, 39656, 1436, 198, 1962, 1935, 2035, 627, 644, 25615, 11, 78942, 300, 82850, 13468, 430, 64805, 15042, 304, 472, 16895, 3177, 6996, 9139, 20752, 198, 44103, 315, 64805, 15042, 1234, 5933, 18186, 4787, 13, 11205, 6650, 1253, 387, 198, 54754, 7913, 555, 11760, 287, 1124, 311, 4930, 261, 4207, 315, 4238, 11, 439, 5807, 1636, 311, 3473, 4688, 3177, 198, 22352, 315, 19041, 12821, 4504, 9578, 13, 2030, 576, 25229, 6650, 19159, 11012, 18534, 19837, 323, 198, 36698, 315, 32415, 4367, 323, 1933, 14638, 1109, 1884, 15042, 304, 40120, 627, 791, 48999, 1917, 374, 19171, 69214, 11754, 555, 959, 5397, 315, 4238, 93959, 13, 763, 276, 198, 327, 32836, 1133, 13375, 11791, 25296, 279, 81524, 315, 64750, 3177, 389, 77896, 11, 220, 1041, 15, 24548, 198, 52898, 1511, 323, 614, 4591, 4315, 2380, 2204, 3177, 22484, 25, 13266, 12588, 14818, 7058, 278, 1316, 4238, 9124, 459, 26880, 3392, 315, 37576, 323, 43734, 46471, 26, 1884, 1234, 4251, 198, 27256, 4692, 1189, 54320, 9124, 220, 2031, 4, 28585, 323, 966, 4, 25000, 26, 323, 54719, 1234, 18718, 51881, 7058, 1189, 54320, 9124, 220, 966, 4, 28585, 323, 2031, 4, 25000, 13, 1115, 15629, 1912, 1550, 1962, 339, 58035, 439, 198, 9336, 264, 325, 2544, 315, 339, 295, 1146, 1605, 5315, 13, 2052, 54719, 15246, 311, 339, 752, 771, 3177, 17257, 21152, 16490, 198, 20375, 4038, 6931, 323, 8636, 832, 2305, 6931, 1109, 1884, 15246, 311, 279, 4251, 3177, 627, 32, 31177, 2423, 21896, 1051, 1903, 449, 23112, 467, 315, 76, 560, 304, 8370, 60327, 6709, 39671, 198, 258, 3264, 4, 315, 49818, 11, 4661, 682, 49818, 560, 1550, 65541, 3635, 55961, 11967, 662, 11458, 1174, 54719, 24548, 1234, 198, 53980, 53121, 8040, 9572, 4483, 316, 6167, 82, 3010, 1109, 1884, 1234, 279, 5902, 51881, 7058, 1189, 54320, 11, 323, 28956, 4038, 3010, 1109, 1884, 1234, 279, 64349, 74864, 54320, 13, 1556, 723, 72, 7058, 83, 4001, 2515, 16514, 75375, 25, 13266, 24548, 12588, 279, 64349, 3177, 6688, 7342, 311, 82279, 902, 198, 52898, 9333, 304, 1396, 323, 1404, 1109, 1884, 24548, 12588, 5933, 3177, 627, 11663, 26969, 617, 6982, 430, 3177, 8659, 22223, 279, 33686, 3159, 661, 67169, 345, 300, 9336, 439, 1605, 5789, 304, 49818, 307, 54160, 323, 79343, 8942, 278, 4079, 13918, 13, 763, 1820, 22928, 220, 5926, 15, 529, 274, 345, 45887, 11035, 276, 21091, 430, 1820, 84076, 287, 36899, 29416, 315, 339, 46212, 4238, 574, 265, 7058, 82, 43419, 13544, 336, 5141, 315, 67461, 13, 763, 1605, 7978, 13375, 555, 1255, 7674, 1247, 11, 2947, 11490, 342, 198, 438, 38, 39095, 11, 433, 86, 395, 71, 785, 430, 4238, 1253, 13402, 13010, 389, 1820, 306, 556, 842, 78738, 5826, 7058, 880, 1073, 29718, 2931, 348, 1122, 5976, 87633, 71373, 304, 700, 295, 2259, 60772, 12092, 1023, 5789, 198, 1073, 1820, 54160, 555, 3195, 315, 5323, 683, 81209, 44014, 13, 14636, 11, 21075, 3177, 11, 539, 35214, 315, 1820, 198, 25030, 4367, 439, 5933, 3177, 11, 649, 1514, 66592, 449, 279, 842, 78738, 1887, 4669, 279, 50581, 627, 32, 56065, 574, 13375, 16239, 1063, 29920, 3026, 58946, 1759, 287, 2162, 889, 7543, 198, 3646, 315, 50828, 892, 55154, 1234, 279, 258, 41116, 315, 15278, 4688, 18186, 13, 2435, 1766, 430, 198, 45010, 3026, 16654, 264, 325, 424, 989, 54182, 5845, 311, 3518, 30986, 35719, 26, 3686, 9493, 279, 4238, 2332, 486, 12860, 449, 3361, 54320, 6319, 311, 87811, 40120, 11, 872, 35719, 44225, 198, 16514, 43842, 1503, 555, 868, 4, 2949, 1097, 6167, 13, 7570, 810, 34973, 3495, 13375, 555, 54927, 7058, 306, 1705, 706, 485, 10297, 430, 27256, 4692, 1189, 18186, 649, 1593, 19465, 34684, 11, 9572, 323, 198, 63007, 304, 279, 7917, 315, 1690, 2324, 7739, 11, 2737, 12966, 627, 71088, 505, 279, 69153, 18815, 279, 20384, 8389, 6372, 315, 15278, 4688, 18186, 26, 584, 198, 25849, 1101, 2980, 872, 810, 25636, 2515, 263, 414, 2664, 81821, 13, 11205, 9546, 11, 555, 198, 413, 287, 3814, 1139, 1938, 14287, 408, 311, 21495, 5085, 279, 44398, 10272, 81821, 22416, 5912, 25492, 315, 198, 60023, 323, 13772, 287, 2547, 9499, 11, 27339, 304, 2664, 26333, 11, 5099, 2637, 430, 77, 72247, 18274, 7058, 2407, 97836, 3131, 1475, 220, 1187, 31482, 13, 666, 13213, 495, 1253, 28054, 9379, 2380, 4410, 33179, 1343, 78, 7058, 83, 18843, 22012, 617, 2663, 1054, 4238, 8631, 49216, 2460, 64805, 323, 77896, 1397, 73462, 18852, 315, 4238, 323, 23449, 779, 339, 1900, 638, 16595, 198, 4734, 288, 1253, 2800, 3556, 3885, 3719, 22756, 13, 578, 459, 57565, 7640, 2391, 279, 198, 9471, 16869, 731, 2035, 30820, 1193, 994, 539, 2295, 809, 291, 449, 555, 4238, 287, 11, 902, 690, 198, 9726, 311, 94411, 5820, 304, 339, 301, 2299, 7917, 13, 666, 13213, 495, 6127, 9379, 339, 752, 41948, 288, 315, 74189, 198, 438, 77539, 527, 55905, 291, 11, 13239, 304, 3473, 4093, 488, 45728, 56407, 11, 323, 1820, 2664, 374, 23576, 2788, 198, 1073, 264, 3738, 8547, 315, 2324, 5457, 627, 849, 50732, 7649, 279, 258, 41116, 315, 472, 16895, 3177, 389, 18668, 92076, 5962, 430, 11, 994, 506, 7058, 3950, 117807, 316, 3852, 4207, 315, 4238, 11, 279, 18668, 95304, 63108, 98374, 13, 3277, 892, 15246, 311, 198, 4238, 574, 10453, 2996, 27115, 927, 264, 19862, 315, 82089, 11, 279, 18668, 417, 39255, 39656, 422, 198, 327, 3950, 1948, 771, 3177, 11, 719, 1962, 8154, 279, 3306, 73048, 1529, 51220, 4251, 3177, 13, 7429, 11, 1234, 279, 64349, 198, 4238, 11, 9139, 6400, 1022, 12011, 10390, 1604, 46471, 574, 1490, 998, 508, 45734, 3210, 323, 339, 15686, 1851, 7058, 479, 315, 279, 14580, 1877, 17910, 315, 279, 8762, 315, 8789, 2702, 574, 98459, 627, 85625, 12966, 11, 1063, 14248, 15562, 430, 1820, 425, 266, 8370, 7724, 5662, 7392, 198, 76, 38954, 2643, 387, 258, 27256, 5886, 555, 1820, 472, 16895, 77052, 315, 9471, 1712, 13, 358, 339, 300, 82850, 912, 7058, 83, 7725, 430, 2910, 20730, 25051, 1317, 12688, 22178, 11, 7724, 527, 3409, 19261, 7392, 198, 76, 38954, 4038, 477, 42820, 14992, 1109, 872, 6800, 6489, 3058, 1550, 5215, 31227, 1174, 50828, 4725, 198, 8637, 2060, 11008, 374, 35214, 41305, 291, 449, 555, 1820, 396, 17158, 315, 472, 16895, 18186, 1139, 198, 50828, 6439, 11, 28592, 7859, 279, 4478, 520, 902, 814, 15196, 627, 3915, 420, 26125, 11, 289, 336, 352, 3619, 279, 475, 685, 18186, 11335, 304, 414, 49174, 198, 75, 1924, 323, 86, 336, 352, 1101, 15562, 430, 543, 1820, 81524, 315, 472, 16895, 18186, 617, 3686, 83, 15784, 359, 7058, 21468, 13, 362, 376, 1157, 66, 1873, 315, 12393, 2011, 54914, 311, 5171, 7770, 682, 300, 8132, 315, 14789, 438, 64275, 198, 438, 872, 17139, 31469, 282, 115192, 389, 3823, 2890, 627, 1032, 13, 18, 13, 6690, 1628, 11681, 44661, 198, 26777, 380, 383, 70, 521, 788, 20278, 430, 80785, 709, 1820, 266, 8801, 8182, 315, 1820, 28641, 323, 782, 68254, 198, 30115, 5496, 3245, 449, 1202, 21152, 589, 315, 14789, 22079, 1821, 5371, 24463, 1555, 872, 11141, 26, 304, 7058, 55529, 37397, 1555, 13987, 49649, 304, 50828, 13162, 26, 90546, 37397, 28135, 1555, 872, 198, 37282, 26, 7795, 3518, 30986, 24463, 704, 1073, 16142, 977, 439, 275, 95423, 927, 872, 342, 3385, 26, 323, 28400, 598, 5371, 198, 50828, 8312, 315, 78, 19472, 28135, 1555, 279, 37282, 11, 719, 27995, 989, 1555, 279, 75, 29222, 13, 578, 28074, 7058, 3825, 306, 2324, 1073, 370, 1094, 1587, 539, 7413, 3156, 433, 79079, 1202, 3983, 11745, 323, 576, 1723, 315, 198, 21152, 44661, 9731, 3156, 279, 408, 1073, 14789, 29845, 6127, 383, 4734, 315, 417, 29579, 11, 323, 275, 25849, 387, 198, 25742, 291, 279, 6682, 734, 315, 339, 301, 2299, 47120, 13, 468, 762, 276, 34667, 336, 3852, 5672, 449, 7058, 412, 14239, 323, 15031, 2919, 2085, 3090, 1174, 8248, 58710, 830, 600, 315, 21152, 44661, 374, 2295, 809, 291, 449, 198, 2000, 1193, 264, 2478, 4520, 11, 1057, 2324, 6288, 10548, 627, 1079, 29579, 374, 276, 84556, 11, 91605, 1920, 11, 1694, 35319, 4184, 311, 1820, 198, 2664, 529, 274, 10701, 3966, 13, 3161, 38128, 45274, 11, 3566, 1244, 383, 14614, 323, 81, 61254, 2740, 1174, 47492, 198, 359, 444, 71888, 1174, 561, 383, 4734, 374, 65, 23478, 1057, 64589, 2585, 13, 2468, 4014, 2984, 1244, 383, 14297, 198, 438, 1752, 33980, 398, 662, 2170, 7323, 374, 43842, 1503, 11, 27027, 9221, 810, 11295, 11, 449, 7191, 506, 7058, 66, 76339, 315, 279, 1891, 95896, 76, 323, 15489, 311, 2187, 369, 7319, 24463, 23730, 627, 4071, 700, 288, 5682, 5382, 19567, 527, 1962, 6263, 1619, 311, 1820, 27417, 7636, 26, 814, 264, 417, 615, 292, 198, 76, 41356, 47274, 2277, 279, 67733, 38411, 13, 1102, 3267, 4262, 430, 700, 23394, 21914, 56037, 811, 315, 1820, 18207, 198, 82, 53887, 449, 1124, 869, 3808, 315, 1820, 27417, 304, 417, 29579, 13, 4314, 27027, 19567, 198, 19171, 1040, 275, 1088, 459, 15693, 8331, 304, 339, 762, 2496, 2987, 315, 1820, 51105, 11, 439, 86, 336, 352, 3217, 48121, 762, 521, 315, 329, 45184, 1732, 1694, 594, 355, 33337, 555, 472, 16895, 594, 29579, 11, 555, 8370, 30570, 7058, 66, 2987, 323, 4851, 1957, 527, 28101, 627, 1383, 24470, 11, 339, 301, 33481, 36853, 304, 1820, 2664, 527, 339, 301, 29222, 11, 6319, 323, 89171, 291, 311, 50828, 198, 1816, 315, 265, 47444, 3805, 438, 42312, 775, 13, 2435, 5266, 339, 774, 269, 710, 505, 279, 17666, 277, 20337, 311, 1820, 198, 15115, 3646, 56249, 438, 1527, 279, 267, 944, 372, 304, 7096, 311, 6509, 39138, 304, 1445, 13, 3277, 279, 27417, 7147, 198, 285, 93613, 1555, 279, 1335, 315, 49818, 355, 19153, 315, 1820, 27417, 11, 323, 9493, 279, 8747, 95896, 76, 374, 451, 7058, 14655, 11, 279, 27417, 56429, 52956, 11, 420, 10008, 1860, 582, 21066, 11, 323, 1820, 1334, 78277, 288, 1139, 275, 4906, 7058, 3078, 989, 1174, 9493, 279, 27417, 7147, 17517, 323, 339, 19586, 95896, 76, 374, 93613, 11, 279, 1334, 285, 25229, 704, 198, 1073, 339, 301, 29222, 13, 27328, 66, 57222, 449, 420, 4734, 11, 279, 51105, 28555, 1555, 279, 75, 29222, 11, 3820, 7058, 287, 20709, 19472, 11, 15691, 433, 998, 1820, 346, 8839, 323, 70, 2299, 1022, 74441, 40589, 430, 411, 300, 65, 6478, 198, 1527, 279, 37791, 13, 1115, 4459, 1920, 374, 84556, 323, 285, 81722, 555, 1820, 2664, 529, 274, 17483, 369, 198, 78, 19472, 627, 2127, 2553, 6857, 315, 75, 29222, 6782, 13489, 671, 15068, 13987, 264, 2496, 6572, 13, 1442, 45010, 7917, 198, 52898, 682, 59295, 704, 6863, 1517, 1900, 10730, 11, 814, 1053, 3504, 459, 4903, 220, 1272, 87, 1135, 1897, 295, 13, 578, 17645, 198, 1543, 60537, 3916, 7446, 13489, 220, 15831, 11, 931, 41999, 15271, 315, 1334, 51526, 258, 576, 25030, 892, 220, 6549, 198, 2308, 54883, 315, 51105, 527, 26047, 1908, 304, 339, 301, 29222, 13, 5810, 279, 5481, 19941, 323, 6802, 38333, 315, 1820, 2664, 198, 548, 65, 6478, 555, 1820, 51105, 323, 3914, 1885, 9833, 708, 11, 279, 51105, 91111, 8136, 2548, 8312, 315, 78, 19472, 345, 45168, 26252, 11, 35784, 323, 1820, 434, 768, 315, 40619, 4238, 311, 1395, 444, 5735, 291, 311, 543, 18753, 315, 1820, 2664, 311, 198, 69, 399, 819, 279, 376, 91387, 315, 37791, 449, 1243, 2553, 41959, 311, 17281, 1202, 959, 1245, 5865, 627, 2028, 52435, 79689, 1920, 11, 323, 333, 20000, 2295, 809, 291, 449, 11, 92779, 495, 1436, 58046, 4306, 13, 3277, 198, 417, 29579, 374, 677, 1257, 291, 11, 279, 75, 3153, 28863, 398, 2543, 1529, 51220, 95562, 3930, 295, 1605, 44221, 4526, 198, 1073, 74441, 40589, 6962, 258, 1820, 51105, 13, 763, 3323, 8136, 365, 17859, 11 ]
0xBreath/holistic-books
who willdothecertifying ofproducts. Italso states thatthe Department ofAgriculture hasno“affirmation obligation” toenforce theregulation. The regulation does notgointoeffectuntil January 1980, andHarlan expects some adjust- ments will need to be made as “we get experience.” Whatever theoutcome oftheMaine regulation andtheproposed federal guidelines for advertising, it’ s likely that fewer products will carry the term “natural” in the future. Chicago T ribuneLesson 25 - Selection And Storage Of Most Wholesome Foods, Part II 25.1. V egetables 25.2. Storage Of Fresh V egetables 25.3. Purchasing And Storing Seeds For Sprouting And Ready-T o-Eat Sprouts 25.4. Selection And Storage Of Dried Grains And Legumes 25.5. Bread—General Information 25.6. Butter And Oil—General Information 25.7. Sweeteners 25.8. Packaged, Frozen And Canned Foods—General Information And Storage 25.9. Questions & Answers Article #1: W ell! Y ou W anted T o Know By V.V. Vetrano, B.S., D.C. 25.1. Vegetables 25.1.1 How to Judge and Select V egetables Vegetables areavery important partofanoptimally nutritional diet, andcanbethe most enjoyable part of a meal if properly chosen and prepared. Dr.Shelton says, “Alargerawvegetable salad with each dinner isoneofthemost important elements ofthediet. Asapreventive ofdisease, itisfarsuperior toallthevac- cines and scrums ever devised.” Vegetables areanabolic (bodybuilding) foods, yet,unlike most protein foods, they arealmost consistently alkaline inreaction, have very little fatandcontain adequate amounts of dietary fiber. Green leafy vegetables aretherichest source ofchlorophyll, aswell asminerals and vitamins. They also contain small amounts ofprotein ofhigh biological value, which is easier to assimilate than concentrated proteins. Adietcontaining excessive amounts ofprotein andcarbohydrates would notbenear- ly so harmful if balanced with a generous amount of vegetables. Vegetables addvariety tothemenu andplay animportant roleinthenutrition ofhu- mans. 25.1.1 How to Judge and Select Vegetables General Suggestions: 1.Buy in season when quality is highest and prices lowest. 2.Don’ tbuymore than youwillusebefore they deteriorate. Thesooner youuseyour veg- etables, the more flavor and nutritional value they will contain. 3.Handle displayed vegetables carefully so you don’ t damage them for others. 4.Buy thefreshest andbestquality available—it willtaste better,youwillhave lesstodis- card and you will get more usable food for your money. Vegetables arebest when eaten immediately after they arepicked from thegarden. Trytoatleast grow some ofyour own lettuce (many vegetables caneven begrown in crates, ifthere isreally nogarden space available), orfind someone inyour area who canshare with you. Green leafy vegetables aresoimportant thatitisworth going to some trouble toassure asupply ofthebest available. Allvegetables have themost to offer nutritionally andhave thebestflavor when organically grown andeaten intheraw state immediately after harvesting. Themore time thatpasses after harvesting, themore chemical changes occur which alter the nutritional composition and the taste.Fresh vegetables areusually transported rapidly from field tomarket inchilled vans tokeep them atmaximum quality.Ifhandled properly atthewholesale andretail levels, they canreach youinfairly good condition. Unlike fruit, theconcern isfreshness, not ripeness. Itisincumbent upon youtolearn topick thefreshest andbest, andtoreject poor quality vegetables thathave been mishandled orthathave justbeen onhand too long. Even when youmust depend onconventional sources foryour produce, youcan become awise, canny,selective, knowledgeable shopper,andyouandyour family and dinner guests will eat the best food available. Ifit’sfresh, itlooks fresh—not wilted, wrinkled, drooping orotherwise blemished. Thecolor should becharacteristic ofthevariety.Thedegree ofmaturity isalso impor- tant. Most vegetables arebestwhen slightly immature; iflargeandmature, they areusu- ally tough. Aswith fruits, most ofthevegetables available inthemarkets have been treated with heavy doses ofchemical fertilizers andpesticides. Washing cansomewhat decrease those thatremain ontheoutside surface, though nothing canremove theresidues which areabsorbed through theroots. Some vegetables canbepeeled, butitissadtohave to remove the skin and thus lose the nutrients which lie immediately beneath it. Some vegetables have their own protective coating, like podded peas andbeans. Vegetables likelettuce canbewashed only lightly toremove dirtandsand, andused “as is.”Unless yougrow your own, orobtain organically-grown vegetables, that’sthebest youcando.Youwill stillbehealthier andbetter nourished than nonvegetarians, and, aspreviously explained, chemical residues inthebodies ofvegetarians areconsiderably lower than in the bodies of meateaters. Some vegetables may also bewaxed. Watch forthewax coatings oncucumbers, tomatoes, peppers, parsnips andrutabagas. Either trytobuyunwaxed vegetables, orpeel them. Ifyoumust peel, don’tcuttoodeeply.Trytodiscard only thethinskin. Thegreat- est concentration of nutrients is just beneath the skin. Red coloring may beadded tosweet potatoes ortosome new white potatoes. Don’ t buy colored vegetables. Potatoes andonions arefrequently treated with ananti-sprouting chemical. Ifthe potatoes look fresh andgood, andafewareshowing signs oftinysprouts, thatwould seem toindicate thatthey have notbeen treated. Ipick those thatarenotsprouting, of course. Tomatoes may bepicked green andgassed inthevanontheway tomarket. Youcan tellbythecolor andthetaste. Tomatoes thatwere notpicked prematurely willripen toa deep-glowing red color, the flesh will not be mushy, and the taste will be superb. Ifyoulocate asource of“organically grown” vegetables, check thesource totryto find outifthey really areasrepresented. Usually,there arecertain indications, certain differences inappearance andtaste. Inanyevent, don’taccept vegetables thatarepoor quality or old just because you have been assured they are or ganically grown. Keep trying tofind organically grown produce, butinthemeantime these lessons can help you pick the freshest and best of what is seasonably available. Specific Varieties of Vegetables (alphabetically): Artichokes, Globe (or French) Peak season isMarch through May.Artichokes aregrown inCalifornia and, while they areshipped allthrough theyear,they arebest from March through May.This veg- etable isusually cooked. Select firm, compact, tightly closed heads thatareheavy inre- lation tosize, with green, fresh-looking leaves. Size isnotrelated toquality orflavor. Youmay sometimes findartichokes with frost discoloration ontheouter leaves. Thein- nerleaves arestillgood andunaffected. Reject artichokes with brownish softspots near the stem or on leaf edges.Artichokes, Jerusalem (or ground) This plant haspotato-like tubers which aredelicious eaten raw.Itiscrisp andtastes alittle likeafresh water chestnut. Italsohasadelicate flavor when cooked. Dr.Vetrano hasexpressed theopinion thatthestarch inJerusalem artichokes isnotreadily absorbed by the body. Asparagus Peak season isMarch through June. Asparagus isusually cooked, butitisdelicious raw.Select deep green, well-rounded spears with compact, tightly closed tips. Theyoung slim tipsarethemost tender andbest tasting. Avoid wilted, limp, flatorangular stalks. They areusually tough andstringy.Use asparagus assoon aspossible; itisvery per- ishable. Dr.Esser says thewild asparagus isarealdelicacy.Healsosays thatcultivated asparagus isthechoicest ofallspring vegetables andshould beinevery home garden. However,Dr.Burton hasexpressed theopinion thatthefactthattheeating ofasparagus causes theurine toemit afoulodor,isindicative ofthisvegetable’ sunfavorable reaction in the body, and that he would recommend using it sparingly, if at all. Beans (Fresh) Snap Beans (Green or Wax), Pole Beans, Italian String Beans Peak season isMay through October,particularly June andJuly.Available allyear, butofpoor quality outofseason. Select beans with both ends intact. They should have apliable, velvety feel, nothard ortough. Thecolor should befresh andbright-looking andthepods should beyoung andsnap
[ 14965, 690, 3055, 339, 762, 531, 7922, 315, 10354, 13, 1102, 19171, 5415, 430, 1820, 198, 27725, 315, 32, 13130, 554, 706, 2201, 2118, 2715, 2923, 367, 29672, 863, 100134, 9009, 1070, 70, 2987, 13, 578, 198, 1610, 2987, 1587, 539, 70, 787, 4748, 1740, 39830, 6186, 220, 3753, 15, 11, 323, 27588, 10946, 25283, 1063, 7652, 7058, 1392, 690, 1205, 311, 387, 1903, 439, 1054, 906, 636, 3217, 49216, 47916, 279, 87294, 315, 1820, 6334, 68, 19812, 323, 339, 752, 897, 20158, 6918, 17959, 198, 2000, 13172, 11, 433, 529, 274, 4461, 430, 17162, 3956, 690, 6920, 279, 4751, 1054, 53980, 863, 304, 279, 3938, 627, 47275, 350, 20735, 2957, 71504, 220, 914, 482, 25117, 1628, 15035, 5046, 7648, 1254, 7298, 638, 198, 37, 9242, 11, 3744, 8105, 198, 914, 13, 16, 13, 650, 70763, 4893, 198, 914, 13, 17, 13, 15035, 5046, 30260, 650, 70763, 4893, 198, 914, 13, 18, 13, 53792, 4522, 1628, 800, 5620, 74089, 1789, 15883, 11149, 1628, 32082, 9469, 297, 13737, 266, 15883, 11934, 198, 914, 13, 19, 13, 25117, 1628, 15035, 5046, 423, 4588, 2895, 1771, 1628, 7765, 19131, 198, 914, 13, 20, 13, 50141, 2345, 15777, 8245, 198, 914, 13, 21, 13, 31457, 1628, 15895, 2345, 15777, 8245, 198, 914, 13, 22, 13, 27687, 18724, 198, 914, 13, 23, 13, 14114, 3359, 11, 58846, 1628, 356, 7443, 40160, 2345, 15777, 8245, 1628, 15035, 198, 914, 13, 24, 13, 24271, 612, 38343, 198, 17064, 674, 16, 25, 468, 26689, 0, 816, 6033, 468, 3276, 291, 350, 297, 14521, 3296, 650, 662, 53, 13, 650, 17820, 5770, 11, 426, 815, 2637, 423, 732, 627, 914, 13, 16, 13, 43800, 4893, 198, 914, 13, 16, 13, 16, 2650, 311, 20819, 323, 8593, 650, 70763, 4893, 198, 43712, 456, 4893, 527, 25727, 3062, 961, 1073, 276, 19680, 750, 43226, 10173, 11, 323, 4919, 65, 19030, 198, 3646, 32180, 961, 315, 264, 15496, 422, 10489, 12146, 323, 10235, 627, 9023, 11086, 301, 783, 2795, 11, 1054, 2149, 42876, 675, 83571, 481, 33566, 449, 1855, 14177, 374, 606, 1073, 49818, 537, 198, 15693, 5540, 315, 79371, 3978, 13, 1666, 391, 265, 688, 535, 315, 67, 56407, 11, 433, 285, 69, 1590, 3550, 2521, 311, 543, 1820, 54803, 7058, 66, 1572, 323, 9406, 6370, 3596, 69120, 49216, 43712, 456, 4893, 527, 276, 57565, 320, 2664, 24177, 8, 15657, 11, 3686, 11, 359, 4908, 1455, 13128, 15657, 11, 814, 198, 548, 60301, 21356, 66787, 483, 304, 60307, 11, 617, 1633, 2697, 8834, 438, 53195, 26613, 198, 6173, 82, 315, 34625, 24722, 16853, 20147, 16312, 88, 24822, 527, 700, 292, 6536, 2592, 315, 72967, 5237, 25734, 11, 439, 9336, 439, 1083, 17822, 323, 198, 55911, 38925, 13, 2435, 1101, 6782, 2678, 15055, 315, 79565, 315, 12156, 24156, 907, 11, 902, 374, 198, 68, 77783, 311, 40054, 76457, 1109, 38626, 28896, 627, 2654, 3978, 778, 2101, 27639, 15055, 315, 79565, 323, 7063, 34658, 988, 1053, 539, 8123, 686, 7058, 398, 779, 28856, 422, 24770, 449, 264, 28771, 3392, 315, 24822, 627, 43712, 456, 4893, 923, 30265, 2676, 311, 49818, 1509, 323, 1387, 459, 15693, 3560, 258, 3473, 332, 17462, 315, 17156, 7058, 70991, 627, 914, 13, 16, 13, 16, 2650, 311, 20819, 323, 8593, 43800, 4893, 198, 15777, 88715, 512, 16, 1823, 4168, 304, 3280, 994, 4367, 374, 8592, 323, 7729, 15821, 627, 17, 920, 263, 529, 16767, 84, 1631, 461, 1109, 499, 14724, 817, 15145, 814, 39436, 349, 13, 666, 288, 9186, 261, 499, 817, 22479, 48438, 7058, 295, 4893, 11, 279, 810, 17615, 323, 43226, 907, 814, 690, 6782, 627, 18, 32521, 12882, 24822, 15884, 779, 499, 1541, 529, 259, 5674, 1124, 369, 3885, 627, 19, 1823, 4168, 279, 69, 417, 6536, 323, 16241, 10692, 2561, 44603, 690, 83, 5642, 2731, 1174, 9514, 14724, 19553, 3625, 267, 347, 285, 7058, 5057, 323, 499, 690, 636, 810, 41030, 3691, 369, 701, 3300, 16853, 43712, 456, 4893, 527, 16241, 994, 35661, 7214, 1306, 814, 527, 94599, 505, 279, 70, 8506, 627, 22170, 998, 266, 56371, 3139, 1063, 315, 22479, 1866, 71655, 320, 35676, 24822, 649, 17206, 2197, 4935, 304, 198, 5192, 988, 11, 422, 19041, 374, 54760, 34410, 8506, 3634, 2561, 705, 477, 3990, 4423, 304, 22479, 3158, 889, 198, 66, 598, 77811, 449, 499, 13, 7997, 16312, 88, 24822, 264, 50864, 15693, 430, 20000, 20069, 2133, 311, 198, 15031, 12544, 311, 395, 554, 439, 85023, 315, 1820, 16241, 2561, 13, 2052, 83571, 4893, 617, 1124, 537, 311, 198, 26133, 26677, 750, 323, 19553, 279, 16241, 1517, 3372, 994, 2942, 2740, 15042, 323, 68, 13827, 304, 700, 675, 198, 2513, 7214, 1306, 66747, 13, 49038, 461, 892, 430, 95423, 1306, 66747, 11, 1124, 461, 198, 32056, 4442, 12446, 902, 11857, 279, 43226, 18528, 323, 279, 12945, 1006, 2548, 24822, 527, 44066, 40460, 19019, 505, 2115, 311, 19859, 17560, 4473, 77124, 198, 998, 13397, 1124, 520, 40287, 4367, 662, 2746, 39921, 10489, 520, 16142, 75790, 1604, 323, 2171, 607, 5990, 345, 20670, 649, 23430, 499, 13885, 1334, 398, 1695, 3044, 13, 27140, 14098, 11, 279, 444, 29644, 374, 72408, 2136, 11, 539, 198, 462, 2821, 434, 13, 1102, 285, 2910, 3635, 306, 5304, 379, 412, 1286, 1923, 1948, 875, 279, 69, 417, 6536, 323, 16241, 11, 323, 83, 461, 585, 198, 5481, 269, 4367, 24822, 430, 19553, 1027, 64496, 438, 839, 30299, 589, 525, 1120, 82850, 389, 10888, 2288, 198, 4930, 13, 7570, 994, 499, 25849, 6904, 389, 444, 44322, 8336, 369, 22479, 8356, 11, 499, 4919, 198, 17106, 638, 1384, 1082, 11, 649, 3919, 1174, 1779, 535, 11, 42066, 94303, 1174, 438, 9514, 13634, 414, 3070, 323, 198, 67, 4481, 15051, 690, 8343, 279, 1888, 3691, 2561, 627, 2746, 275, 753, 72408, 11, 433, 95373, 7878, 63938, 75596, 291, 11, 58370, 839, 11, 7118, 34807, 477, 61036, 293, 3516, 3384, 627, 791, 3506, 1288, 387, 19740, 4633, 315, 1820, 30265, 2676, 662, 1016, 291, 27874, 315, 76, 38954, 374, 19171, 3242, 269, 7058, 61512, 13, 7648, 24822, 527, 16241, 9493, 10284, 86525, 26, 422, 17185, 438, 76, 1598, 11, 814, 527, 64968, 7058, 750, 11292, 627, 2170, 4291, 26390, 11, 1455, 315, 1820, 83571, 4893, 2561, 304, 339, 21799, 1441, 617, 1027, 12020, 198, 4291, 8987, 35130, 315, 32056, 36214, 12509, 323, 30223, 76195, 13, 82238, 43732, 316, 81575, 18979, 198, 54719, 430, 48684, 389, 1820, 68090, 7479, 11, 3582, 4400, 649, 5514, 92779, 307, 1157, 902, 198, 548, 3518, 269, 2788, 1555, 9139, 1944, 82, 13, 4427, 24822, 649, 1395, 375, 41189, 11, 719, 275, 1056, 329, 998, 19553, 311, 198, 5514, 279, 6930, 323, 8617, 9229, 279, 37493, 902, 10457, 7214, 24923, 433, 627, 8538, 24822, 617, 872, 1866, 29219, 41394, 11, 1093, 7661, 9988, 47136, 323, 28440, 627, 43712, 456, 4893, 1093, 28163, 10743, 649, 83036, 13883, 1193, 34504, 311, 5514, 26351, 2914, 438, 11, 323, 2656, 1054, 300, 198, 285, 2029, 36687, 499, 67318, 701, 1866, 11, 477, 677, 23771, 2942, 2740, 2427, 4935, 24822, 11, 430, 529, 267, 383, 16241, 198, 9514, 66, 4988, 39537, 14724, 2103, 1395, 12393, 1291, 323, 58234, 46798, 3384, 1109, 2536, 83571, 30627, 11, 323, 345, 300, 1762, 18785, 11497, 11, 11742, 71783, 304, 1820, 65, 10233, 315, 83571, 30627, 527, 25742, 2915, 198, 15115, 1109, 304, 279, 13162, 315, 757, 349, 11796, 627, 8538, 24822, 1253, 1101, 28054, 52551, 13, 10573, 13544, 365, 710, 92025, 78970, 1791, 372, 1941, 345, 38501, 20798, 11, 58573, 11, 1370, 9810, 3153, 323, 70546, 370, 86152, 13, 21663, 1456, 83, 677, 4168, 359, 86, 52551, 24822, 11, 477, 375, 301, 198, 49818, 13, 1442, 9514, 25849, 58212, 11, 1541, 1431, 10453, 998, 536, 752, 398, 662, 22170, 68987, 48660, 1193, 279, 339, 1354, 8148, 13, 578, 47991, 7058, 478, 20545, 315, 37493, 374, 1120, 24923, 279, 6930, 627, 6161, 35987, 1253, 387, 17249, 311, 95928, 35267, 64609, 32554, 502, 4251, 35267, 13, 4418, 529, 259, 198, 20369, 28296, 24822, 627, 45716, 20798, 323, 263, 919, 527, 69, 70941, 12020, 449, 459, 15719, 1355, 652, 11149, 11742, 13, 1442, 1820, 198, 19644, 20798, 1427, 7878, 323, 19045, 11, 323, 2642, 365, 64, 2548, 24060, 12195, 43146, 258, 1065, 652, 11934, 11, 430, 41450, 198, 325, 336, 311, 485, 8630, 430, 20670, 617, 539, 82850, 12020, 13, 358, 30345, 1884, 430, 548, 1962, 52773, 11149, 11, 315, 198, 12120, 627, 25763, 20798, 1253, 387, 94599, 6307, 323, 70, 60104, 304, 1820, 16023, 6167, 25754, 311, 19859, 13, 1472, 4919, 198, 73457, 1729, 339, 762, 795, 323, 339, 295, 5642, 13, 8529, 20798, 430, 52898, 539, 94599, 89019, 690, 462, 2821, 311, 64, 198, 33980, 2427, 10516, 287, 2579, 1933, 1174, 279, 26000, 690, 539, 387, 30823, 88, 1174, 323, 279, 12945, 690, 387, 33689, 627, 2746, 9514, 23207, 439, 930, 315, 2118, 8629, 2740, 15042, 863, 24822, 11, 1817, 279, 2484, 311, 1568, 998, 198, 3990, 704, 333, 20670, 2216, 5789, 53859, 13, 34067, 1174, 19041, 527, 66, 7770, 56190, 11, 3738, 198, 67, 59426, 304, 97755, 323, 83, 5642, 13, 763, 3852, 3163, 11, 1541, 1431, 10543, 24822, 430, 548, 5481, 269, 198, 10692, 477, 2362, 1120, 1606, 499, 617, 1027, 28478, 814, 527, 477, 25893, 2740, 15042, 627, 19999, 4560, 311, 3990, 2942, 2740, 15042, 8356, 11, 719, 258, 9224, 519, 547, 1521, 18872, 198, 4919, 1520, 499, 3820, 279, 49973, 6536, 323, 1888, 315, 1148, 374, 3280, 2915, 2561, 627, 48614, 28968, 26640, 315, 43800, 4893, 320, 90553, 2740, 997, 9470, 718, 8099, 11, 41910, 320, 269, 8753, 340, 57867, 3280, 374, 28623, 1555, 3297, 51164, 718, 8099, 527, 62376, 304, 46510, 323, 11, 1418, 198, 20670, 264, 417, 2200, 7018, 682, 20322, 814, 686, 11, 20670, 527, 16241, 505, 5587, 1555, 3297, 29845, 48438, 7058, 36164, 374, 44066, 30205, 13, 8593, 7626, 11, 17251, 11, 40069, 8036, 14971, 430, 548, 89945, 304, 265, 7058, 2354, 311, 2190, 11, 449, 6307, 11, 7878, 31348, 11141, 13, 8645, 374, 1962, 9920, 311, 10692, 477, 1517, 3372, 16853, 2675, 18864, 7170, 1505, 472, 718, 8099, 449, 45834, 2624, 795, 367, 389, 1820, 2743, 11141, 13, 578, 258, 7058, 1215, 273, 4798, 527, 44466, 19045, 323, 359, 32157, 13, 88393, 1989, 718, 8099, 449, 14198, 819, 8579, 68110, 3221, 198, 1820, 19646, 477, 389, 16312, 13116, 51164, 718, 8099, 11, 26523, 320, 269, 5015, 340, 2028, 6136, 706, 19644, 4428, 12970, 15286, 388, 902, 527, 9783, 9824, 35661, 7257, 28628, 3510, 6091, 79, 323, 83, 28006, 198, 278, 2433, 1093, 2642, 2548, 3090, 15489, 24217, 13, 1102, 19171, 4752, 15503, 8630, 17615, 994, 30205, 13, 2999, 5168, 17820, 5770, 198, 4752, 14107, 291, 279, 454, 37400, 430, 61943, 1132, 304, 45057, 25245, 1989, 718, 8099, 374, 1962, 888, 1570, 42101, 198, 1729, 279, 2547, 16853, 2170, 94789, 198, 57867, 3280, 374, 28623, 1555, 5651, 13, 1666, 94789, 374, 44066, 30205, 11, 719, 20000, 9783, 9824, 198, 1059, 15094, 5655, 6307, 11, 1664, 65318, 2395, 1590, 449, 17251, 11, 40069, 8036, 10631, 13, 2435, 283, 983, 198, 3306, 318, 10631, 548, 49818, 537, 28682, 323, 16241, 47500, 13, 35106, 75596, 291, 11, 83378, 11, 1344, 859, 4328, 55972, 82, 627, 7009, 527, 44066, 11292, 323, 928, 88, 662, 10464, 439, 94789, 439, 67156, 439, 10236, 26, 433, 285, 1225, 824, 7058, 819, 481, 13, 2999, 5253, 784, 261, 2795, 279, 68974, 439, 94789, 374, 548, 4852, 43723, 2826, 662, 1548, 1147, 437, 954, 430, 93113, 55786, 198, 300, 94789, 6127, 383, 971, 292, 478, 315, 5700, 2702, 24822, 323, 5562, 387, 483, 1225, 2162, 13863, 627, 11458, 1174, 9023, 1823, 324, 783, 706, 14107, 291, 279, 454, 37400, 430, 339, 830, 533, 9210, 1820, 91955, 315, 300, 94789, 198, 936, 4881, 279, 324, 483, 311, 19233, 8136, 11206, 50017, 62510, 86184, 1413, 315, 576, 83571, 481, 529, 7160, 75060, 481, 13010, 198, 258, 279, 2547, 1174, 323, 430, 568, 1053, 7079, 1701, 433, 96055, 398, 1174, 422, 520, 682, 627, 82658, 320, 56753, 340, 62971, 81836, 320, 20147, 477, 76842, 705, 53727, 81836, 11, 15155, 935, 81836, 198, 57867, 3280, 374, 11356, 1555, 6664, 1174, 74039, 5651, 323, 29527, 82436, 2141, 31953, 686, 345, 8248, 1073, 5481, 269, 4367, 704, 1073, 17217, 13, 8593, 27994, 449, 2225, 10548, 35539, 13, 2435, 1288, 617, 198, 391, 51430, 11, 9231, 85, 2676, 2733, 11, 912, 339, 569, 64609, 1409, 13, 578, 3506, 1288, 58046, 2548, 323, 73216, 31348, 198, 438, 339, 752, 30797, 1288, 7888, 283, 983, 323, 49954 ]
0xBreath/holistic-books
.Molasses supplies no fatty acids. One tablespoon ofblackstrap molasses supplies approximately 43calories. Inorder tomeet ourdaily caloric needs, wewould have toconsume anentire meal ofmolasses. Molasses cannot berelished byitself byanyone. Aproper food ofhumans canbeeaten asameal. Forinstance, wecanmake amono meal ofanyoneofthese foods: apples, wa- termelon, cantaloupes, bananas, grapes, oranges, peaches, apricots, figs, dates, etc.And youcanmaintain health forseveral weeks justonthese foods alone. However,youcould never make onemono meal ofmolasses. Itwould berepulsive toeven think ofdoing so and it could certainly not support life. Thefactthatmolasses cannot meet anyofthecriteria ofafood automatically puts it in the category of junk food and it should be eliminated from our diet forever! 35.4. Health Claims For Molasses 35.4.1 Minerals in Molasses 35.4.2 A Rich Source of V itamins 35.4.3 Molasses - A Good Laxative 35.4.4 Carbon Dioxide 35.4.5 Phosphoric Acid 35.4.6 Bone Char 35.4.7 Chlorine 35.4.1 Minerals in Molasses Dr.Rudolph Ballentine says that, “Since itisaconcentrated residue, molasses con- tains significant quantities ofminerals such asiron, afairamount ofcalcium andgener- ous quantities of trace elements such as zinc, copper, and chromium.” Justbecause these minerals canbedetected inmolasses does notmean thatthey are inaform thatcanutilized bythebody.Infact, these minerals aremostly resulting from theresidues from thelime, cattle bones, soil, andother residues leftafter being boiled formany hours athigh temperatures. Most areinorganic andtotally unusable tothehu- man body,Even ifthere were anyorganic minerals left,they would berendered useless after the boiling and chemical treatment. 35.4.2 A Rich Source of Vitamins Itisclaimed thatthechief value ofmolasses liesinthefactthatitisrichinvitamins oftheBfamily.Considering theprocess which themolasses hasgone through, thisis quite impossible. First ofall,theBvitamins arewater soluble. Largequantities ofwater areadded tothemolasses during itsmanufacture. SotheBvitamins would bedissolved. Second, Bvitamins aredestroyed byheat ateven amoderate temperature. They arecer- tainly destroyed bythehigh heat andlong boiling time required intheprocess ofrender- ing molasses. 35.4.3 Molasses - A Good Laxative Thefactthattheconsumption ofmolasses results indiarrhea orseems tohave alax- ative effectisproof thatthebody isattempting todispose ofthisunwholesome food as quickly and as best it can. It is completely incompatible with bodily needs or functions. P.E.Noris writes, “Atnight take ateaspoonful ofmolasses inwarm water ormilk.” Hecautions thatoneshould nottake more than thisasitmay nauseate you. Hisbody is trying totellhimsomething butheisnotlistening. Thebody knows what isapoison and what isnot.Takeatablespoon ofanywholesome food such assunflower seeds. Youwill feelfineandmost likely willwant more. Takeatablespoon ofmolasses andyouwillbe immediately sick. There will be no craving for more.Do yourself a favor and do not poison yourself. Youshould also beaware ofthefactthatthispoison isnotonly added tomolasses butisoften seen inmost dried fruits. Asyouknow,dried fruits arevaluable additions toourdietwhen they areofgood quality.However,when treated with sulphur dioxide, these fruits become deadly asthepoisons with which they aretreated andshould never be consumed. How canyourecognize sulphur treated fruits? Mostly bythecolor.Ifthefruit’ scolor isbright andunusually clear,ithasbeen treated. Ifthefruit’ scolor isdull andalittle brownish, then most likely ithasnot.Also, read thelabels when buying these packaged dried fruits. Another excellent idea would betodryyour own. Home food dehydrators arereadily available anddoanexcellent jobofdrying andpreserving fruits. This way youknow forsure thatthefruit wasofexcellent quality andnopoisons were added to them during the drying process. 35.4.4 Carbon Dioxide Carbon dioxide gasisgenerally produced inthecombustion, decomposition, orfer- mentation ofcarbon oritscompounds, isfound intheairandisexhaled byallanimals. Itisthefinal product ofcombustion ofcarbon infood, which thebody exhales through thelungs oreliminates through thekidneys inurine, orinperspiration through theskin. Although carbon dioxide ispresent intheairwebreathe (uptoabout 5%), ifitisina greater quantity than this, itproduces anuncomfortable degree ofhyperpnea with men- tal confusion and will cause death by suf focation. Carbon dioxide gasisused inthemanufacture ofmolasses, carbonated drinks and commercially used in dry ice. Soweknow thatcarbon dioxide isawaste product given offbythebody.Wealso know that ifinhaled inlargeamounts itcanresult indeath. Wedonotasyetknow what effects itwillhave when added toourfood insmall quantities. Should wetake the chance? AsHygienists wecannot condone theuseofproven orunproven poisons. We may assume, however,thatifitispoisonous inoneform (air), itwillalso bepoisonous in another (food). 35.4.5 Phosphoric Acid Phosphoric acid isnotonly used inthemanufacture ofmolasses butisalsoadded to carbonated softdrinks. Itisasolvent which isused tokeep alltheconstituents inacom- pound inaliquid form. This acid, according totheMerck manual results incorrosive burns from inhalation, skin contact, eyecontact, andingestion. Itwillalso cause local pain. This is another deadly poison. 35.4.6 Bone Char Inorder tounderstand why thissubstance, which isadded tocertain foods including molasses, isdangerous, wemust understand what itisthatwearedealing with. Bone char isthecharcoal remains ofanimal bones. Charcoal isactually thecarbon remains after burning orheating these bones. Carbon isachemical element which ispresent in all or ganic substances. These include proteins, carbohydrates, and fats. When acompound containing carbon combines with oxygen inthebody,energyis liberated andcarbon dioxide isformed. Carbon hasseveral chemical features thatmake itunique asafoundation forlife. However,ifthese features arealtered drastically as they areupon theaddition ofheat, disastrous results may occur.Itisaknown factthat thecharcoal formed oncharcoal broiled steaks which aresocommonly eaten today are carcinogens. Itisalsopossible thatthealteration ofthecarbon element inacooked foods could have adverse consequences onourhealth. Theaddition ofbone char tomolasses just taking this product one step further down the ladder of the junk food dungeon.35.4.7 Chlorine Chlorine iscommonly used asawater purifier anbleach. Added toflour at400 parts permillion, itinstantly ages theflour andbleaches itwhite. Formany years a flour bleach called Agene wasused, until England’ sDr.Mellanby discovered thatAgene caused running fitsandmental deterioration indogs. The Food andDrug Administra- tion, under public pressure, finally outlawed thebleach. Butthechlorine bleaches used today,although regarded assafebytheFDA, arehighly toxic poisons. Nitrosylchloride, forexample, isavery corrosive reddish yellow gaswhich isintensely irritating toeyes, skin andmucosa. Inhalation may cause pulmonary edema andhemorrhage. Yetthisis added to foods. 35.5. Impurities In Molasses Molasses contains 9%ashand17.5% waste. That consists ofmostly cellulose plus all ofthewastes leftover after theprocessing ofwhite sugar including soil, residues and chemical contaminants. Somolasses isworse than refined sugar asitcarries with itallthebadqualities of refined sugar plus theadded toxins. AsLife Scientists, weattempt tobuild health and notdestroy it.When weingest such atotally unwholesome andanti-life product asmo- lasses, wearetruly destroying life. Doyour body afavor anddonotgive poisons but give it fuel for life in the form of whole fresh fruits, vegetables, nuts and seeds. Instead ofsatisfying ourcraving forsweets with such poisons asmolasses, usefresh or dried fruits and your sweet tooth will surely be satisfied. 35
[ 1345, 337, 52090, 17135, 912, 40085, 33969, 627, 4054, 62611, 315, 11708, 5202, 22337, 52090, 17135, 13489, 220, 3391, 5531, 2490, 13, 763, 1382, 198, 83, 638, 295, 1057, 49174, 1652, 27456, 3966, 11, 289, 365, 619, 617, 311, 85594, 459, 306, 556, 15496, 315, 45444, 52090, 627, 44, 337, 52090, 4250, 10418, 301, 3384, 555, 275, 726, 555, 3852, 606, 13, 362, 81768, 3691, 315, 28400, 598, 649, 33131, 13827, 198, 300, 373, 278, 13, 1789, 4956, 11, 584, 4919, 7072, 1097, 10358, 15496, 315, 3852, 606, 1073, 45010, 15657, 25, 41776, 11, 10667, 7058, 5098, 65467, 11, 16869, 278, 13649, 288, 11, 68442, 11, 66008, 11, 85138, 11, 1069, 14576, 11, 21726, 292, 2469, 11, 4237, 82, 11, 13003, 11, 5099, 32264, 198, 9514, 4919, 67913, 467, 2890, 369, 325, 17998, 5672, 1120, 6167, 2423, 15657, 7636, 13, 4452, 1174, 9514, 29177, 198, 37593, 1304, 389, 7439, 78, 15496, 315, 45444, 52090, 13, 1102, 41450, 28031, 79, 58921, 311, 17206, 1781, 315, 45359, 779, 198, 438, 433, 1436, 7995, 539, 1862, 2324, 627, 791, 34210, 9210, 45444, 52090, 4250, 3449, 904, 1073, 339, 762, 5204, 315, 64, 14239, 9651, 9711, 433, 198, 258, 279, 5699, 315, 30774, 3691, 323, 433, 1288, 387, 34373, 505, 1057, 10173, 16058, 4999, 1758, 13, 19, 13, 6401, 51198, 1789, 33518, 52090, 198, 1758, 13, 19, 13, 16, 84886, 304, 33518, 52090, 198, 1758, 13, 19, 13, 17, 362, 8269, 8922, 315, 650, 433, 38925, 198, 1758, 13, 19, 13, 18, 33518, 52090, 482, 362, 7839, 445, 710, 1413, 198, 1758, 13, 19, 13, 19, 22208, 423, 37901, 198, 1758, 13, 19, 13, 20, 2405, 24527, 27456, 50234, 198, 1758, 13, 19, 13, 21, 46701, 4969, 198, 1758, 13, 19, 13, 22, 92479, 483, 198, 1758, 13, 19, 13, 16, 84886, 304, 33518, 52090, 198, 9023, 2056, 664, 44070, 13131, 27970, 2795, 430, 11, 1054, 12834, 433, 10994, 444, 1189, 55373, 49232, 11, 22337, 52090, 390, 7058, 127324, 5199, 33776, 315, 1083, 17822, 1778, 439, 2534, 11, 8136, 1334, 6173, 315, 27684, 2411, 323, 7642, 7058, 788, 33776, 315, 11917, 5540, 1778, 439, 49601, 11, 24166, 1174, 323, 97962, 49216, 10156, 28753, 1521, 34072, 649, 2788, 295, 1599, 304, 45444, 52090, 1587, 539, 14622, 430, 20670, 527, 198, 2259, 630, 430, 4919, 1338, 1534, 555, 1820, 2664, 662, 19998, 533, 11, 1521, 34072, 527, 63995, 13239, 505, 198, 700, 288, 307, 1157, 505, 279, 40043, 11, 36952, 25896, 11, 17614, 11, 323, 1605, 71783, 2163, 10924, 1694, 66185, 198, 630, 3852, 4207, 12004, 1108, 20472, 13, 7648, 527, 258, 61694, 323, 28879, 750, 16236, 481, 311, 1820, 17156, 7058, 1543, 2547, 1174, 13461, 422, 19041, 1051, 904, 61694, 34072, 2163, 11, 20670, 1053, 10418, 1693, 291, 29948, 198, 10924, 279, 50937, 323, 11742, 6514, 627, 1758, 13, 19, 13, 17, 362, 8269, 8922, 315, 29560, 38925, 198, 2181, 285, 21974, 430, 1820, 62626, 907, 315, 45444, 52090, 15812, 48121, 830, 533, 9210, 20000, 14172, 14386, 275, 38925, 198, 1073, 1820, 33, 19521, 662, 83896, 279, 4734, 902, 1124, 337, 52090, 706, 46696, 1555, 11, 420, 285, 198, 84270, 12266, 13, 5629, 315, 543, 63738, 33, 55911, 38925, 527, 13284, 88045, 13, 20902, 31548, 1385, 315, 13284, 198, 548, 17249, 311, 49818, 337, 52090, 2391, 1202, 98550, 554, 13, 2100, 1820, 33, 55911, 38925, 1053, 4950, 1056, 8905, 627, 16041, 11, 426, 55911, 38925, 527, 15886, 291, 555, 20559, 520, 17206, 1097, 4414, 349, 9499, 13, 2435, 527, 3913, 7058, 23771, 398, 14763, 555, 1820, 12156, 8798, 323, 4930, 50937, 892, 2631, 304, 339, 752, 41948, 315, 7472, 7058, 287, 22337, 52090, 627, 1758, 13, 19, 13, 18, 33518, 52090, 482, 362, 7839, 445, 710, 1413, 198, 791, 34210, 9210, 1820, 67776, 562, 315, 45444, 52090, 3135, 1280, 72, 1138, 41033, 477, 325, 12116, 311, 19553, 453, 710, 7058, 1413, 2515, 285, 16157, 430, 1820, 2664, 374, 56605, 287, 311, 84965, 315, 576, 359, 1336, 7298, 638, 3691, 439, 198, 28863, 398, 323, 439, 1888, 433, 649, 13, 1102, 374, 6724, 53924, 449, 48131, 3966, 477, 5865, 627, 47, 5253, 2112, 51380, 14238, 11, 1054, 32, 1546, 492, 1935, 30912, 300, 33076, 1285, 315, 45444, 52090, 304, 83697, 3090, 68702, 34263, 49216, 39, 762, 2784, 919, 430, 3233, 71, 619, 539, 23609, 810, 1109, 420, 300, 275, 18864, 49394, 349, 499, 13, 5414, 2664, 374, 198, 85134, 2458, 616, 71, 5861, 11793, 719, 383, 285, 1962, 75919, 13, 578, 2664, 8964, 1148, 374, 66652, 3416, 323, 198, 12840, 374, 1962, 84172, 15436, 2203, 9186, 315, 3852, 1336, 7298, 638, 3691, 1778, 1089, 359, 39853, 19595, 13, 1472, 14724, 198, 1897, 491, 483, 438, 3646, 4461, 690, 53757, 810, 13, 12040, 15436, 2203, 9186, 315, 45444, 52090, 323, 9514, 14724, 1395, 198, 318, 44287, 14363, 13, 2684, 690, 387, 912, 64804, 369, 810, 34696, 6261, 264, 4799, 323, 656, 539, 21109, 6261, 627, 56, 788, 71, 619, 1101, 387, 20111, 315, 339, 830, 533, 9210, 576, 5481, 3416, 374, 1962, 3323, 3779, 10390, 337, 52090, 198, 8248, 285, 61917, 3970, 304, 3646, 32720, 26390, 13, 1666, 9514, 33134, 1174, 67, 4588, 26390, 527, 838, 13429, 38314, 198, 998, 77492, 3978, 9493, 814, 527, 1073, 19045, 4367, 662, 11458, 1174, 9493, 12020, 449, 83778, 324, 40589, 345, 45010, 26390, 3719, 25114, 12025, 383, 5481, 19941, 449, 902, 814, 527, 83, 2920, 323, 5562, 2646, 198, 1395, 27073, 627, 4438, 649, 9514, 34551, 553, 83778, 324, 12020, 26390, 30, 64285, 555, 339, 762, 795, 662, 2746, 339, 830, 21702, 529, 1156, 795, 198, 285, 73216, 323, 359, 44066, 2867, 1174, 411, 300, 82850, 12020, 13, 1442, 339, 830, 21702, 529, 1156, 795, 374, 67, 620, 323, 278, 2433, 198, 65561, 819, 11, 1243, 1455, 4461, 78942, 300, 1962, 9833, 708, 11, 1373, 279, 17298, 994, 12096, 1521, 47237, 198, 67, 4588, 26390, 13, 13596, 9250, 4623, 1053, 1297, 347, 894, 22479, 1866, 13, 5492, 3691, 409, 26233, 3046, 198, 277, 486, 329, 1570, 2561, 323, 3055, 276, 327, 25777, 2683, 1073, 67, 28609, 323, 24544, 20073, 26390, 13, 1115, 1648, 198, 9514, 33134, 369, 19643, 430, 339, 830, 21702, 574, 1073, 327, 25777, 4367, 323, 77, 56809, 19941, 1051, 3779, 311, 198, 49818, 2391, 279, 46479, 1920, 627, 1758, 13, 19, 13, 19, 22208, 423, 37901, 198, 37707, 40589, 6962, 285, 7642, 750, 9124, 304, 339, 762, 2925, 592, 290, 11, 66266, 11, 477, 809, 7058, 32199, 315, 74441, 477, 1220, 5807, 3171, 11, 374, 15456, 304, 1820, 1334, 438, 76353, 60985, 555, 543, 77896, 627, 2181, 380, 383, 12085, 2027, 315, 22631, 592, 290, 315, 74441, 3630, 347, 11, 902, 279, 2664, 57759, 3916, 1555, 198, 339, 301, 29222, 297, 3833, 61334, 988, 1555, 279, 64381, 36371, 304, 324, 483, 11, 477, 258, 32390, 29579, 1555, 279, 37282, 627, 16179, 12782, 40589, 374, 29844, 304, 1820, 1334, 2984, 1244, 383, 320, 7717, 78, 9274, 220, 20, 34971, 422, 20000, 2259, 198, 66335, 12472, 1109, 420, 11, 433, 8723, 1634, 459, 359, 19975, 481, 8547, 315, 69292, 79, 33252, 449, 3026, 7058, 51977, 22047, 323, 690, 5353, 4648, 555, 56868, 282, 2328, 627, 37707, 40589, 6962, 285, 2656, 304, 339, 16357, 4830, 554, 315, 45444, 52090, 11, 12782, 660, 21662, 323, 198, 84707, 398, 1511, 304, 9235, 10054, 627, 50, 363, 1247, 3409, 430, 74441, 40589, 374, 675, 5642, 2027, 2728, 1022, 1729, 1820, 2664, 662, 1687, 19171, 198, 33134, 430, 422, 44338, 839, 304, 17185, 6173, 82, 433, 4919, 1407, 5278, 589, 13, 6658, 263, 354, 6539, 295, 33134, 198, 12840, 6372, 433, 14724, 19553, 994, 3779, 311, 414, 14239, 1672, 30632, 33776, 13, 12540, 14739, 731, 279, 198, 331, 685, 30, 1666, 31916, 88364, 1705, 584, 34360, 9955, 606, 279, 817, 1073, 782, 1055, 477, 359, 782, 1055, 3273, 19941, 13, 1226, 198, 18864, 9855, 11, 4869, 1174, 9210, 333, 20000, 5481, 3416, 788, 304, 606, 630, 320, 1334, 705, 433, 14724, 19171, 387, 5481, 3416, 788, 198, 258, 2500, 320, 14239, 4390, 1758, 13, 19, 13, 20, 2405, 24527, 27456, 50234, 198, 3438, 24527, 27456, 13935, 374, 1962, 3323, 1511, 304, 339, 16357, 4830, 554, 315, 45444, 52090, 719, 285, 19171, 17249, 311, 198, 74441, 660, 8579, 3696, 15872, 13, 1102, 87034, 337, 688, 902, 374, 2656, 311, 13397, 682, 1820, 1040, 33462, 812, 304, 45670, 7058, 79, 801, 304, 278, 33089, 1376, 13, 1115, 13935, 11, 4184, 311, 1820, 27814, 377, 11630, 3135, 9097, 3714, 535, 198, 22464, 82, 505, 77773, 367, 11, 6930, 3729, 11, 8071, 6421, 11, 323, 287, 43598, 13, 1102, 14724, 19171, 5353, 2254, 198, 92724, 13, 1115, 374, 2500, 25114, 21109, 627, 1758, 13, 19, 13, 21, 46701, 4969, 198, 644, 1382, 259, 94006, 2752, 3249, 420, 2008, 1333, 11, 902, 374, 17249, 55961, 7770, 15657, 2737, 198, 45444, 52090, 11, 374, 32550, 788, 11, 289, 336, 592, 3619, 1148, 433, 380, 9379, 906, 548, 451, 6260, 449, 13, 46701, 198, 1799, 6127, 383, 1799, 41565, 8625, 315, 48999, 25896, 13, 4969, 41565, 374, 74128, 279, 74441, 8625, 198, 10924, 20252, 477, 383, 1113, 1521, 25896, 13, 22208, 374, 613, 336, 950, 2449, 902, 374, 29844, 304, 198, 543, 477, 25893, 292, 33155, 13, 4314, 2997, 28896, 11, 62345, 11, 323, 50127, 627, 4599, 86801, 801, 8649, 12782, 33511, 449, 24463, 304, 1820, 2664, 1174, 17947, 285, 198, 2808, 261, 660, 323, 74441, 40589, 374, 10365, 13, 22208, 706, 325, 17998, 11742, 4519, 430, 7072, 198, 275, 9782, 439, 2642, 4159, 369, 14789, 13, 4452, 1174, 333, 45010, 4519, 527, 278, 34259, 48863, 439, 198, 20670, 527, 59723, 279, 723, 684, 315, 20559, 11, 53057, 3135, 1253, 12446, 662, 2181, 285, 587, 4262, 2144, 9210, 198, 1820, 1799, 41565, 14454, 389, 1799, 41565, 2967, 2230, 4179, 10011, 902, 264, 417, 12255, 1677, 398, 35661, 3432, 527, 198, 7063, 18595, 57118, 13, 1102, 285, 1147, 454, 24576, 430, 1820, 38377, 367, 315, 339, 762, 52745, 2449, 304, 582, 1982, 291, 15657, 198, 29177, 617, 31959, 16296, 389, 414, 12393, 13, 578, 723, 684, 315, 20337, 1181, 10390, 337, 52090, 198, 4345, 4737, 420, 2027, 832, 3094, 4726, 1523, 279, 36865, 315, 279, 30774, 3691, 43539, 13, 1758, 13, 19, 13, 22, 92479, 483, 198, 1163, 9761, 483, 374, 5581, 398, 1511, 439, 675, 977, 4087, 3125, 459, 901, 613, 13, 18152, 311, 1517, 414, 520, 3443, 198, 18753, 14175, 15068, 11, 433, 86258, 398, 17051, 279, 1517, 414, 323, 901, 14576, 433, 5902, 13, 3459, 3852, 1667, 264, 198, 1517, 414, 83451, 2663, 4701, 1994, 574, 2656, 11, 3156, 9635, 529, 274, 9023, 1345, 85886, 1729, 11352, 430, 9219, 1994, 198, 936, 2656, 4401, 18809, 438, 93221, 82189, 1280, 27403, 13, 578, 12369, 323, 78893, 7735, 76063, 7058, 28491, 11, 1234, 586, 7410, 11, 5616, 65106, 291, 279, 901, 613, 13, 2030, 1820, 72967, 483, 12704, 14576, 1511, 198, 31213, 1174, 37241, 27458, 1089, 5763, 1729, 1820, 82169, 11, 527, 12156, 398, 21503, 3273, 19941, 13, 50616, 3714, 4010, 72967, 579, 345, 1348, 87, 1545, 11, 374, 25727, 46657, 535, 63244, 819, 14071, 6962, 8370, 374, 396, 61132, 85077, 311, 58331, 345, 37282, 323, 76, 1791, 12252, 13, 93012, 367, 1253, 5353, 70524, 1608, 9355, 323, 30132, 54308, 425, 13, 14968, 576, 285, 198, 17249, 311, 15657, 627, 1758, 13, 20, 13, 14727, 38333, 763, 33518, 52090, 198, 44, 337, 52090, 5727, 220, 24, 4, 1003, 438, 1114, 13, 20, 4, 12571, 13, 3011, 17610, 315, 63995, 70002, 974, 5636, 682, 198, 1073, 16142, 28006, 65543, 1306, 279, 21315, 315, 5902, 13465, 2737, 17614, 11, 71783, 323, 198, 32056, 88959, 627, 50982, 337, 52090, 374, 86, 11073, 1109, 38291, 13465, 439, 275, 7063, 4108, 449, 433, 543, 1820, 14176, 83465, 315, 198, 1116, 1619, 13465, 5636, 279, 17249, 62186, 13, 1666, 26833, 57116, 11, 584, 56605, 311, 5957, 2890, 323, 198, 1962, 15886, 433, 51861, 584, 287, 478, 1778, 520, 354, 750, 653, 1336, 7298, 638, 323, 15719, 26928, 2027, 439, 6489, 7058, 34968, 11, 584, 548, 376, 3988, 33812, 2324, 13, 423, 2303, 414, 2547, 8136, 3372, 323, 15357, 354, 47530, 3273, 19941, 719, 198, 47530, 433, 10633, 369, 2324, 304, 279, 1376, 315, 4459, 7878, 26390, 11, 24822, 11, 31049, 323, 19595, 627, 31887, 59161, 7630, 7169, 1057, 5192, 2370, 75751, 26488, 449, 1778, 3273, 19941, 33928, 337, 52090, 11, 1005, 72408, 198, 269, 32720, 26390, 323, 701, 10437, 26588, 690, 22225, 387, 20097, 627, 1758 ]
0xBreath/holistic-books
ills, powders, liq- uids) inthevain hope ofsupplying missing nutrients. Itcan’tbedone! Inthelesson about food supplements, youlearned thatthese products areuseless, andeven damag- ing. 49.11. Four Methods There are four methods of gardening: 1.Natural—This method does notpoison thesoil, butdoes deplete it,especially ofnitro- gen, and its productivity gradually decreases. 2.Chemical—This method increases theproduction thefirst andsecond years, atthecost offlavor andnutritional value (lower protein content andhigher carbohydrate content) anddestruction totheenvironment. Theplants must relyonartificial chemicals tostim- ulate their growth, and, astime goes on,more andmore chemicals areneeded and problems increase. Insects mutate anddevelop resistant strains, themicroor ganisms and earthworms inthesoilarekilled bythechemicals, andthefarmer orgardener develops neurological diseases from inhaling the sprays or absorption through the skin. 3.Organic—This method replenishes thesoil, andisthemethod described andadvocated inthislesson, toproduce abetter -quality crop, without poisoning thefood, theenviron- ment, orthegardener.Theorganic gardener uses only organic materials (organized liv- ing matter).4.Biodynamic—The term “biodynamic” refers to“working with theenergieswhich create andmaintain life.” This method ofagriculture uses organic methods, including compost, butalso uses herbal preparations tospray theplants andtrees. Thebasic ingredient of thebiodynamic spray isaspecially-prepared colloidal clay compound. Thespray flows into allsmall cracks andcrevices oftheplant andforms aprotective film, tohelp in healing minor lesions, butdoes notinterfere with therespiration oftheplant. Thespray also contains very lowpercentages ofsuch insecticides asryania, rotenone, pyrethrum, andquassia, farbelow customary concentrations, because thespray isnotintended asan eradicator.These insecticides areplant extractives, butarenotcompletely harmless, as indicated previously.Therecommendation istowait fourteen days after spraying before harvesting. Thebiodynamic spray isalso available without theinsecticides. Thebiody- namic spray isalso said toenable theplants toderive certain nutrients from theatmos- phere. This system wasoriginally started byRudolph Steiner,anddeveloped byDr.E. E.Pfeiffer.Thebiodynamic method ismore sophisticated, more complicated, andmore work than theorganic methods described inthislesson. Wetried biodynamic methods inIndiana, butfound them more difficult andnomore productive than simpler organic methods. Anamusing illustration ofthedifference between natural andorganic methods isa story toldbyDr.Alec Burton atAmerican Natural Hygiene Society Conventions about agentleman who came toYorkshire, England, andtook over anextremely dilapidated property.Hedidagreat deal ofwork onthisproperty,renovating itandgetting itintoa beautiful condition, and, eventually,people came from miles around toadmire andap- preciate hisgarden. One daythelocal priest came toseeit,andsaid, “What abeautiful garden youhave!” Theman said, “Yes,it’sbeen hard work, andI’ve done itallbymy- self.” “No,” said thepriest, “with thehelp oftheLord.” Theman said, “All right—with the help of the Lord, but you should have seen it when he was doing it by himself.” There isquite abitofinformation available fortheorganic gardener who warns to learn how togetmaximum results. How toGrowVegetables andFruits bytheOrganic Method byJ.I.Rodale andstaff(mentioned previously) isanexcellent comprehensive reference book, listing practically allvarieties offood plants, with detailed planting in- structions for each. Forthose who want afewsimple rules forgrowing food with aminimum oftime andenergy,moderate success canbeanticipated bysimply using organic methods, in- stead of chemicals; and mulching instead of cultivating and weeding. 49.12. No Space For A Garden? 49.12.1 Do The Best Y ou Can Ifyouliveinanapartment orcondominium anddon’thave space foraregular gar- den, youcanstillgrow some ofyour own food onyour porch orpatio. Youcanuse boxes, barrels, ormake awall garden. Small plants likelettuce, squash, cucumbers, or strawberries need boxes only four tosixinches high. Tomatoes, peppers, cauliflower, andcabbage need more space fortheir roots, andthese boxes should beatleast tenor twelve inches high. Vinebranching plants (cucumbers, squash, melons) canbetrained tospread over thepatio floor (concrete orwhatever). They require little boxspace. Grapevines canbe planted along a building wall or fence. Youcanbuild awall garden anywhere youhave alittle space. Annie Silvan describes awall garden andhow tobuild it.Shesays thatitislikealargeblock orwall ofsoilwith plants growing outofallsides. “Youwill need four one-by-six boards twofeetlong, four one-by-six boards fivefeetlong andatleast 14two-by-two poles four feetlong.” Make twobottomless boxes outoftheone-by-sixes —aframe forthetopandoneforthebottom. Nail thetwo-by-twos tothese frames, onefootapart. Itwilllook something like acage with vertical bars. Leave thebottom andthetopopen, butlineallsides (inside) with open mesh wire andthen black plastic. Secure themesh with wire. Place thewall initspermanent position, fillwith soil, andwater from thetopsothesoilwillsettle. Use tomatoes androot vegetables atthetop; lettuce, strawberries, cabbage, cauliflower,or anyleafy greens onthesides. Make little holes intheplastic toinsert theplants. Water all around and on top. Patio tomatoes (inpots) areeasy togrow.Leaf structure iseasy togrow.Ionce grew some inseveral largeflower pots. Youcangrow sunflower seeds tothegreen leafstage inflats bypressing unhulled seeds intothesoilandkeeping them moist. They areready forharvesting inaweek. Buckwheat, adzuki beans, lentils, mung beans, oranyother seeds orbeans canbegrown thesame way,andwillproduce aproduct which issuperior nutritionally toseeds sprouted with only water,since they will have thebenefit ofthe earth, sun and outside air. When noother way ispossible, sprout your seeds onyour kitchen counter injarsor other containers. Weusealfalfa sprouts almost daily.Alfalfa isknown tocontain trace minerals which may belacking inother plants. Theroot system offield-grown alfalfa reaches down asdeeply asfifteen feetintothesubsoil, picking upminerals notpresent higher up, and these minerals are, of course, present in the seeds in the sprouts. 49.12.1 Do The Best You Can Grow asmuch organic food asyoupossibly can. Seek outandshare with other or- ganic growers. Import organically-grown nuts, seeds, anddried fruits from other areas. Keep trying to produce or obtain fresh or ganically-grown produce. Fortherest(ifany) some compromises may benecessary.Getthebest-quality food obtainable, wash inplain water,peel waxed fruits andvegetables, anddothebest you can. Trytoobtain foods grown ondifferent soils, indifferent parts ofthecountry,toin- sure obtaining avariety oftrace minerals which may have been damaged ordestroyed in certain areas: Ifyoueatmost ofyour food uncooked, youwillstillattain ahigher degree of health than conventional eaters. 49.13. Harvest Of Pleasure And Health Ibelieve there willbeafewwho willdispute theenvironmental improvements thatwill accrue because ofthedeemphasis onchemicals andpoisons, advocated bytheorganic gardener.Ifyoulearn about, andimplement, organic gardening methods, youwillalso find them practical, convenient, agreeable, and economical. And there issomuch personal satisfaction inthecreation ofliving plants incoop- eration with theforces ofnature—you come toregard your plants andtrees aschildren whom you love and foster, and who respond by giving you their fruits. What ismore rewarding andthrilling than seeing thefirstseedlings, ortheblossoms, orthefruits ready toharvest? But, bestofall,thefood youharvest willbeflavorful and delicious, bursting with thenutrients youhave helped tosupply; andclean andfreeof residues of chemical fertilizers and poison sprays. The, only way toobtain afullcomplement ofallthevitamins, minerals, enzymes, hormones, chlorophyll, carbohydrates, andother substances (known andunknown) in ideal combinations, isbye
[ 3385, 11, 7019, 12601, 11, 908, 80, 7058, 92316, 8, 304, 1820, 85, 467, 3987, 315, 95783, 287, 7554, 37493, 13, 1102, 4919, 1431, 2788, 606, 0, 763, 1820, 28595, 198, 9274, 3691, 33690, 11, 499, 12964, 291, 430, 45010, 3956, 527, 817, 1752, 11, 323, 17206, 3824, 351, 7058, 287, 627, 2491, 13, 806, 13, 13625, 19331, 198, 3947, 527, 3116, 5528, 315, 60299, 512, 16, 2112, 4688, 2345, 2028, 1749, 1587, 539, 5481, 3416, 279, 708, 321, 11, 719, 28156, 409, 5282, 433, 11, 36046, 315, 45168, 299, 7058, 4469, 11, 323, 1202, 26206, 27115, 43154, 627, 17, 6487, 336, 950, 2345, 2028, 1749, 12992, 279, 23452, 279, 3983, 323, 5686, 1667, 11, 520, 339, 762, 537, 198, 1885, 75, 3372, 323, 24217, 37842, 907, 320, 15115, 13128, 2262, 323, 90447, 67732, 2262, 340, 438, 451, 3099, 311, 1820, 24175, 13, 578, 64805, 2011, 17631, 263, 472, 16895, 26333, 311, 54754, 7058, 6468, 872, 6650, 11, 323, 11, 12025, 547, 5900, 389, 11, 6518, 323, 6518, 26333, 527, 41917, 323, 198, 96440, 5376, 13, 763, 55529, 68282, 323, 16219, 31785, 42400, 11, 1124, 2823, 269, 25893, 13978, 323, 198, 28641, 56741, 82, 304, 6509, 74913, 548, 74, 4473, 555, 1820, 32056, 82, 11, 323, 339, 830, 277, 1195, 1262, 569, 804, 39671, 198, 818, 2868, 31356, 19338, 505, 60537, 6260, 279, 8314, 954, 477, 44225, 1555, 279, 6930, 627, 18, 8548, 8609, 292, 2345, 2028, 1749, 70543, 21168, 279, 708, 321, 11, 323, 380, 30132, 1086, 7633, 323, 14625, 511, 660, 198, 258, 576, 28595, 11, 311, 98374, 671, 22120, 482, 10692, 19641, 11, 2085, 52236, 279, 14239, 11, 279, 268, 2842, 7058, 479, 11, 30299, 797, 569, 804, 662, 791, 61694, 22641, 804, 5829, 1193, 17808, 7384, 320, 63316, 15471, 7058, 287, 5030, 570, 19, 1823, 72, 61002, 2345, 791, 4751, 1054, 8385, 61002, 863, 19813, 311, 2118, 21837, 449, 279, 804, 68469, 8370, 1893, 198, 438, 67913, 467, 2324, 2029, 1115, 1749, 315, 351, 2265, 10745, 5829, 17808, 5528, 11, 2737, 57823, 345, 8248, 19171, 5829, 51487, 47979, 311, 52773, 352, 279, 64805, 323, 91512, 13, 578, 23144, 25795, 315, 198, 1820, 8385, 61002, 23749, 374, 300, 4899, 22041, 7360, 82048, 26966, 37148, 24549, 13, 666, 288, 91704, 28555, 198, 18614, 682, 9181, 45963, 323, 846, 85, 1238, 315, 1820, 21494, 323, 10008, 264, 47079, 535, 4632, 11, 311, 8823, 304, 198, 383, 6260, 9099, 63324, 11, 719, 28156, 539, 2295, 69, 486, 449, 92779, 29579, 315, 1820, 21494, 13, 666, 288, 91704, 198, 19171, 5727, 1633, 3428, 25426, 1154, 315, 21470, 27080, 76195, 439, 894, 9345, 11, 938, 2002, 606, 11, 4611, 265, 339, 10952, 345, 438, 447, 395, 689, 11, 3117, 54277, 73348, 32466, 11, 1606, 279, 52773, 352, 374, 1962, 396, 2954, 439, 276, 198, 261, 329, 13557, 662, 9673, 27080, 76195, 527, 21494, 8819, 1924, 11, 719, 548, 1962, 884, 50268, 53997, 11, 439, 198, 485, 10297, 8767, 662, 3947, 31628, 367, 6127, 363, 1339, 63360, 2919, 1306, 83636, 1603, 198, 13279, 7164, 287, 13, 578, 8385, 61002, 23749, 374, 19171, 2561, 2085, 279, 258, 9885, 76195, 13, 578, 8385, 1094, 7058, 77, 4079, 23749, 374, 19171, 1071, 311, 12837, 279, 64805, 311, 28197, 3738, 37493, 505, 47213, 8801, 7058, 8182, 13, 1115, 1887, 574, 8781, 750, 3940, 555, 49, 664, 44070, 3441, 10670, 1174, 438, 16219, 291, 555, 9023, 5253, 627, 36, 1087, 1897, 14657, 662, 791, 8385, 61002, 1749, 374, 6518, 27877, 11, 810, 17395, 11, 323, 6518, 198, 1816, 1109, 279, 61694, 5528, 7633, 304, 576, 28595, 13, 45956, 4588, 6160, 61002, 5528, 198, 258, 89849, 11, 719, 15456, 1124, 810, 5107, 323, 17101, 461, 27331, 1109, 35388, 17808, 198, 36842, 627, 2127, 309, 985, 40134, 315, 79371, 18691, 1990, 5933, 323, 61694, 5528, 52435, 198, 27583, 3309, 1729, 9023, 885, 35853, 54755, 520, 29518, 18955, 10320, 43312, 13581, 1221, 31759, 922, 198, 8252, 273, 1543, 889, 3782, 311, 100077, 15255, 11, 9635, 11, 323, 91453, 927, 459, 428, 54358, 19371, 44221, 660, 198, 3784, 662, 39, 291, 307, 351, 1244, 3568, 315, 1816, 389, 576, 3784, 1174, 1466, 869, 1113, 433, 438, 51210, 433, 18614, 64, 198, 88044, 3044, 11, 323, 11, 9778, 1174, 16455, 3782, 505, 8931, 2212, 311, 48029, 556, 323, 391, 7058, 63553, 349, 813, 70, 8506, 13, 3861, 1938, 339, 301, 3768, 28185, 3782, 311, 4151, 275, 11, 2914, 3864, 11, 1054, 3923, 671, 68, 35777, 198, 70, 8506, 499, 19553, 18319, 666, 16357, 1071, 11, 1054, 9642, 80824, 753, 82850, 2653, 990, 11, 323, 40, 4070, 2884, 433, 543, 65, 1631, 88, 7058, 726, 2029, 1054, 2822, 2476, 1071, 279, 69708, 478, 11, 1054, 4291, 279, 8823, 315, 1820, 52182, 2029, 666, 16357, 1071, 11, 1054, 2460, 1314, 81902, 198, 1820, 1520, 315, 279, 10425, 11, 719, 499, 1288, 617, 3970, 433, 994, 568, 574, 3815, 433, 555, 5678, 49216, 3947, 374, 84270, 671, 275, 1073, 26125, 2561, 369, 1820, 61694, 22641, 804, 889, 49140, 311, 198, 12964, 1268, 311, 456, 40287, 3135, 13, 2650, 311, 57888, 43712, 456, 4893, 323, 37, 68998, 555, 1820, 24105, 292, 198, 3607, 555, 41, 2506, 2056, 347, 1604, 323, 28221, 7, 37691, 8767, 8, 374, 276, 327, 25777, 16195, 198, 16690, 2363, 11, 15182, 32367, 682, 959, 32606, 315, 14239, 11012, 11, 449, 11944, 48114, 304, 7058, 20232, 369, 1855, 627, 37, 2419, 974, 889, 1390, 8136, 365, 23796, 5718, 11809, 25156, 3691, 449, 264, 39088, 315, 1712, 198, 438, 17947, 1174, 2658, 59768, 2450, 649, 1395, 93878, 555, 15124, 2603, 1701, 17808, 5528, 11, 304, 7058, 43280, 315, 26333, 26, 323, 15975, 28075, 4619, 315, 99139, 323, 584, 16490, 627, 2491, 13, 717, 13, 2360, 11746, 1789, 362, 19558, 5380, 2491, 13, 717, 13, 16, 3234, 578, 7252, 816, 6033, 3053, 198, 2746, 9514, 25859, 74276, 391, 3275, 477, 1321, 8129, 2411, 323, 15357, 529, 339, 525, 3634, 369, 548, 70, 1299, 7515, 7058, 5294, 11, 499, 4919, 44466, 67318, 1063, 315, 22479, 1866, 3691, 389, 22479, 45747, 477, 4781, 822, 13, 1472, 4919, 817, 198, 22995, 11, 42975, 11, 477, 7072, 1384, 543, 13863, 13, 15344, 11012, 1093, 28163, 10743, 11, 59576, 11, 75391, 372, 1941, 11, 477, 198, 496, 675, 36989, 1205, 15039, 1193, 3116, 311, 82, 21088, 8696, 1579, 13, 8529, 20798, 11, 58573, 11, 96970, 13801, 438, 66, 57589, 1205, 810, 3634, 369, 50828, 20282, 11, 323, 45010, 15039, 1288, 9567, 56371, 5899, 269, 198, 15930, 21903, 15271, 1579, 627, 53, 483, 18424, 287, 11012, 320, 66, 1791, 372, 1941, 11, 59576, 11, 10804, 2439, 8, 649, 65, 17820, 2692, 311, 59295, 927, 198, 339, 752, 6400, 6558, 320, 444, 9537, 477, 69386, 570, 2435, 1397, 2697, 3830, 8920, 13, 80629, 85, 1572, 649, 1395, 198, 501, 7719, 3235, 264, 4857, 7147, 477, 25675, 627, 2675, 4919, 5957, 1384, 543, 13863, 12660, 499, 19553, 453, 2433, 3634, 13, 53089, 8211, 16023, 16964, 198, 675, 543, 13863, 323, 5269, 311, 5957, 433, 11086, 288, 954, 430, 20000, 4908, 278, 2812, 4677, 477, 16836, 315, 708, 321, 4291, 198, 64805, 7982, 704, 1073, 5700, 3422, 13, 1054, 2675, 14724, 1205, 3116, 832, 14656, 55541, 21126, 4483, 1073, 68, 295, 4930, 345, 35124, 832, 14656, 55541, 21126, 4330, 1897, 295, 4930, 323, 266, 56371, 220, 975, 20375, 14656, 38502, 51879, 3116, 7693, 4930, 49216, 8238, 4483, 677, 2896, 1752, 15039, 704, 1073, 1820, 606, 14656, 55541, 288, 2001, 64, 6906, 13544, 295, 454, 438, 606, 2000, 1820, 15205, 13, 75528, 279, 20375, 14656, 98662, 437, 311, 45010, 14418, 11, 389, 830, 1944, 391, 472, 13, 1102, 14724, 7349, 2555, 1093, 198, 582, 425, 449, 12414, 16283, 13, 26257, 279, 15205, 323, 339, 295, 454, 2569, 11, 719, 1074, 5700, 3422, 320, 42450, 340, 4291, 1825, 11546, 9244, 323, 3473, 3776, 12466, 13, 35602, 1124, 4385, 449, 9244, 13, 11004, 279, 16836, 198, 258, 1220, 98524, 2361, 11, 5266, 4291, 17614, 11, 323, 13284, 505, 279, 3565, 708, 6509, 74913, 14724, 751, 11489, 13, 5560, 198, 38501, 20798, 323, 2959, 24822, 520, 339, 295, 454, 26, 71655, 11, 76203, 11, 74873, 11, 96970, 1174, 269, 198, 276, 982, 2642, 88, 52011, 389, 6509, 3422, 13, 7557, 2697, 20349, 304, 1820, 501, 5174, 311, 4302, 279, 64805, 13, 10164, 198, 543, 2212, 323, 389, 1948, 627, 47, 6400, 41613, 320, 43192, 2469, 8, 527, 46122, 13445, 654, 662, 32561, 6070, 374, 46122, 13445, 654, 662, 40, 13486, 14264, 198, 15031, 54682, 17998, 3544, 39853, 51131, 13, 1472, 66, 526, 654, 7160, 39853, 19595, 311, 339, 797, 4542, 16312, 21406, 198, 258, 1517, 1900, 555, 1911, 287, 31175, 92122, 19595, 1139, 6509, 74913, 438, 33494, 1124, 21147, 13, 2435, 802, 486, 7759, 198, 2000, 13279, 7164, 287, 304, 85277, 1247, 13, 27156, 86, 20559, 11, 1008, 89, 22227, 27994, 11, 48907, 8839, 11, 296, 2234, 27994, 11, 477, 3852, 1605, 198, 325, 6910, 477, 28440, 649, 52253, 4935, 279, 25030, 1648, 51526, 14724, 98374, 264, 3107, 902, 2425, 3550, 2521, 198, 83664, 750, 311, 325, 6910, 8314, 19042, 449, 1193, 3090, 1174, 11536, 814, 690, 617, 279, 68244, 275, 315, 1820, 198, 28641, 11, 7160, 323, 4994, 3805, 16853, 4599, 912, 1605, 1648, 374, 10236, 11, 8314, 412, 701, 19595, 389, 22479, 9979, 5663, 5934, 1590, 269, 198, 1605, 24794, 13, 1226, 817, 3181, 85526, 8314, 11934, 4661, 7446, 662, 2149, 69, 85526, 374, 5391, 311, 53195, 11917, 198, 1083, 17822, 902, 1253, 1689, 9162, 304, 1605, 11012, 13, 23258, 1944, 1887, 1022, 823, 2427, 4935, 85766, 85526, 198, 265, 14576, 1523, 439, 33980, 398, 439, 69, 333, 15247, 7693, 18614, 6509, 392, 708, 321, 11, 21816, 709, 1083, 17822, 539, 29844, 198, 90447, 709, 11, 323, 1521, 34072, 527, 11, 315, 3388, 11, 3118, 304, 279, 19595, 304, 279, 8314, 11934, 627, 2491, 13, 717, 13, 16, 3234, 578, 7252, 1472, 3053, 198, 57888, 33928, 1412, 17808, 3691, 439, 9514, 54228, 649, 13, 30839, 704, 438, 19930, 449, 1023, 477, 7058, 30528, 292, 70077, 13, 13516, 2942, 2740, 2427, 4935, 31049, 11, 19595, 11, 323, 67, 4588, 26390, 505, 1023, 5789, 627, 19999, 4560, 311, 8356, 477, 6994, 7878, 477, 25893, 2740, 2427, 4935, 8356, 627, 2520, 700, 478, 34433, 3852, 8, 1063, 92546, 1253, 3399, 20726, 662, 1991, 1820, 16241, 22867, 3691, 198, 677, 23771, 481, 11, 11623, 304, 21435, 3090, 1174, 375, 301, 37123, 291, 26390, 323, 83571, 4893, 11, 323, 3055, 1820, 16241, 499, 198, 4919, 13, 9934, 998, 677, 23771, 15657, 15042, 389, 64750, 69561, 11, 80008, 5596, 315, 339, 762, 5083, 1174, 998, 258, 7058, 19643, 19546, 264, 30265, 2676, 315, 15417, 34072, 902, 1253, 617, 1027, 20727, 477, 15886, 291, 304, 198, 66, 7770, 5789, 25, 1442, 9514, 33166, 3646, 315, 22479, 3691, 653, 99797, 11, 499, 14724, 44466, 1617, 467, 264, 90447, 8547, 198, 1073, 2890, 1109, 21349, 8343, 388, 627, 2491, 13, 1032, 13, 56935, 5046, 33540, 4058, 1628, 6401, 198, 40, 9978, 19704, 1070, 690, 1395, 2642, 365, 14965, 690, 4338, 8660, 279, 24175, 278, 18637, 430, 14724, 198, 4575, 81, 361, 1606, 315, 339, 15686, 87292, 389, 32056, 82, 323, 5481, 19941, 11, 64854, 555, 1820, 61694, 198, 54592, 804, 662, 2746, 9514, 12964, 922, 11, 323, 95574, 11, 17808, 60299, 5528, 11, 499, 14724, 19171, 198, 3990, 1124, 15325, 11, 17125, 11, 7655, 481, 11, 323, 60618, 627, 3112, 1070, 2425, 316, 1412, 4443, 24617, 304, 339, 762, 27551, 315, 64275, 11012, 304, 87957, 7058, 21597, 449, 279, 49896, 315, 67812, 71480, 2586, 311, 1610, 569, 701, 11012, 323, 91512, 439, 5988, 198, 1336, 316, 499, 3021, 323, 31087, 1174, 323, 889, 6013, 555, 7231, 499, 872, 26390, 627, 3923, 374, 6518, 42093, 323, 61124, 9585, 1109, 9298, 279, 3983, 23425, 19342, 11, 477, 1820, 65, 9563, 7085, 345, 2419, 830, 68998, 5644, 311, 13279, 7164, 30, 2030, 11, 1888, 1073, 543, 11, 339, 830, 1411, 499, 13279, 7164, 690, 58747, 75, 3372, 1285, 323, 198, 9783, 9824, 11, 77850, 449, 1243, 332, 32930, 499, 19553, 9087, 311, 95783, 26, 323, 18883, 323, 10816, 1073, 198, 417, 307, 1157, 315, 11742, 36214, 12509, 323, 21109, 8314, 954, 627, 791, 11, 1193, 1648, 311, 677, 23771, 8136, 620, 884, 2833, 315, 543, 1820, 55911, 38925, 11, 34072, 11, 56067, 345, 71, 494, 3233, 11, 37833, 5237, 25734, 11, 62345, 11, 323, 1605, 33155, 320, 5391, 323, 16476, 8, 304, 198, 64053, 28559, 11, 374, 29474 ]
0xBreath/holistic-books
uppy.Thefurofboth was interrible condition, thin andvery short anddull looking. Foratime theanimals were fedonordinary dogfood plus scraps obtained from alocal slaughterhouse. The Collie wasasad-looking specimen. About three years agowedecided totryavegetarian dietonthedogs. Wefedthem sweet fruits inthemorning andacombination ofcooked and raw vegetables in the late afternoon. W e did give them a raw egg every other day. Theresults were amazing. Inacomparatively short time theDoberman hadashiny soft coat andtheCollie was araving beauty! WelosttheDoberman, unfortunately, through anaccidental injury,buttheCollie’ scoat offuristhick, very shiny andofa beautiful tri-color. Itwould appear most likely thatbaldheadedness inboth men andwomen istheresult ofyears ofmalnutrition, andinusing theterm “nutrition,” weinclude allphases ofnu- trition: absorption, assimilation, elimination, etc., aswell asthefeeding ofappropriate food inacorrect amount andmanner; plus, associate influencing factors, such astheob- taining of suf ficient sunlight, etc. Wehave already observed thatwhen thedietisimproved inhumans, new growth canoften beobserved butagain weshould point outthatsuch growth would bepossible only when the hair cells are still viable and not dead. Many researchers suggest using isolated vitamins tostimulate thescalp andthus im- prove thecondition ofthehairanditsgrowth. Dale Alexander comments how Dr.Her- man Goodman, aleading dermatologist, recommends foods which arerich invitaminA,foods such ascarrots. Hygienists, however,know thatthere areno“target” foods, thatwemust have thewhole spectrum andthatthisisprovided byeating avariety of foods, buteating them insuitable combinations soastomaximize availability tothebio- processes of the body. Itseems thatmost dermatologists have little understanding ofthefactthatwemust supply the“whole” offood, notbitsandpieces. Dr.Richard W.Muller who practices inseveral European capitols including Paris andVienna, recommends foods high insul- furcontent butthen notes thatironandcalcium arealsoimportant haircomponents. We recently hadaninquiry viathemails from anindividual who hadaproblem related to nutrition. Shesaid thatshewassitting with aboxofunopened pills andtablets bearing atotal price tagof$300.00 which hadbeen prescribed forher.These consisted ofall manner ofvitamin andmineral supplements. Shehadgreat doubt thatdosing herself this way wastheproper approach. Weadvised hertoreturn thewhole batch unopened and begin to eat the Hygienic way. Certainly,impaired digestion andpoor eating habits cancause allmanner ofbody troubles including disorders ofthescalp andhair; especially abnormal hairloss, eczema, carbuncles and, nodoubt, complete baldness, too.Most people eattoofastanddonot chew their food. Inexcess of90to95% ofthefoods they doeatarecooked andeven these foods arepoorly chosen. Itisnowonder aminimum ofnutrient wealth passes through thecells ofthemembranes lining theintestinal canal prior toentering theblood- stream fortransport tohaircells andallother body cells. Theaverage person pays for food, heeats“food,” butthebody cells failtoreceive thenutrients oflifeinsufficient quantity andintheir original symbiotic proportions todomore than sustain lifeandthis for but a brief span! Itislittle wonder thatthebody begins tosagandthatthehairbecomes lifeless and lacks suitable pigmentation, orthatscalps flake anditchandthateventually thehairfalls out. Werecently didabionutritional analysis andprofile foramother andson.Theresults were most revealing. Themother hasbeen afaithful follower ofNatural Hygiene foral- most three years now,thesonafaithful follower ofhispeer group dietofhambur gers, french fries, andcoke and, isnodoubt, likethevast majority ofhisagegroup, “into” drugs andalcohol, also. While themother ’stestrevealed almost allreadings within op- timal (not “average”) lines, the17-year -old son’sreadings were largely either above or below theoptimal with anumber ofthem registering inthe“dangerous” area. While oth- erfacts may account, nodoubt, forsome deviations, thecontrasts inthese twoinstances can rightfully, we believe, be attributed to the dif ferences in nutritional practices noted. Dr.Lucien Jacques ofParis worked with 71patients who suffered with disorders of theG.I.tract, allofwhom complained ofrapidly falling hair.Many ofthese patients al- sodrank excessive amounts oftea,coffee,andalcoholic beverages. Simply bychanging thedietofhispatients, Dr.Jacques notonly wasable toobserve better digestion inhis patients, but also remarkable changes in the health of the hair, including the coloring. White sugar,allmanufactured sweets such asicecream, pastries, candy,softdrinks, processed foods ofallkinds areacid-producing andnerve-destroying. Ifwewish topos- sess ahead covered with thick, shiny beautiful hair,wemust payattention tothefood anddrink. Wemust drink only thepurest ofwater andeatofthose foods towhich wehu- mans areadapted: luscious ripesweet fruits plus limited amounts ofyoung leafy greens and fruit vegetables (non-sweet fruits), sprouts, nuts and edible seeds. Iron isrequired forathick crop ofhair.Raisins, lettuce, strawberries, apples, cher- ries, and many other luscious fruits are well endowed with iron. Sulphur,anessential food element, isfound abundantly inmembers ofthecabbage family, in cucumbers, in potatoes, and figs. Silicon forstrong filaments isfound inleafy varieties ofgreen lettuce, especially in romaine; itisalso present instrawberries, incucumbers, andcherries aswell asinthe skins of apples and other fruits.Healthy hairrequires carbohydrates tosupply carbon andhydrogen forcomposition andthecarbon forfuel. Ripe, sweet fruits furnish thefinest kind ofpredigested energy- conserving carbohydrates tobefound. This isespecially trueofthesweet, sweet fruits, the banana being a prime example of an almost perfect food. Adequate protein andalltheessential amino acids arefound inmany fruits andveg- etables. The proteins found in many plant foods are biologically of optimum value. TheLaw oftheMinimum about which welearned earlier tells usthattheabsence or short supply ofeven asingle nutrient foranyextended period oftime canlead togen- eralhealth debilitation regardless ofhow well supplied wemay beinallother nutrients. Testsonboth animals andhumans have shown thatdeficiencies canalsoreduce thehair quality andhealth. Itwould appear thatthere isagrand pact innature wherein correct proportions andadequacy ofallnutrients arethebasic requirements ofmaximum health. Eating cooked foods, eating foods lacking innutritional content, failing tochew prop- erly,eating toexcess andeating toooften, thetaking ofisolated vitamin andmineral supplements, alack ofexercise orsunshine, long continued emotional stress exposure, indeed, alack ofanyoftherequisites oforganic existence canlead inevitably todimin- ished health, andanylack ofhealth will bereflected inalusterless, sick-looking hair which soon starts tolose itscolor,tothin andfalloutinever increasing amounts. No single food factor oranycombination offood factors puttogether byman andtaken in isolation canwork hairandscalp magic. Thebody isaunitized functioning entity.The health of the hair reflects the health status of the totality. Many excuses areoffered from time totime andbymany “authorities” forthinning ofthehair,forlossofcolor andsheen, forbaldness, excuses likeinherited badgenes, wearing hatswhich aretootight andwearing them toooften, shampooing toofrequently, andmany others. But, these areonly excuses. None arebased ontheknown realities which define and limit the life process. More primitive men andwoman have abundant crops ofhair.Whole nations ofpeo- plewho have lived forthousands ofyears onsimple diets have thick healthy growths ofhair.Itisonly “civilized” men andwomen who partake ofpoor devitalized heteroge- neous messes offood inquantities farinexcess ofbody need who sufferhairandscalp problems associated with malnutrition. Itiscivilized people who show meager crops of hair and damaged scalps. Dr.ArtMollen, aPhoenix osteopathic physician andafirm believer inthebenefits tobederived from regular paced jogging, does notseemuch prospect ofextending the human lifespan. Pottenger ’sexperiments with catsatYaleshowed thatittakes several generations towitness theresults ofgood eating aswell asofpo
[ 65129, 662, 791, 69, 2868, 69, 21704, 198, 16514, 958, 12560, 3044, 11, 15792, 323, 1225, 2875, 323, 67, 620, 3411, 13, 1789, 266, 547, 279, 77896, 198, 52898, 23114, 263, 21707, 5679, 14239, 5636, 92885, 12457, 505, 264, 2497, 40856, 7830, 13, 578, 198, 15623, 648, 574, 77711, 31348, 58184, 13, 10180, 2380, 1667, 945, 13111, 79741, 311, 1568, 525, 456, 8997, 198, 94942, 6167, 291, 27403, 13, 468, 830, 291, 49818, 10437, 26390, 304, 49818, 80675, 323, 582, 2925, 2617, 315, 99797, 198, 438, 7257, 24822, 304, 279, 3389, 13658, 13, 468, 384, 1550, 3041, 1124, 264, 7257, 19151, 1475, 1023, 1938, 16853, 1016, 13213, 122761, 1051, 8056, 13, 763, 45670, 1768, 8046, 2875, 892, 279, 5519, 81295, 1047, 1003, 6577, 198, 3594, 23724, 323, 1820, 15623, 648, 574, 802, 2370, 13444, 0, 26056, 537, 1820, 5519, 81295, 11, 26907, 13801, 20322, 459, 4575, 62723, 11134, 1174, 8248, 1820, 15623, 648, 529, 25661, 266, 1022, 324, 380, 71, 875, 11, 1633, 42299, 323, 1073, 64, 198, 88044, 2463, 8048, 16853, 2181, 41450, 5101, 1455, 4461, 430, 65, 4852, 63600, 2136, 304, 21704, 3026, 323, 65762, 6127, 1964, 288, 495, 198, 1073, 42820, 315, 14991, 83664, 11, 323, 258, 985, 279, 5098, 1054, 83664, 2476, 584, 1012, 682, 764, 2315, 315, 9110, 7058, 376, 684, 25, 44225, 11, 40054, 13763, 11, 44032, 11, 5099, 2637, 439, 9336, 12025, 383, 46519, 315, 29228, 198, 14239, 304, 582, 28132, 3392, 323, 76, 4992, 26, 5636, 11, 22712, 66700, 9547, 11, 1778, 12025, 383, 677, 7058, 83, 2101, 315, 56868, 282, 5499, 40120, 11, 5099, 627, 1687, 19553, 2736, 13468, 430, 9493, 279, 94942, 285, 318, 96608, 304, 28400, 598, 11, 502, 6650, 198, 4919, 61917, 387, 5598, 2841, 719, 33871, 289, 4385, 619, 1486, 704, 339, 1900, 1412, 6650, 1053, 387, 10236, 198, 3323, 994, 279, 7013, 7917, 527, 2103, 31528, 323, 539, 5710, 627, 8607, 12074, 4284, 1701, 25181, 46192, 311, 54754, 6468, 279, 94307, 79, 323, 34232, 737, 7058, 35563, 279, 9233, 315, 1820, 51729, 438, 1220, 74189, 13, 37828, 20643, 6170, 1268, 2999, 3924, 261, 7058, 1543, 71492, 11, 264, 21307, 61485, 16549, 11, 40912, 15657, 902, 802, 261, 718, 1558, 76652, 32, 11, 96420, 1778, 439, 7063, 90329, 13, 10320, 88364, 1705, 11, 4869, 1174, 33134, 430, 19041, 527, 2201, 2118, 5775, 863, 15657, 345, 9210, 86, 336, 592, 617, 279, 67733, 20326, 323, 9210, 576, 285, 64525, 54141, 1113, 264, 30265, 2676, 315, 198, 96420, 11, 719, 91955, 1124, 1672, 86581, 28559, 779, 561, 316, 710, 12117, 18539, 311, 1820, 38423, 7058, 4734, 288, 315, 279, 2547, 16853, 2181, 325, 12116, 430, 3646, 61485, 22012, 617, 2697, 8830, 315, 339, 830, 533, 9210, 86, 336, 592, 198, 95783, 279, 2118, 67733, 863, 315, 14239, 11, 539, 11777, 438, 47568, 13, 2999, 2056, 718, 569, 468, 1345, 620, 261, 889, 12659, 198, 258, 325, 17998, 7665, 61510, 3145, 2737, 12366, 323, 36644, 15299, 11, 40912, 15657, 1579, 1672, 360, 7058, 84001, 1834, 719, 3473, 8554, 430, 2534, 438, 27684, 2411, 527, 19171, 15693, 7013, 5260, 13, 1226, 198, 47743, 398, 1047, 276, 258, 17795, 3355, 589, 52476, 505, 459, 55977, 889, 1047, 59948, 10329, 5552, 311, 198, 83664, 13, 1443, 288, 3864, 430, 939, 365, 395, 15154, 449, 671, 5241, 1073, 359, 57228, 26153, 323, 2048, 2641, 18534, 198, 266, 2426, 3430, 4877, 1073, 3, 3101, 13, 410, 902, 1047, 82850, 32031, 369, 1964, 5221, 2423, 44660, 315, 543, 198, 76, 4992, 315, 55911, 8778, 323, 1083, 3333, 33690, 13, 3005, 32345, 47991, 10712, 430, 67, 14759, 11937, 420, 198, 3195, 41421, 383, 81768, 5603, 13, 1226, 329, 26451, 305, 531, 461, 413, 279, 67733, 7309, 653, 57228, 323, 198, 7413, 311, 8343, 279, 10320, 88364, 292, 1648, 16853, 96556, 1174, 318, 77267, 74502, 323, 5481, 269, 12459, 26870, 649, 1593, 682, 76, 4992, 315, 2664, 198, 376, 86713, 2737, 24673, 315, 339, 82182, 79, 323, 51729, 26, 5423, 35663, 7013, 9563, 11, 12208, 89, 9355, 345, 7063, 65, 1371, 645, 323, 11, 16387, 5599, 83, 11, 4686, 48653, 2136, 11, 2288, 1345, 537, 1274, 8343, 998, 1073, 561, 438, 15357, 354, 198, 331, 365, 872, 3691, 13, 763, 327, 1140, 315, 1954, 998, 2721, 4, 315, 339, 830, 9242, 814, 99553, 460, 265, 99797, 323, 17206, 198, 45010, 15657, 527, 5481, 269, 398, 12146, 13, 1102, 285, 3409, 14518, 264, 39088, 315, 24217, 13283, 12205, 16609, 198, 20322, 279, 37791, 315, 49818, 60163, 14997, 36471, 279, 71558, 40021, 4972, 311, 1992, 287, 279, 51105, 7058, 4116, 369, 27543, 311, 51729, 37791, 323, 37037, 700, 2547, 7917, 13, 578, 17645, 1732, 21935, 369, 198, 14239, 11, 568, 68, 1900, 2118, 14239, 2476, 719, 1820, 2664, 7917, 3775, 83, 461, 8402, 1243, 332, 32930, 315, 14789, 1354, 27781, 198, 13832, 323, 258, 50828, 4113, 67754, 62114, 49892, 311, 5717, 461, 1109, 14201, 2324, 438, 576, 198, 2000, 719, 264, 10015, 9575, 4999, 2181, 23265, 2433, 5895, 430, 1820, 2664, 12302, 311, 82, 351, 438, 9210, 1820, 51729, 17106, 20969, 2324, 1752, 323, 198, 75, 7977, 14791, 24623, 32199, 11, 30299, 1900, 5531, 1725, 1344, 731, 323, 1641, 438, 339, 349, 688, 1870, 279, 51729, 33695, 198, 412, 627, 89553, 1189, 398, 1550, 370, 290, 332, 37842, 6492, 323, 5478, 55634, 1605, 323, 942, 844, 1964, 288, 122761, 198, 52898, 1455, 31720, 13, 49038, 1605, 706, 82850, 264, 75710, 1285, 49307, 315, 55381, 10320, 43312, 369, 278, 7058, 3646, 2380, 1667, 1457, 11, 6509, 263, 36934, 411, 1285, 49307, 315, 26301, 16944, 1912, 10173, 1073, 71, 3042, 324, 342, 388, 345, 69, 6793, 53031, 11, 323, 1030, 441, 323, 11, 4536, 347, 5599, 83, 11, 3208, 19030, 85, 561, 8857, 315, 26301, 425, 4166, 11, 1054, 18614, 89874, 3696, 13602, 323, 278, 11353, 11, 1101, 13, 6104, 1124, 1605, 18217, 267, 73875, 588, 5962, 4661, 682, 888, 826, 2949, 1200, 7058, 83, 2931, 320, 1962, 1054, 17645, 33611, 5238, 11, 279, 1114, 4771, 482, 820, 4538, 753, 888, 826, 1051, 14090, 3060, 3485, 477, 198, 54277, 279, 2985, 2931, 449, 459, 900, 315, 49818, 39829, 304, 1820, 2118, 32550, 788, 863, 3158, 13, 6104, 297, 339, 7058, 261, 69153, 1253, 2759, 11, 16387, 5599, 83, 11, 369, 15031, 86365, 11, 279, 8386, 12019, 304, 45010, 1403, 48925, 198, 4919, 99124, 1174, 584, 4510, 11, 387, 30706, 311, 279, 1422, 18728, 2436, 304, 43226, 12659, 10555, 627, 9023, 1236, 1791, 3675, 64850, 315, 60704, 6575, 449, 220, 6028, 81437, 889, 16654, 449, 24673, 315, 198, 1820, 38, 2506, 13, 2193, 11, 63747, 69, 1336, 316, 35070, 315, 86812, 398, 16054, 7013, 40734, 315, 45010, 6978, 453, 7058, 82, 347, 13430, 27639, 15055, 315, 82694, 11, 79217, 11, 17086, 45494, 47497, 13, 29524, 555, 52813, 198, 79371, 3978, 1073, 26301, 81437, 11, 2999, 3587, 582, 14295, 539, 3323, 574, 481, 311, 49133, 2731, 74502, 304, 26301, 198, 81437, 11, 719, 1101, 23649, 4442, 304, 279, 2890, 315, 279, 7013, 1174, 2737, 279, 35987, 627, 14404, 13465, 1174, 543, 98550, 3149, 76657, 1778, 439, 560, 47100, 11, 3347, 4108, 11, 32656, 1174, 3594, 3696, 15872, 345, 35122, 15657, 315, 543, 74, 8843, 527, 58156, 90375, 323, 1215, 588, 12, 15886, 287, 13, 1442, 86, 66929, 311, 981, 7058, 40157, 8469, 9960, 449, 12314, 11, 42299, 6366, 7013, 25576, 336, 592, 2343, 54203, 311, 339, 830, 1411, 198, 438, 98427, 13, 468, 336, 592, 7172, 1193, 279, 52833, 267, 315, 13284, 323, 33166, 1073, 54719, 15657, 311, 8370, 584, 17156, 7058, 70991, 527, 89171, 291, 25, 326, 26089, 1245, 436, 9100, 4589, 26390, 5636, 7347, 15055, 315, 82279, 16312, 88, 52011, 198, 438, 14098, 24822, 320, 6414, 1355, 4589, 26390, 705, 8314, 11934, 11, 31049, 323, 67740, 19595, 627, 47493, 374, 6413, 369, 589, 875, 19641, 315, 51729, 2056, 2852, 1354, 11, 71655, 11, 76203, 11, 41776, 11, 23008, 7058, 4108, 11, 323, 1690, 1023, 326, 26089, 1245, 26390, 527, 1664, 98728, 449, 11245, 627, 50, 360, 764, 324, 1174, 276, 49582, 3691, 2449, 11, 374, 15456, 23325, 18007, 304, 23832, 315, 339, 762, 57589, 198, 19521, 1174, 304, 75391, 372, 1941, 11, 304, 35267, 11, 323, 4237, 82, 627, 28671, 1965, 369, 4620, 1488, 24469, 374, 15456, 304, 25126, 88, 36680, 315, 13553, 71655, 11, 5423, 304, 198, 442, 8511, 26, 433, 285, 19171, 3118, 9680, 675, 36989, 11, 3709, 1791, 372, 1941, 11, 323, 9211, 4108, 439, 9336, 439, 258, 1820, 198, 50418, 315, 41776, 323, 1023, 26390, 76080, 88, 7013, 42475, 62345, 311, 95783, 12782, 323, 67229, 4469, 369, 77907, 198, 438, 339, 762, 52745, 369, 64475, 13, 432, 3527, 11, 10437, 26390, 52259, 279, 5589, 478, 3169, 315, 24361, 343, 10185, 4907, 7058, 6387, 20073, 62345, 25410, 830, 801, 13, 1115, 374, 36046, 837, 1073, 6509, 4589, 11, 10437, 26390, 345, 1820, 44196, 1694, 264, 10461, 3187, 315, 459, 4661, 4832, 3691, 627, 32, 451, 19684, 13128, 323, 543, 1820, 49582, 42500, 33969, 527, 15456, 304, 35676, 26390, 323, 588, 70, 7058, 295, 4893, 13, 578, 28896, 1766, 304, 1690, 6136, 15657, 527, 6160, 30450, 315, 54767, 907, 627, 791, 39166, 315, 1820, 29795, 922, 902, 584, 12964, 291, 6931, 10975, 88689, 9379, 1820, 3518, 768, 477, 198, 8846, 8312, 315, 17206, 439, 2222, 50123, 369, 3852, 42198, 4261, 315, 1712, 649, 27152, 311, 4469, 7058, 3333, 12393, 4316, 33949, 15851, 315, 5269, 1664, 17665, 289, 336, 352, 387, 992, 385, 700, 37493, 627, 2323, 942, 21704, 10099, 323, 28400, 598, 617, 6982, 430, 755, 43690, 649, 1147, 461, 13677, 279, 51729, 198, 10692, 323, 12393, 13, 1102, 41450, 5101, 430, 19041, 374, 351, 11588, 60821, 6301, 1598, 42418, 4495, 198, 782, 403, 919, 323, 1037, 447, 2826, 315, 543, 24217, 32930, 527, 1820, 23144, 8670, 315, 40287, 2890, 627, 36, 1113, 30205, 15657, 11, 12459, 15657, 32161, 6301, 332, 37842, 2262, 11, 22109, 98798, 365, 2047, 7058, 261, 398, 23379, 1113, 311, 327, 1140, 323, 91955, 2288, 61917, 11, 279, 89894, 315, 61023, 660, 28170, 323, 1083, 3333, 198, 13066, 4779, 11, 453, 474, 315, 64562, 477, 40619, 31338, 11, 1317, 8738, 14604, 8631, 14675, 345, 28074, 291, 11, 453, 474, 315, 3852, 1073, 19041, 49350, 315, 61694, 14209, 649, 27152, 40605, 11791, 61334, 7058, 3384, 2890, 11, 323, 91014, 474, 315, 12393, 690, 28031, 69, 2258, 304, 278, 5100, 1752, 11, 14363, 31348, 7013, 198, 8370, 5246, 8638, 311, 1497, 1202, 3506, 1174, 998, 64771, 323, 13772, 14492, 424, 7859, 15055, 13, 2360, 198, 15698, 3691, 8331, 477, 3852, 76128, 315, 14239, 9547, 2231, 998, 3522, 555, 1543, 323, 83261, 304, 198, 285, 36062, 649, 1816, 7013, 438, 94307, 79, 11204, 13, 578, 2664, 52435, 3928, 1534, 31301, 5502, 662, 791, 198, 12393, 315, 279, 7013, 27053, 279, 2890, 2704, 315, 279, 2458, 2786, 16853, 8607, 55586, 527, 1885, 12616, 505, 892, 311, 1712, 323, 1729, 35676, 1054, 3170, 1385, 863, 13544, 20353, 198, 1073, 1820, 51729, 11, 2000, 2353, 708, 69, 3506, 323, 32158, 268, 11, 55844, 4852, 2136, 11, 55586, 1093, 258, 49494, 3958, 59275, 345, 86, 13992, 45526, 8370, 527, 998, 354, 492, 323, 86, 13992, 1124, 2288, 61917, 11, 63032, 287, 311, 1073, 70941, 13801, 438, 35676, 3885, 13, 2030, 11, 1521, 527, 3323, 55586, 13, 2290, 527, 31039, 389, 339, 1247, 4262, 50446, 198, 8370, 7124, 323, 4017, 279, 2324, 1920, 627, 7816, 28694, 3026, 323, 22803, 617, 44611, 31665, 315, 51729, 18951, 1286, 17089, 315, 375, 78, 7058, 698, 14965, 617, 12439, 13544, 40137, 315, 42820, 389, 23796, 41943, 617, 12314, 9498, 6650, 82, 198, 1073, 51729, 28628, 285, 3323, 1054, 94230, 1534, 863, 3026, 323, 65762, 889, 961, 731, 315, 5481, 269, 3567, 2223, 1534, 30548, 41632, 7058, 818, 788, 9622, 288, 315, 14239, 304, 31548, 1385, 3117, 258, 327, 1140, 315, 2664, 1205, 889, 7831, 51729, 438, 94307, 79, 198, 96440, 5938, 449, 8811, 83664, 13, 1102, 3510, 6362, 1534, 1274, 889, 1501, 757, 1435, 31665, 315, 198, 51729, 323, 20727, 24964, 1725, 627, 9023, 51164, 44, 33389, 11, 264, 79925, 52368, 62209, 28378, 323, 2642, 2923, 62379, 304, 1820, 68244, 1220, 198, 83, 677, 7442, 2270, 505, 5912, 78780, 99738, 11, 1587, 539, 325, 336, 1412, 22199, 315, 428, 2518, 279, 198, 26380, 61961, 13, 393, 1751, 10214, 18217, 11814, 50732, 449, 19987, 266, 56, 3916, 5269, 291, 430, 1468, 2094, 3892, 198, 7642, 811, 16190, 8251, 92779, 122761, 315, 19045, 12459, 439, 9336, 439, 1073, 5481 ]
0xBreath/holistic-books
. Cardiovascular Drugs 74.8.1 Digitalis 74.8.2 Diuretics 74.8.3 V asodilators 74.8.4 Propranolol Toquote Dr.Shelton, “The broad anddistinct difference between theHygienic sys- temandthedrug system isthis: Hygiene seeks torestore health byhealthful means and conditions; drug systems seek tocure disease with agents thatareknown toproduce dis- ease inthewell. Instead offilling ourbodies with poisons, why notlook torest, sleep, better food, fasting, exercise, sunshine, emotional poise, cleanliness, andplain andsim- plewholesome food asthemeans ofrestoring ustohealth? Hygienic care consists in theuseofsuch means aswhen applied toaman inhealth willkeep himinhealth and willnottend tomake himsick. Medical treatment ofthesick consists almost wholly in theuseofmeans which ifgiven toaman inperfect health would unfit himforwork or business or,perhaps, even killhim. TheHygienist rejects allpoisons andemploys only beneficial substances and conditions to aid the healing processes of the body.” Sodrugs arenotrecommended. They donotproduce health butcontribute todisease. 74.8.1 Digitalis Digitalis isahighly-poisonous substance derived from theleaves ofthefoxglove, formerly used asan“herb remedy.”Itwasfirst introduced toformal medicine in1785 bytheEnglish physician William Withering, butitsuseinfolk medicine preceded that date by many years. Digitals belongs toagroup ofdrugs called thecardiac glycosides. The twomost commonly-used glycosides aredigoxin anddigitoxin. This drug isknow toresult in many adverse effects. The most serious toxic effectisadangerous irregularity ofthe heartbeat, butthepatient may also suffernausea, vomiting, andvarious symptoms of brain involvement, including drowsiness, headache, andblurred orstrangely colored vi- sion. Stimulation from anydrug isavery exhausting action andisalways followed bya period ofdepression orexhaustion. Digitalis slows theheart action bystimulating the vagus nerve centers. Theright vagus nerve isdistributed predominantly tothesinoatrial node, andtheleftvagus affects principally theatrioventricular node. Stimulation ofthe right vagus decreases heart rate, whereas leftvagal stimulation may induce ventricular slowing subsequent tothedevelopment ofheart block. Largedoses ofdigitalis oranac- cumulation ofsmaller doses canresult inheart block. Ifacomplete block oftheheart’ s electrical conduction system occurs, theheart may beslowed toanextent thatitcannot sustain life. Digitalis also results inadisturbance ofthenormal rhythm oftheheart (arrythmia). Therhythmical projection ofimpulses from thesinus node aredisturbed sothattheheart rate shows regularly alternating short phases of slowing and acceleration. Abundle ofmuscular fibers intheheart known astheauriculoventricular bundle or thebundle ofHis, conducts impulses from theauricle totheventricle. These arecon- ducted inaway tocause theventricular beat oftheheart tofollow theauricular beat in about one-fifth ofasecond. Theadministration ofdigitalis retards orprevents thiscon- duction ofimpulses. Here again theeffectisduetothestimulation ofthevagus center.It isnotuncommon foraprolongation oftheinterval between theauricular andventricular beats from three-tenths tothree-fifths ofasecond, when digitalis isgiven inso-called therapeutic doses. Theexcretion ofdigitalis isslow sothatcontinued administration oflargedoses of thedrug easily gives riseto“accumulative poisoning.” Poisoning resulting from anover-whelming dose results indeath inafewminutes. This state ofpoisoning presents four well-defined states: 1.Vagus andvasoconstrictor stimulation with slowed heart, rapid riseinblood pressure, and diastolic relaxation indicating diminished tone of the heart muscle. 2.Predominance ofvagus action, with greater lossoftone andheart block, orbrief periods of vagus standstill, and sometimes premature beats from, muscular irritation. 3.Predominance ofmuscular action with abrupt changes totachycardia, very rapid beating of the ventricle, usually not in unison with the auricle, high arterial pressure. 4.Weakness andexcessive irritability oftheheart muscle with auricular tremor,ventricular tremor and death. 74.8.2 Diuretics High blood pressure with excessive blood volume isoften theresult ofexcessive wa- terandsaltretention. Thesingle greatest cause ofsaltandwater retention isthedietary consumption ofinorganic sodium chloride (table salt). Saltaffects thevascular system intwoways: asanosmotic influence (attracting molecules ofwater) andasachemical irritant thatsensitizes thevascular smooth muscle tonormally-occurring vasoconstrictor substances such asadrenalin. Direct interference with kidney function isanother way that salt use contributes to high blood pressure. Diuretics aregiven toprevent thereabsorptipn ofsaltandwater bythekidneys and thus lessen thesymptoms ofcongestive heart failure. There aremany kinds ofdiuretics butallhave thesame objective toincrease theoutput ofsaltandwater intheurine. One ofthemajor problems they present isanexcessive lossofsaltandother minerals, espe- cially potassium. Potassium lossismost common with thewidely-used thiazide class of diuretics (chlorothiazide andhydrocholorothiazide). Their usecanresult infeelings of weakness andifdigitalis isbeing taken atthesame time, car,make toxicity even greater. This lossofpotassium isoften counteracted byadding asecond diuretic—one thatdoes notcause potassium loss—to thethiazide. However,thecombination ofdiuretics in- duces another danger: diuretics thatprevent potassium lossdosobyinterfering with the kidneys toexcrete themineral. This canlead toadangerously high level ofpotassium inthebody.Thiazides canalsoreduce theelimination ofuricacid andthus aggravate an existing case of gout and redeposit this highly toxic by-product into the tissues. 74.8.3 Vasodilators Drugs thatresult inthedilation ofblood vessels areoften given toheart patients. The vasodilators longest inuse(more than onehundred years) arethenitrates. Nitro- glycerin isthemost-frequently used andisusually taken intablets thatareplaced under the tongue and allowed to dissolve. Thetoxins ofthenitrates result infainting ordizziness, headaches, andpalpitations resulting from thecompensatory increase inheart rateandthespeed ofheart contraction. The presence ofthispoison inthesystem requires additional work ofthealready-ex- hausted heart to eliminate this harmful substance. 74.8.4 Propranolol Propranolol (Inderal) isadrug thatresults inablock ofsome ofthesympathetic nerves totheheart. These nerves (thebeta-sympathetic orbeta-adrener gicnerves) carry messages from thebrain thatcause theheart toincrease itsrateandthespeed ofitscon- traction. When these messages areblocked, theheart rateslows, thespeed ofcontraction decrease and the heart’ s demand for oxygen decreases. One ofthepossible dangers isthedevelopment ofcongestive heart failure because thespeed andtheforce oftheheart’ scontraction arereduced. However thisposes twomajor problems: thecongestive failure itself; andtheconsequent expanded volume of blood in the heart, which increases its size and may make the angina worse. Another toxicity results from propranolol. This drug affects thebeta-sympathetic nerves throughout thebody,notjustthose oftheheart. Since these nerves areresponsible fordilating theblood vessels oftheskin, propranolol usecanresult inconstriction of these vessels, leading topale, cold hands andfeet. Thesame nerves alsocause thebody’ s airtubes todilate, andwhen thatdilation isblocked, theairtubes become constricted. A patient with asthma can find the condition aggravated. Patients who aretaking insulin fordiabetes experience another problem with this drug. Beta-sympathetic nerves cause anincrease inblood sugar when thelevel drops too low.Inadiabetic person who istaking insulin, alowsugar level canbeaggravated or prolonged when propranolol isalso being taken. Propranolol canalso result indepres- sion, dif ficulty in sleeping, and sometimes, impotence. Anumber ofother drugs arealso given toheart patients. They areallpoisons. The result from taking anydrug isenervation andtoxicosis. Itislikepouring gasoline ona fireinorder toextinguish it.Youarejustmaking matters worse andaggravating
[ 13, 92976, 33945, 51766, 198, 5728, 13, 23, 13, 16, 14434, 285, 198, 5728, 13, 23, 13, 17, 7923, 554, 13024, 198, 5728, 13, 23, 13, 18, 650, 439, 347, 321, 3046, 198, 5728, 13, 23, 13, 19, 1322, 652, 39710, 337, 198, 1271, 3022, 2999, 11086, 301, 783, 11, 1054, 791, 7353, 323, 54121, 6811, 1990, 279, 31916, 88364, 292, 5826, 7058, 880, 438, 79371, 73047, 1887, 6127, 26301, 25, 10320, 43312, 26737, 311, 31904, 2890, 555, 12393, 1285, 3445, 323, 198, 16902, 26, 5623, 6067, 6056, 55961, 554, 8624, 449, 13307, 430, 548, 5391, 311, 98374, 834, 7058, 47714, 304, 16142, 616, 13, 12361, 1022, 9585, 1057, 65, 10233, 449, 3273, 19941, 11, 3249, 539, 7349, 311, 4014, 11, 6212, 345, 58234, 3691, 11, 54560, 11, 10368, 11, 52495, 11, 14604, 3273, 1082, 11, 96391, 11, 323, 21435, 323, 15124, 7058, 698, 1336, 7298, 638, 3691, 12025, 71, 3981, 598, 315, 4014, 5620, 577, 34152, 12393, 30, 10320, 88364, 292, 2512, 17610, 304, 198, 1820, 817, 1073, 21470, 3445, 439, 9493, 9435, 311, 13005, 304, 12393, 690, 13397, 1461, 258, 12393, 323, 198, 14724, 77, 1751, 408, 311, 7072, 1461, 82, 875, 13, 13235, 6514, 315, 6509, 875, 17610, 4661, 42241, 304, 198, 1820, 817, 1073, 47321, 902, 422, 43068, 311, 13005, 304, 64185, 2890, 1053, 94567, 1461, 2000, 1816, 477, 198, 27243, 477, 11, 66372, 11, 1524, 5622, 40617, 13, 578, 31916, 88364, 380, 60515, 682, 5481, 19941, 323, 31310, 1065, 1193, 198, 68244, 7235, 33155, 323, 4787, 311, 12576, 279, 21730, 11618, 315, 279, 2547, 662, 89874, 50, 347, 81, 13602, 527, 1962, 86447, 13, 2435, 1541, 354, 98374, 2890, 719, 444, 2248, 11791, 56407, 627, 5728, 13, 23, 13, 16, 14434, 285, 198, 39212, 285, 374, 1494, 1108, 398, 75488, 3416, 788, 20278, 14592, 505, 279, 273, 4798, 315, 339, 830, 5241, 70, 31153, 345, 70614, 1511, 439, 276, 2118, 1964, 65, 40239, 662, 863, 2181, 16514, 3983, 11784, 311, 630, 278, 16088, 304, 11256, 20, 198, 1729, 1820, 23392, 28378, 12656, 468, 2544, 287, 11, 719, 1220, 817, 258, 42031, 16088, 53580, 430, 198, 1045, 555, 1690, 1667, 627, 37520, 1147, 17623, 311, 351, 896, 315, 3696, 13602, 2663, 279, 5057, 18029, 37807, 9594, 3422, 13, 578, 4483, 316, 537, 198, 5581, 398, 69621, 37807, 9594, 3422, 527, 45961, 5241, 258, 323, 36034, 5241, 258, 13, 1115, 5623, 374, 33134, 311, 1407, 304, 198, 35676, 31959, 6372, 13, 578, 1455, 6129, 21503, 2515, 285, 329, 4091, 788, 42408, 488, 315, 1820, 198, 73571, 11, 719, 339, 752, 16794, 1253, 1101, 8657, 944, 3538, 64, 11, 63571, 11, 323, 959, 1245, 13803, 315, 198, 54160, 22315, 11, 2737, 294, 1849, 1918, 11, 47846, 11, 323, 2067, 8293, 477, 496, 526, 989, 28296, 3355, 7058, 82, 290, 627, 626, 61461, 505, 904, 73821, 374, 25727, 79953, 1957, 323, 285, 33222, 8272, 555, 64, 198, 19862, 315, 451, 4099, 16536, 87, 15424, 290, 13, 14434, 285, 70270, 279, 18207, 1957, 555, 54754, 15853, 279, 198, 85, 59838, 32015, 19169, 13, 23258, 492, 17764, 355, 32015, 374, 63475, 47904, 311, 6509, 3394, 2416, 278, 198, 3593, 11, 323, 1820, 2414, 85, 59838, 22223, 92381, 279, 2416, 78, 688, 57333, 2494, 13, 800, 61461, 315, 1820, 198, 1315, 17764, 355, 43154, 4851, 4478, 11, 20444, 2163, 85, 69212, 41959, 1253, 49853, 10594, 57333, 198, 3306, 24060, 17876, 311, 339, 15686, 76931, 315, 18207, 2565, 13, 445, 93349, 20274, 315, 58369, 285, 105125, 582, 7058, 60353, 2987, 315, 9181, 261, 35130, 649, 1407, 304, 18207, 2565, 13, 1442, 45670, 5282, 2565, 315, 1820, 18207, 529, 274, 198, 19493, 12381, 390, 23985, 1887, 13980, 11, 279, 18207, 1253, 9234, 10516, 291, 311, 276, 71272, 430, 275, 34360, 198, 82, 31873, 2324, 627, 39212, 285, 1101, 3135, 304, 329, 380, 9225, 685, 315, 3473, 2553, 37390, 315, 1820, 18207, 320, 11687, 339, 91299, 4390, 1016, 261, 61254, 950, 22343, 315, 6802, 67116, 505, 279, 16319, 355, 2494, 527, 12489, 75325, 779, 9210, 1820, 18207, 198, 7853, 5039, 15870, 73462, 2875, 35530, 315, 48408, 323, 31903, 627, 5953, 4300, 315, 38827, 22077, 49774, 304, 1820, 18207, 3967, 12025, 383, 4202, 33753, 688, 57333, 13190, 477, 198, 1820, 35618, 315, 16366, 11, 74198, 87633, 505, 279, 4202, 2045, 311, 1820, 688, 81, 2045, 13, 4314, 527, 444, 7058, 55015, 304, 14075, 311, 1593, 279, 688, 57333, 9567, 315, 1820, 18207, 311, 19070, 279, 4202, 24553, 9567, 304, 198, 9274, 832, 2269, 58710, 315, 521, 1321, 13, 578, 91690, 315, 58369, 285, 2160, 2402, 477, 1762, 48764, 420, 444, 7058, 23985, 315, 6802, 67116, 13, 5810, 1578, 279, 27153, 285, 1072, 295, 8942, 478, 61461, 315, 1820, 85, 59838, 4219, 662, 2181, 198, 285, 1962, 359, 5581, 369, 391, 1098, 647, 367, 315, 1820, 29004, 1990, 279, 4202, 24553, 323, 688, 57333, 198, 1395, 1900, 505, 2380, 2442, 306, 5104, 311, 28956, 2269, 333, 17323, 315, 521, 1321, 11, 994, 7528, 285, 374, 43068, 304, 708, 19434, 198, 700, 32486, 35130, 627, 791, 327, 89790, 315, 58369, 285, 2425, 10516, 779, 9210, 86957, 8735, 315, 27995, 291, 20274, 315, 198, 79371, 73047, 6847, 6835, 10025, 11269, 2118, 40031, 22948, 52236, 2029, 52212, 287, 13239, 505, 459, 2017, 12, 94179, 19660, 3135, 5278, 589, 304, 2642, 365, 38137, 13, 1115, 1614, 315, 5481, 3416, 287, 18911, 3116, 198, 9336, 39817, 5415, 512, 16, 5168, 59838, 323, 4378, 78, 444, 6765, 269, 41959, 449, 48946, 4851, 11, 11295, 10205, 258, 51105, 7410, 345, 438, 1891, 561, 7918, 43685, 19392, 54182, 16630, 315, 279, 4851, 16124, 627, 17, 1087, 1171, 8129, 685, 315, 85, 59838, 1957, 11, 449, 7191, 2537, 3594, 606, 323, 18207, 2565, 11, 477, 6796, 18852, 198, 1073, 17764, 355, 2559, 44466, 11, 323, 7170, 42227, 34427, 505, 11, 52192, 66510, 627, 18, 1087, 1171, 8129, 685, 315, 38827, 22077, 1957, 449, 44077, 4442, 2458, 613, 3418, 569, 689, 11, 1633, 11295, 27242, 198, 1073, 279, 10594, 81, 2045, 11, 6118, 539, 304, 653, 3416, 449, 279, 44521, 2045, 11, 1579, 80935, 7410, 627, 19, 23210, 587, 2136, 323, 327, 87728, 30118, 2968, 315, 1820, 18207, 16124, 449, 44521, 24553, 18659, 269, 1174, 688, 57333, 198, 83, 1864, 269, 323, 4648, 627, 5728, 13, 23, 13, 17, 7923, 554, 13024, 198, 12243, 6680, 7410, 449, 27639, 6680, 8286, 374, 61917, 92779, 495, 315, 327, 87728, 10667, 7058, 466, 2914, 3223, 2171, 3012, 13, 666, 288, 2222, 12474, 5353, 315, 43326, 438, 13284, 38231, 6127, 42109, 3978, 661, 198, 67776, 562, 315, 258, 61694, 39695, 82882, 320, 2048, 12290, 570, 8375, 2629, 41027, 279, 33945, 1887, 198, 396, 58554, 954, 25, 439, 44705, 76, 14546, 10383, 320, 266, 2193, 287, 35715, 315, 13284, 8, 323, 300, 613, 336, 950, 198, 404, 1018, 519, 41136, 729, 275, 4861, 279, 33945, 11113, 16124, 8941, 494, 750, 12, 511, 46839, 348, 40055, 444, 6765, 269, 198, 2008, 9623, 1778, 439, 329, 1466, 36207, 13, 7286, 32317, 449, 39042, 734, 374, 43063, 1648, 198, 9210, 12290, 1005, 44072, 311, 1579, 6680, 7410, 627, 22427, 554, 13024, 527, 43068, 311, 93755, 1070, 3518, 269, 418, 575, 77, 315, 43326, 438, 13284, 555, 339, 1247, 307, 36371, 323, 198, 34232, 76970, 279, 24738, 52273, 315, 444, 7114, 535, 4851, 8060, 13, 2684, 527, 35676, 13124, 315, 8747, 554, 13024, 198, 8248, 543, 19553, 279, 25030, 16945, 311, 79601, 279, 3081, 315, 43326, 438, 13284, 304, 1820, 324, 483, 13, 3861, 198, 1073, 49818, 3111, 5435, 814, 3118, 374, 276, 327, 87728, 2537, 708, 3933, 3223, 438, 1605, 34072, 11, 1560, 375, 7058, 16158, 398, 62275, 13, 14020, 49163, 4814, 2191, 537, 4279, 449, 279, 44715, 989, 69621, 270, 28073, 579, 538, 315, 198, 8747, 554, 13024, 320, 72967, 8942, 28073, 579, 323, 67229, 331, 795, 8942, 28073, 579, 570, 11205, 1005, 4919, 1407, 304, 57676, 826, 315, 198, 13451, 2136, 323, 333, 58369, 285, 374, 35214, 4529, 520, 6509, 373, 892, 11, 1841, 11, 7072, 58011, 1524, 7191, 16853, 2028, 2537, 708, 11089, 354, 49163, 374, 61917, 5663, 22955, 555, 3071, 264, 5686, 1891, 554, 29150, 87671, 430, 28156, 198, 1962, 1593, 62275, 4814, 50617, 279, 339, 28073, 579, 13, 4452, 1174, 339, 762, 2925, 2617, 315, 8747, 554, 13024, 304, 7058, 1072, 1634, 2500, 8137, 25, 1891, 554, 13024, 430, 93755, 62275, 4814, 41625, 28113, 2295, 809, 287, 449, 279, 198, 64381, 36371, 311, 327, 9537, 279, 1083, 3333, 13, 1115, 649, 27152, 311, 329, 4091, 7162, 1579, 2237, 315, 19644, 49163, 198, 258, 1820, 2664, 662, 1016, 28073, 3422, 649, 1147, 461, 13677, 279, 40895, 2617, 315, 324, 292, 58156, 323, 34232, 46041, 349, 459, 198, 37995, 1162, 315, 342, 412, 323, 31265, 2792, 420, 7701, 21503, 555, 29745, 1139, 279, 39881, 627, 5728, 13, 23, 13, 18, 53934, 347, 321, 3046, 198, 9023, 13602, 430, 1407, 304, 79371, 13763, 315, 51105, 31080, 527, 61917, 2728, 311, 18207, 6978, 627, 791, 44496, 347, 321, 3046, 22807, 304, 817, 1278, 461, 1109, 832, 71, 7259, 1667, 8, 527, 3473, 22288, 988, 13, 50616, 299, 7058, 23797, 3913, 258, 6127, 30132, 537, 2269, 70941, 1511, 323, 285, 44066, 4529, 528, 481, 2641, 430, 548, 37469, 1234, 198, 1820, 25466, 323, 5535, 311, 73739, 627, 1016, 295, 5241, 1354, 315, 3473, 22288, 988, 1121, 4225, 71959, 6141, 97745, 11, 55403, 11, 323, 19866, 79, 31767, 198, 1407, 287, 505, 279, 5807, 729, 5382, 5376, 304, 18207, 4478, 438, 6509, 4609, 315, 18207, 71895, 627, 791, 9546, 315, 576, 5481, 3416, 304, 6509, 615, 7612, 5217, 990, 315, 1820, 46584, 10397, 7058, 15424, 291, 4851, 311, 22472, 420, 28856, 20278, 627, 5728, 13, 23, 13, 19, 1322, 652, 39710, 337, 198, 1360, 652, 39710, 337, 320, 40, 910, 278, 8, 374, 15008, 773, 430, 8234, 304, 370, 1039, 315, 15031, 315, 6509, 88, 1331, 589, 5411, 198, 77, 13583, 311, 1820, 18207, 13, 4314, 50581, 320, 1820, 19674, 1355, 88, 1331, 589, 5411, 477, 19674, 26831, 265, 1215, 342, 292, 77, 13583, 8, 6920, 198, 16727, 505, 279, 54160, 430, 1593, 279, 18207, 311, 79601, 1202, 7853, 438, 6509, 4609, 315, 1220, 444, 7058, 27523, 13, 3277, 1521, 6743, 527, 62448, 11, 279, 18207, 7969, 75, 4336, 11, 279, 20997, 315, 8386, 1335, 198, 451, 20542, 323, 279, 4851, 529, 274, 7631, 369, 24463, 43154, 627, 4054, 315, 339, 752, 24576, 37064, 6127, 71, 15686, 76931, 315, 444, 7114, 535, 4851, 8060, 1606, 198, 6509, 4609, 323, 339, 830, 16716, 315, 1820, 18207, 529, 274, 8386, 1335, 802, 12616, 24921, 13, 4452, 420, 8449, 4483, 316, 3111, 5435, 25, 279, 444, 7114, 535, 8060, 5196, 26, 323, 1820, 444, 72457, 17626, 8286, 315, 198, 51105, 304, 279, 4851, 11, 902, 12992, 1202, 1404, 323, 1253, 1304, 279, 6590, 2259, 11201, 627, 14364, 58011, 3135, 505, 463, 652, 39710, 337, 13, 1115, 5623, 22223, 279, 19674, 1355, 88, 1331, 589, 5411, 198, 77, 13583, 6957, 279, 2664, 1174, 1962, 4345, 54719, 315, 1820, 18207, 13, 8876, 1521, 50581, 802, 13213, 43419, 198, 8350, 321, 1113, 279, 51105, 31080, 315, 6509, 8148, 11, 463, 652, 39710, 337, 1005, 4919, 1407, 28093, 52230, 315, 198, 45010, 31080, 11, 6522, 1948, 1604, 11, 9439, 6206, 323, 1897, 295, 13, 666, 288, 373, 50581, 10942, 511, 3538, 279, 2664, 529, 274, 198, 1334, 83, 51725, 11791, 76457, 11, 323, 9493, 430, 67, 13763, 374, 62448, 11, 279, 1334, 83, 51725, 3719, 390, 74172, 13, 362, 198, 23557, 449, 51643, 649, 1505, 279, 3044, 63368, 627, 86245, 889, 527, 89894, 32152, 369, 8747, 16629, 3217, 2500, 3575, 449, 420, 198, 73821, 13, 35343, 1355, 88, 1331, 589, 5411, 50581, 5353, 459, 79601, 304, 51105, 13465, 994, 279, 3374, 21701, 2288, 198, 10516, 5450, 2836, 45938, 1732, 889, 6127, 1802, 32152, 11, 453, 4336, 8734, 2237, 649, 1395, 351, 36490, 660, 477, 198, 782, 4930, 291, 994, 463, 652, 39710, 337, 374, 19171, 1694, 4529, 13, 1322, 652, 39710, 337, 649, 19171, 1121, 5278, 24544, 7058, 82, 290, 11, 1422, 282, 27081, 304, 21811, 11, 323, 7170, 11, 3242, 98660, 627, 2127, 900, 315, 1605, 11217, 527, 19171, 2728, 311, 18207, 6978, 13, 2435, 527, 543, 5481, 19941, 13, 578, 198, 1407, 505, 4737, 904, 73821, 374, 268, 8943, 323, 998, 14668, 10934, 13, 1102, 285, 4908, 55619, 287, 46595, 106507, 198, 11029, 258, 1382, 311, 428, 13102, 819, 433, 39537, 548, 4345, 28936, 13146, 11201, 323, 351, 36490, 1113 ]
0xBreath/holistic-books
., D.C., eminent professional Hygienist inAus- tralia: “Afood element isapart ofacomplex food which, intheliving plant orani- mal, almost invariably,contains some, even ifonly inminute quantities, ofallthevari- ousfood elements—proteins, carbohydrates, fats, minerals, andvitamins... Thebody is adapted totheuseoffood asacomplex mixture offood elements. Wedonoteatfood elements ornutrients inisolation when weconsume anatural food. When weeatthese items outoftheir natural contexts with other nutrients, …thenutritional impact isdif- ferent and can lead to unfavorable consequences.” Thepotential damage andartificial deficiencies thatmay becreated through theuse ofprotein supplements andother supplements areconsiderable. Justasanexcess ofni- trogen intheplant willcreate artificial deficiencies ofother elements andprevent fruit-ing,sostimulation tothehuman organism produced bysupplementation willdisturb nat- uralbalance. This isthe“Law oftheMinimum”: “The development ofliving beings is regulated bythesupply ofwhichever element isleast bountifully provided.” (This has been long known inplant life.) Using supplements, bycreating anoverabundance of some elements, creates anartificial shortage ofother elements, known andunknown, and the element in shortest supply determines our development. Avery finedentist andhischarming wife, who arestaunch advocates ofso-called “natural” supplementation, toldmethatthey know thatsupplements arebeneficial and necessary, because “if they don’ t take their supplements, they just drag around.” What better proof could there beofthestimulating effectandaddictive nature of supplementation? AHygienist canskip meals, oreatfruit only forseveral days, oreat hisregular dietoffruits, vegetables, andnuts, andcontinue tobehisvital, sparkling, in- domitable self, with no crutches and no pills. Manufactured concentrates aresold bycommercial interests who aredetermined, for their profit, tomaintain theposition thatsubstitute andcompensatory substances can provide superior nutrition. Supplements areunnecessary,expensive, stimulating, addic- tive, and create artificial deficiencies and pathological changes in the human or ganism. The richest sources ofprotein andallother food elements areinliving food: raw nuts andseeds, fruits andvegetables, anditishere they arefound inideal combinations with other substances (known andunknown) essential totheir fullutilization. There is nobetter way: When youeatavariety ofwhole, rawfoods, inaccordance with Hygienic principles, youneed notbeconcerned about amino acids orvitamins orminerals orany- thing else—everything will be adequately supplied.Lesson 86 - The Supplement Approach To Nutrition 86.1. Introduction 86.2. The Supplement Approach T o Nutrition 86.3. The Appeal Of The Supplement School 86.4. The Supplementalists 86.5. The Only Safe Source Of Nutrients 86.6. Questions & Answers Article #1: The Great Supplement Hoax! by T.C. Fry Article #2: V itamins: A Quarter Billion Dollar Humbug by Dr. Herbert M. Shelton Article #3:Are90% orMore oftheVitamins YouTakeGoing Down theDrain? by T.C. Fry Article #4:Resolving theIssue ofSupplementation byDrs. Robert andElizabeth McCarter Article #5: The Minerals of Life by Dr. Herbert M. Shelton 86.1. Introduction One dayinAugust, athirty-three-year -oldwoman went toherdoctor because shehada water retention problem. Thefamily doctor advised thewoman totake supplements of vitamin B-6 (also known as pyridoxine ). Thedoctor didn’ tsayhow much ofthevitamin totake, sothewoman started eating three orfour vitamin tablets ateach meal. “Istarted taking thevitamin inmegadoses (largeamounts),” shelater toldreporters. “Ibelieved thatwastheway thatvitamins are supposed to work. T aking lar ge amounts seemed to be the in-thing for the 1980s.” After taking theB-6 supplements fortwo months, shestill hadawater retention problem. “My ankles were swelling, andIwas stillabout twenty pounds overweight from allthewater Iwasholding.” Soshereturned toherdoctor who toldhertojuststart taking lar ger doses of the vitamin. “Ididn’ tbother toaskhimhow largeadose,” thewoman said, “Ijuststarted taking more.” BylateOctober,shewastaking between sixtotwelve grams ofthevitamin each day.The minimum daily requirement forB-6isabout twotofour milligrams perday. This woman was taking 3,000 to 4,000 times the amount needed. ByDecember,shestarted having aconstant tingling inherfeetanddifficulty walk- ing.“Icoudn’ tgetdown thesteps tomybusiness,” shetold thenewspapers, “and my feet felt like there were 50-pound weights tied to them.” Shestillpersisted intaking huge doses ofvitamin B-6, convinced thatherdoctor must be right. Four months later,shecould noteven hold afork inherhand orsign hername. The megadoses ofvitamin B-6hadsoseverely disrupted hernervous system thatthewoman was incapable of performing even the simplest routine task. “The vitamin ruined myhealth,” shesaid, “and itforced metosellmysecond busi- ness.” One oftheneurologists who treated thewoman hadthistosay:“There isanexcellent chance thatthelargedoses ofthevitamin hadacausative roleinherillness. Wemust assume that megadoses of B-6 can injure both motor and sensory nerves.” Inthesame newspaper thatthisstory appeared in,there wasalso anadvertisement forthevitamin byahealth food chain. “Vitamin B-6,” theadstated, “has been used totreat schizophrenia, water retention problems, and tobuild muscles byathletes. Shouldn’ t you add this wonder vitamin to your regular diet-supplementation program?”Vitamins. Supplements. Minerals, enzymes, amino acids, brewer ’syeast, dolomite—all areextracted, artificial, andfragmented dietary additions, andthey have no place in health-promoting nutrition. Yettheappeal andlure ofdietary supplements isstrong—so strong thatanumber ofnutritionists andspokesmen have created anentire dietary school andphilosophy that prescribes theregular useofpotentially dangerous andutterly worthless nutritional ad- ditives and aids. This lesson discusses thedangers ofthesupplementary approach tonutrition and why such a fragmented view of health is doomed to failure. 86.2. The Supplement Approach To Nutrition 86.2.1 The Supplement School and Its Beliefs 86.2.2 Who’ s to Blame? Someone once saidthatthere areasmany approaches tonutrition asthere arenutri- tionists. There isthe“protein school” ofnutrition which emphasizes ahigh-protein diet andprotein foods over allelse. One group tells uswemust eatmeat anddrink milk; another group tells uswemust base ourdietongrains andseaweeds. There arevegetar- ians, fruitarians, sproutarians, andbreatharians. There arenutritionists who defend junk foods andpromote fastfoods. Justabout every conceivable approach tonutrition hasits supporters and adherents. This lesson isabout oneofthemore bizarre cults ofnutritionists: thesupplemental- ists,orthose who advocate powders, pills, capsules, andsupplements ofvitamins, min- erals, andproteins. There have already been several lessons telling why wedon’tneed nutritional supplements inthediet. Youhave already learned about thefallacies ofusing inorganic minerals, fragmented vitamins, andother worthless powders, pills andpotions. Yetthesupplement approach tonutrition remains atrapfortheunwary andunedu- cated. Youneed facts ifyouwish toeducate your clients, friends, family,andpatients about thefolly offollowing therecommendations ofthesupplementalists. This lesson, then, focuses ontheschool ofnutritional thought, andthose spokesmen, thatadvocate the use of supplements as a normal part of a healthy diet. 86.2.1 The Supplement School and Its Beliefs The supplementary approach to nutrition is based on these erroneous beliefs: 1.The human or ganism can utilize inor ganic minerals, vitamins, amino acids, etc. 2.Elements of nutrition can be fragmented and employed in part instead of in total. 3.Nutritional needs have been accurately determined and totally analyzed. 4.More is better. All of these beliefs are false. Let’ s briefly examine them one by one. 86.2.1.1 Fallacy #l: We Can Utilize Inorganic Minerals and Vitamins When mygrandfather was ayoung man, heplowed theclay fields each spring to prepare forplanting cotton. Hetoldmethatevery year oneofthepoor women who lived inthearea would come tohisfields
[ 2637, 423, 732, 2637, 84629, 6721, 10320, 88364, 380, 304, 87650, 7058, 376, 19379, 25, 1054, 32, 14239, 2449, 374, 391, 472, 315, 45670, 9289, 3691, 902, 11, 304, 339, 301, 2299, 6136, 477, 5676, 7058, 14991, 11, 4661, 74614, 1174, 13676, 1063, 11, 1524, 422, 3323, 304, 43657, 33776, 11, 315, 543, 1820, 30265, 7058, 788, 14239, 5540, 2345, 782, 668, 1354, 11, 62345, 11, 50127, 11, 34072, 11, 323, 55911, 38925, 1131, 578, 2664, 374, 198, 89171, 291, 311, 1820, 817, 1885, 1411, 439, 45670, 9289, 21655, 315, 14239, 5540, 13, 6658, 263, 1295, 266, 14239, 198, 22138, 477, 24217, 32930, 304, 285, 36062, 994, 584, 85594, 459, 4688, 3691, 13, 3277, 584, 33166, 45010, 198, 3699, 704, 1073, 50828, 5933, 38697, 449, 1023, 37493, 11, 4696, 3473, 332, 37842, 5536, 374, 88564, 7058, 809, 306, 323, 649, 3063, 311, 93071, 16296, 49216, 791, 93036, 5674, 323, 472, 16895, 72946, 430, 18864, 387, 7266, 1555, 279, 817, 198, 1073, 79565, 33690, 323, 1605, 33690, 527, 25742, 481, 13, 4702, 46488, 327, 1140, 315, 7907, 7058, 83, 26252, 304, 1820, 21494, 690, 3261, 21075, 72946, 315, 1605, 5540, 323, 93755, 14098, 85005, 10900, 537, 61461, 311, 1820, 26380, 47120, 9124, 555, 13066, 10075, 690, 12489, 9225, 18050, 7058, 4269, 22298, 13, 1115, 6127, 383, 2118, 39166, 315, 1820, 29795, 57633, 1054, 791, 4500, 315, 64275, 23837, 374, 198, 81722, 555, 6509, 85023, 315, 1336, 46669, 2449, 374, 56371, 293, 632, 5092, 398, 3984, 2029, 320, 2028, 706, 198, 82850, 1317, 3967, 304, 21494, 2324, 6266, 12362, 33690, 11, 555, 46002, 459, 2017, 370, 98681, 315, 198, 15031, 5540, 11, 11705, 459, 472, 16895, 39259, 315, 1605, 5540, 11, 3967, 323, 16476, 345, 438, 279, 2449, 304, 40243, 8312, 27667, 1057, 4500, 627, 32, 1225, 54981, 306, 380, 323, 26301, 1799, 5424, 7555, 11, 889, 527, 267, 18930, 28424, 315, 708, 19434, 198, 2118, 53980, 863, 73796, 11, 3309, 69991, 266, 20670, 1440, 430, 13066, 4779, 527, 68244, 7235, 323, 198, 95317, 1174, 1606, 1054, 333, 814, 1541, 529, 259, 1935, 872, 33690, 11, 814, 1120, 11161, 2212, 49216, 3923, 2731, 11311, 1436, 1070, 387, 1073, 61943, 318, 15853, 2515, 438, 723, 858, 535, 7138, 315, 198, 13066, 10075, 30, 362, 31916, 88364, 380, 43732, 13694, 21644, 11, 297, 1244, 36698, 1193, 369, 325, 17998, 2919, 11, 297, 1244, 198, 26301, 23108, 10173, 1885, 68998, 11, 24822, 11, 323, 64866, 11, 323, 9726, 311, 1395, 26301, 85, 2223, 11, 64612, 11, 304, 7058, 5717, 15729, 659, 11, 449, 912, 1589, 88449, 323, 912, 26153, 627, 80068, 3149, 99005, 264, 417, 820, 555, 84707, 12034, 889, 527, 67, 47737, 11, 369, 198, 50828, 11626, 11, 10390, 1673, 467, 279, 3571, 430, 2008, 7815, 323, 5807, 729, 5382, 33155, 649, 198, 62556, 16757, 26677, 13, 92410, 527, 15278, 20726, 1174, 4683, 4114, 11, 65792, 11, 923, 292, 7058, 83, 535, 11, 323, 1893, 21075, 72946, 323, 89961, 4442, 304, 279, 3823, 477, 25893, 2191, 627, 791, 57471, 8336, 315, 79565, 323, 37037, 700, 3691, 5540, 527, 258, 64275, 3691, 25, 7257, 198, 64866, 323, 325, 6910, 11, 26390, 323, 83571, 4893, 11, 323, 275, 819, 486, 814, 527, 15456, 304, 64053, 28559, 198, 4291, 1023, 33155, 320, 5391, 323, 16476, 8, 7718, 311, 50828, 2539, 1338, 2065, 13, 2684, 374, 198, 56123, 22120, 1648, 25, 3277, 499, 33166, 402, 2850, 2676, 315, 67733, 11, 7257, 96420, 11, 304, 4575, 541, 685, 449, 10320, 88364, 292, 198, 652, 5824, 645, 11, 499, 17483, 539, 1395, 444, 29644, 291, 922, 42500, 33969, 477, 55911, 38925, 477, 1083, 17822, 477, 3852, 7058, 1626, 775, 2345, 73826, 690, 387, 49672, 17665, 1236, 72505, 220, 4218, 482, 578, 43491, 54184, 2057, 39700, 198, 4218, 13, 16, 13, 29438, 198, 4218, 13, 17, 13, 578, 43491, 54184, 350, 297, 39700, 198, 4218, 13, 18, 13, 578, 62006, 5046, 578, 43491, 6150, 198, 4218, 13, 19, 13, 578, 43491, 278, 1705, 198, 4218, 13, 20, 13, 578, 8442, 23088, 8922, 5046, 18878, 32930, 198, 4218, 13, 21, 13, 24271, 612, 38343, 198, 17064, 674, 16, 25, 578, 8681, 43491, 17723, 710, 0, 555, 350, 662, 34, 13, 53517, 198, 17064, 674, 17, 25, 650, 433, 38925, 25, 362, 35494, 66809, 43464, 20449, 2365, 555, 2999, 662, 58463, 386, 13, 37940, 783, 198, 17064, 674, 18, 25, 11787, 1954, 4, 477, 7816, 315, 1820, 53, 275, 38925, 1472, 18293, 47439, 6419, 279, 9023, 467, 30, 555, 198, 51, 732, 13, 53517, 198, 17064, 674, 19, 25, 1079, 20222, 279, 43106, 315, 10254, 10075, 555, 35, 5544, 13, 8563, 323, 76637, 198, 85031, 5408, 198, 17064, 674, 20, 25, 578, 84886, 315, 9601, 555, 2999, 662, 58463, 386, 13, 37940, 783, 198, 4218, 13, 16, 13, 29438, 198, 4054, 1938, 258, 32559, 11, 12004, 16938, 49493, 4771, 482, 820, 22803, 4024, 311, 1964, 38083, 1606, 1364, 71, 2649, 198, 13284, 38231, 3575, 13, 578, 19521, 10896, 26160, 279, 22803, 2458, 731, 33690, 315, 198, 55911, 8778, 426, 12, 21, 320, 19171, 3967, 439, 4611, 1907, 5241, 483, 96705, 1016, 66981, 5009, 3287, 529, 10814, 352, 5269, 1790, 315, 1820, 55911, 8778, 2458, 731, 11, 779, 16142, 7053, 3940, 12459, 198, 28956, 477, 35124, 28170, 29679, 520, 9739, 15496, 13, 1054, 40, 47823, 4737, 279, 55911, 8778, 304, 71376, 5670, 288, 198, 2387, 2812, 6173, 82, 705, 863, 74135, 977, 3309, 11998, 388, 13, 1054, 40, 9978, 32077, 430, 86, 561, 71, 25754, 430, 55911, 38925, 527, 198, 13066, 3950, 311, 990, 13, 350, 264, 10789, 45555, 3980, 15055, 9508, 311, 387, 279, 304, 12, 1626, 369, 279, 220, 3753, 15, 82, 49216, 6153, 4737, 279, 33, 12, 21, 33690, 12108, 1146, 4038, 11, 1364, 44466, 1047, 675, 977, 38231, 198, 35686, 13, 1054, 5159, 90713, 1051, 55307, 11, 323, 40, 16514, 2103, 9274, 17510, 16701, 50254, 198, 1527, 682, 16142, 977, 358, 70545, 15345, 2029, 328, 437, 1964, 2549, 291, 311, 1964, 38083, 889, 3309, 71, 14200, 4345, 2527, 198, 89894, 45555, 17684, 35130, 315, 279, 28170, 627, 2118, 769, 307, 77, 529, 259, 754, 700, 311, 1091, 40617, 5269, 3544, 329, 974, 2476, 279, 22803, 1071, 11, 1054, 40, 4345, 47823, 4737, 198, 6518, 2029, 3296, 5185, 31294, 1174, 939, 365, 561, 1802, 1990, 4848, 28879, 86, 21903, 34419, 315, 1820, 55911, 8778, 1855, 198, 1316, 11829, 8187, 7446, 16686, 369, 33, 12, 21, 285, 9274, 4483, 354, 1073, 414, 2606, 84209, 824, 1316, 627, 2028, 5333, 574, 4737, 220, 18, 11, 931, 311, 220, 19, 11, 931, 3115, 279, 3392, 4460, 627, 1383, 33246, 1174, 32158, 47823, 3515, 264, 18568, 43327, 2785, 15517, 1897, 295, 438, 72964, 4321, 7058, 287, 35147, 40, 66, 3023, 77, 529, 259, 456, 2996, 279, 25047, 311, 2465, 27243, 2476, 559, 295, 820, 1243, 365, 2203, 9724, 11, 1054, 438, 856, 198, 1897, 295, 6612, 1093, 1070, 1051, 220, 1135, 48730, 14661, 17791, 311, 1124, 49216, 50, 6536, 484, 40926, 291, 528, 1802, 6908, 35130, 315, 55911, 8778, 426, 12, 21, 11, 22954, 430, 1964, 38083, 198, 25849, 387, 1314, 627, 28070, 4038, 3010, 10900, 383, 29177, 5296, 1055, 3412, 8136, 672, 15517, 10888, 477, 7908, 1077, 609, 13, 578, 198, 71376, 5670, 288, 315, 55911, 8778, 426, 12, 21, 32345, 708, 325, 424, 989, 69627, 72909, 651, 788, 1887, 430, 16142, 7053, 198, 16514, 58271, 315, 16785, 1524, 279, 45648, 14348, 3465, 627, 14305, 28170, 47168, 856, 12393, 2476, 559, 288, 3864, 11, 1054, 438, 433, 25229, 2322, 437, 616, 2465, 5686, 5951, 72, 7058, 2136, 49216, 4054, 315, 339, 1994, 2868, 848, 1705, 889, 12020, 279, 22803, 1047, 339, 380, 437, 352, 25, 2118, 3947, 374, 276, 327, 25777, 198, 331, 685, 430, 339, 301, 93349, 20274, 315, 1820, 55911, 8778, 1047, 582, 12119, 1413, 3560, 258, 1964, 484, 2136, 13, 468, 336, 592, 198, 46151, 430, 19262, 5670, 288, 315, 426, 12, 21, 649, 5934, 554, 2225, 9048, 323, 49069, 50581, 49216, 644, 6509, 373, 17222, 430, 576, 27583, 9922, 304, 11, 19041, 574, 19171, 459, 94248, 198, 2000, 1820, 55911, 8778, 555, 64, 12393, 3691, 8957, 13, 1054, 53, 76652, 426, 12, 21, 2476, 279, 329, 267, 660, 11, 1054, 4752, 1027, 1511, 198, 28879, 1244, 58533, 11, 3090, 38231, 5435, 11, 323, 311, 5957, 24569, 555, 589, 14203, 627, 15346, 77, 529, 259, 499, 923, 420, 5895, 28170, 311, 701, 5912, 10173, 59615, 10075, 2068, 12671, 53, 275, 38925, 13, 92410, 13, 84886, 11, 56067, 11, 42500, 33969, 11, 17109, 261, 18217, 82, 9188, 561, 345, 120807, 86903, 87247, 527, 24396, 291, 11, 21075, 11, 323, 43302, 291, 34625, 38314, 11, 323, 20670, 617, 198, 2201, 2035, 304, 2890, 66271, 11780, 26677, 627, 29174, 1820, 34531, 278, 323, 75, 554, 315, 94942, 661, 33690, 374, 4620, 2345, 708, 3831, 430, 276, 900, 198, 1073, 83664, 1705, 323, 2203, 8099, 5794, 617, 3549, 459, 306, 556, 34625, 2978, 323, 46185, 11597, 88, 430, 198, 24544, 56236, 1070, 70, 1299, 1005, 1073, 19644, 31668, 11660, 323, 6339, 398, 66121, 43226, 1008, 7058, 18225, 1924, 323, 52797, 627, 2028, 18228, 35434, 279, 67, 14381, 315, 6509, 455, 67082, 5603, 8941, 332, 17462, 323, 198, 35734, 1778, 264, 87195, 1684, 315, 2890, 374, 58737, 311, 8060, 627, 4218, 13, 17, 13, 578, 43491, 54184, 2057, 39700, 198, 4218, 13, 17, 13, 16, 578, 43491, 6150, 323, 11699, 7984, 30921, 198, 4218, 13, 17, 13, 17, 10699, 529, 274, 311, 2563, 373, 5380, 55611, 3131, 1071, 9210, 19041, 5789, 35676, 20414, 8941, 332, 17462, 12025, 6881, 7784, 332, 462, 7058, 28491, 1705, 13, 2684, 6127, 383, 2118, 79565, 2978, 863, 315, 83664, 902, 66159, 264, 12156, 10039, 39340, 10173, 198, 438, 79565, 15657, 927, 12584, 88882, 13, 3861, 1912, 10975, 603, 86, 336, 592, 8343, 2727, 266, 323, 98427, 14403, 280, 43063, 1912, 10975, 603, 86, 336, 592, 2385, 1057, 94942, 647, 81, 1771, 323, 325, 85277, 6910, 13, 2684, 527, 83571, 277, 7058, 5493, 11, 14098, 30627, 11, 8314, 412, 30627, 11, 323, 21152, 589, 30627, 13, 2684, 7784, 332, 17462, 1705, 889, 10726, 30774, 198, 96420, 323, 25475, 1295, 5043, 96420, 13, 4702, 9274, 1475, 95883, 5603, 8941, 332, 17462, 706, 1220, 198, 24249, 388, 323, 36051, 812, 627, 2028, 18228, 374, 9274, 832, 1073, 49818, 461, 33288, 4612, 82, 315, 83664, 1705, 25, 279, 13066, 2833, 278, 7058, 1705, 11, 2419, 974, 889, 29115, 7019, 12601, 11, 26153, 11, 65879, 11, 323, 13066, 4779, 315, 55911, 38925, 11, 1332, 7058, 17822, 11, 323, 782, 668, 1354, 13, 2684, 617, 2736, 1027, 3892, 18872, 11890, 3249, 11077, 263, 1431, 17483, 198, 24217, 37842, 33690, 304, 79371, 3978, 13, 1472, 19553, 2736, 9687, 922, 279, 13772, 27121, 315, 985, 198, 258, 61694, 34072, 11, 87195, 46192, 11, 323, 1605, 66121, 7019, 12601, 11, 26153, 323, 19644, 919, 627, 29174, 6509, 455, 2833, 5603, 8941, 332, 17462, 8625, 30670, 391, 2000, 1820, 359, 86, 661, 323, 49983, 84, 7058, 66, 660, 13, 1472, 17483, 13363, 422, 9514, 82199, 311, 25802, 349, 701, 8403, 11, 4885, 11, 3070, 1174, 438, 81437, 198, 9274, 279, 8566, 398, 1022, 1573, 287, 1070, 31628, 811, 315, 6509, 455, 2833, 278, 1705, 13, 1115, 18228, 345, 3473, 11, 24400, 389, 6509, 2184, 315, 24217, 37842, 3463, 11, 323, 54719, 11449, 5794, 11, 430, 14625, 82615, 198, 1820, 1005, 315, 33690, 439, 264, 4725, 961, 315, 264, 9498, 10173, 627, 4218, 13, 17, 13, 16, 578, 43491, 6150, 323, 11699, 7984, 30921, 198, 791, 80506, 5603, 311, 26677, 374, 3196, 389, 1521, 77772, 21463, 512, 16, 11829, 3823, 477, 25893, 2191, 649, 29166, 304, 269, 25893, 292, 34072, 11, 46192, 11, 42500, 33969, 11, 5099, 627, 17, 69877, 315, 26677, 649, 387, 87195, 323, 20011, 304, 961, 4619, 315, 304, 2860, 627, 18, 2112, 332, 37842, 3966, 617, 1027, 30357, 11075, 323, 12756, 30239, 627, 19, 93868, 374, 2731, 16853, 2460, 315, 1521, 21463, 527, 905, 13, 6914, 529, 274, 27851, 21635, 1124, 832, 555, 832, 627, 4218, 13, 17, 13, 16, 13, 16, 15128, 2826, 674, 75, 25, 1226, 3053, 10377, 553, 763, 61694, 84886, 323, 29560, 38925, 198, 4599, 856, 53766, 23881, 574, 264, 82279, 893, 11, 568, 501, 13111, 279, 566, 352, 5151, 1855, 10683, 311, 198, 13923, 369, 21494, 287, 24428, 13, 34266, 820, 69991, 349, 1225, 1060, 832, 1073, 339, 752, 10922, 3278, 889, 12439, 198, 258, 1820, 4903, 1053, 2586, 311, 26301, 9184 ]
0xBreath/holistic-books
fixed object. Shetold usthatshehadbeen amazed atfirst tofind outjusthow many times she was required todoher“deep-knee act,” asshecalled it,during thecourse ofasingle day.However,shewaswell rewarded forthisonesimple discipline which sheimposed upon herself. Herback gradually improved andshefound thattheexercise helped herin other ways, too,since shebegan toenjoy greater vitality than shehadknown prior tothe injury. Walking -When walking, oneshould maintain the“Tall,IAM Somebody Look.” Letthehead touch theskyandtheentire body willhave tofollow.Tuckthechin in,but keep thehead slightly forward inanunstressed position. Thepelvis should beslightly forward and the toes should point the way—straight ahead! Always wear comfortable walking shoes, preferably constructed ofsome sturdy,but porous material which willlend support butalso permit gaseous toxins toescape. Walkatafastpace, swinging thearms vigorously.This kind ofwalking, asopposed toleisure- lystrolling, willserve tostrengthen back, side andabdominal muscles aswell asthose of the extremities. Lifting -Wehave allheard therules. I’msure, about how toliftheavy objects, but how often wefailtoabide bythem. Therefore, perhaps itisinorder forustorepeat them forthebenefit ofourstudents asthey work tocorrect other people’ serrors. Perhaps the advice ofourhousewife will help ustoremember them. Always bend with theknees, notwith theback. Keep theback straight. Liftwith your legs andhold theobject close tothebody.Liftonly totheheight ofthechest. And always seetoitthatyour feetare firmly planted on an even, non-skid surface. Ifanobject isheavy,gethelp. Don’ ttrytoprove anything bytrying toliftorshove heavy loads andavoid shifting thatcanthrow aperson offbalance andcause asudden twisting of the body which can sprain or tear a ligament. 96.5.4 If There Is a Back Injury, Certain Common Habits Should Be Overcome 1.Ifyoumust liftarather heavy object, make certain thatthedestination oftheobject, i.e., where youwillplace thatobject, isdirectly ahead ofyou. This willhelp youavoid twist- ing the body. 2.Don’ t try to lift anything above shoulder level. 3.Don’ twear high-heeled orplatform shoes. Any sudden throwing offbalance might cause further injury.Additionally,when such shoes areworn, thecenter ofgravity isthrown offthenorm, thus rendering anindividual more likely tolose balance. High heels also tend tocause organs toshift from their normal alignment, astate ofaffairs thatsends silent stress signals tearing through the nerve pathways. 4.Don’ tforgettohave thecarseatadjust toYOU. Stretching forthepedals orforthesteer- ing wheel increases the curve of the lower back to cause strain. 5.When sitting inachair,don’tslump. Avoid leaning forward foranyprolonged length of time. Arching the back in this manner is conducive to more pain. 6.Ifyour mattress isuncomfortably soft, oritsags, orifthecushions inafavorite chair do notgive fullsupport toyour injured back, make some changes. Without fullsupport, an aching back will continue to trouble. 96.6. Exercise—General 96.6.1 Exercises Designed to Stimulate Circulation and to Stretch T ight Muscles 96.6.2 Exercises for Balance, Posture, Circulation and Increasing Coordination 96.6.3 Exercise Planning 96.6.4 T eaching the Client How to Get the Most Out of Exercise 96.6.1 Exercises Designed to Stimulate Circulation and to Stretch Tight Muscles Performed While Sitting — 1.Sitwell balanced onthefloor with both legsstretched outinfront ofyou. Pullknees up tochest. Relax. Touch head totheknees. Relax. Repeat. Atfirst, youmay notbeable to bring knees alltheway uportotouch them with thehead. Persistence willsoon payoff. 2.Insame position, place thearms under bent knees. Now,straighten outright leg.Return to original position. Straighten out left leg. Return. Repeat, alternating legs. 3.Insitting position with legsstretched outonfloor infront, bend forward from hips keep- ingtheback straight with arms bent atelbows andheld intoside. Hold bent position, but do not bounce. 4.Insame position asinno.3immediately above, spread legsapart andstretch down first totheright legandthen totheleft, maintaining thestraight back atalltimes. Hold the stretch position for the count of 5 each time before relaxing.5.Inthesitting position, place pillow under calfandrotate ankles ofleftleg,then theright leg. Performed While Standing — 1.Clasp hands behind theback. Now straighten thearms, shoulders, andback. Breathe in quickly to the count of 4. Relax and breathe out to the count of 7. Repeat. 2.Raise arms tothefront, breathing inasyouraise thearms andexhaling asyoulower them—as follows: 1.Raise to shoulder height. Then lower to side. 2.Raise above head, stretch to the ceiling. Let the eyes look at the ceiling. Lower to side. 3.Raise above the head, turn the palms out. Lower to side. Start this exercise with 3 repeats and gradually add more as you feel comfortable. 3.Place hands onsides directly infront ofhipbones. Now bend forward toahorizontal position. Keep back straight. Feel thestretch intheback andlegs. Bend knees slightly and then come up to straight position. 4.Withthefeetslightly apart, elbows bent, rotate shoulders front toback several times. Reverse and rotate back to front. 5.Deep knee bend. Justbend knees slightly.This willbesufficient toexercise many mus- cles without attempting the deep knee bend which may traumatize injured parts. Performed While L ying on the Floor — 1.Lieontheback with legs straight onfloor.Pull right knee uptoward thechest. Hold in thisposition tocount of10.Besure totuck thechin in,donotlethead fallbackwards. Repeat with left knee. 2.Pullboth legsuptochest andhold inthisposition with arms clasped around knees fora count of 10. Don’ t forget to breathe as you count. 3.Insame position asinexercise two. 2,extend right legupandforward intotheair.Lower slowly.Repeat with right legseveral times andthen perform thesame movement with the left leg. 4.Turnandlieononeside. Place hand under thehead. Bend thebottom legslightly.Now raise the top leg up and down, pointing the toes. Repeat several times. 5.Turn and lie on the other side and repeat the same exercise. Performed on the Hands and Knees — 1.Getinposition onhands andknees andrelax. Now hump theback. Push itupasfaras is comfortable. Relax. Repeat. 2.Same exercise asabove, except asyouarch theback, bring thehead down. Now bring right knee intowards thehead, then straighten legoutagain behind youasyouraise the head andstraighten theback. Repeat several times with right leg,then repeat exercise using left leg. 3.Sitback ontheheels. Now stretch outyour arms andhead onthefloor infront. Hold for a few seconds, then return to original position. Repeat several times. 4.Lieonthestomach. Then place theelbows onthefloor andclasp hands together inafist. Place forehead ontheclasped hands. Now straighten theright legoutbehind andraise it upwards as high as you can. Lower. Repeat several times. Repeat with left leg. 96.6.2 Exercises for Balance, Posture, Circulation and Increasing Coordination 1.Place feettogether,arms hanging atthesides. Now,liftboth arms over thehead and, at thesame time, bend theleftknee uptothechest ashigh aspossible. Hold afewseconds. Return toposition. Repeat with right knee inthesame manner.When comfortable doingthisexercise, client should trytoalternate, using first onelegandthen theother while maintaining balance. 2.Stand with thefeettogether,onehand onthewall orapiece offurniture tolend support. Intwoeven counts, swing theleftlegforward andback. Keep theback straight, pull theabdomen up,andelevate thechest asthelegswings back. Allthemovement should beinthehip.Keep knee straight andthelegswinging likethependulum inaclock. Re- peat with other leg.Assistance inmaintaining balance may berequired bypersons with severely-weakened muscles. 96.6.3 Exercise Planning Inworking with clients, itisalways advisable topresent theexercises inseries; that is,thisweek dothese, next week, another set,andsoon.This will sustain interest by giving variety totheprogram. Clients should beadvised toperform exercises, when pos- sible tomusic. Thetempo ofthemusic should bevaried according totheageandcondi- tionofthep
[ 22795, 1665, 627, 2059, 295, 820, 577, 31177, 1900, 383, 32345, 82850, 46304, 520, 3983, 311, 3990, 704, 4345, 5269, 1690, 3115, 1364, 198, 16514, 2631, 12067, 1964, 2118, 33980, 12934, 34191, 1180, 2476, 1089, 42750, 4841, 433, 12260, 1711, 279, 12120, 315, 300, 2222, 198, 1316, 67103, 2099, 1174, 939, 365, 300, 9336, 44937, 369, 576, 3233, 6592, 26434, 902, 1364, 318, 3950, 198, 59723, 11937, 13, 6385, 1445, 27115, 13241, 323, 32158, 15456, 430, 1820, 64562, 9087, 1077, 258, 198, 1605, 5627, 11, 2288, 10900, 1736, 1364, 65, 16133, 100134, 4215, 7191, 75716, 1109, 1364, 32345, 5391, 4972, 311, 1820, 198, 258, 42861, 16853, 79616, 482, 4599, 11689, 11, 389, 4385, 619, 10519, 279, 2118, 51, 543, 38868, 1428, 94192, 9372, 49216, 10267, 1820, 2025, 5916, 279, 27782, 438, 1820, 306, 556, 2547, 690, 19553, 311, 19070, 662, 51, 1983, 1820, 60171, 304, 100004, 198, 13397, 279, 2025, 10284, 4741, 108019, 359, 267, 14715, 2361, 13, 578, 48624, 2749, 1288, 9234, 80598, 198, 13741, 323, 279, 45713, 1288, 1486, 279, 1648, 2345, 89292, 8469, 4999, 38195, 10051, 10882, 11689, 15653, 11, 52754, 20968, 315, 15031, 45652, 1174, 8248, 198, 4406, 788, 3769, 902, 690, 75, 408, 1862, 719, 19171, 11810, 342, 521, 788, 62186, 311, 13295, 13, 12839, 460, 9533, 1330, 11, 55060, 279, 16293, 77849, 662, 2028, 3169, 315, 81749, 11, 439, 454, 3950, 311, 273, 33237, 7058, 398, 267, 16608, 11, 690, 13570, 311, 67523, 18972, 1203, 11, 3185, 323, 370, 5717, 992, 24569, 439, 9336, 12025, 71, 974, 198, 1073, 279, 6000, 1385, 627, 43, 18148, 482, 1687, 19553, 682, 55603, 9139, 2482, 13, 358, 529, 1026, 554, 11, 922, 1268, 39674, 333, 1820, 5781, 6302, 11, 719, 198, 5269, 3629, 584, 18910, 998, 370, 579, 555, 49818, 13, 15636, 11, 8530, 433, 58504, 1382, 369, 592, 461, 11221, 1124, 198, 2000, 1820, 68244, 275, 315, 414, 38318, 12025, 36661, 990, 311, 20523, 1023, 1274, 529, 274, 7805, 13, 19292, 279, 198, 329, 1805, 315, 414, 7830, 48841, 690, 1520, 577, 4412, 9792, 1124, 13, 24119, 37920, 449, 279, 74, 69819, 345, 1962, 4291, 279, 1445, 13, 13969, 279, 1445, 7833, 13, 53535, 4291, 701, 14535, 323, 6416, 279, 1735, 3345, 198, 998, 1820, 2664, 662, 43, 91361, 398, 311, 1820, 2627, 315, 1820, 27417, 13, 1628, 2744, 513, 11269, 275, 9210, 22479, 7693, 548, 198, 8978, 398, 39441, 389, 459, 1524, 11, 2536, 46407, 307, 7479, 627, 2746, 276, 1735, 374, 89945, 1174, 456, 8823, 13, 4418, 529, 259, 1568, 3565, 51515, 4205, 555, 85134, 311, 36069, 269, 939, 1009, 198, 89945, 21577, 323, 48956, 32931, 430, 4919, 7265, 1469, 1293, 1022, 22298, 323, 1593, 439, 39095, 198, 15930, 11330, 315, 279, 2547, 902, 649, 8314, 467, 477, 18036, 264, 29413, 2908, 627, 4161, 13, 20, 13, 19, 1442, 2684, 2209, 264, 6984, 66176, 11, 35211, 7874, 29976, 1220, 12540, 2893, 6193, 2063, 198, 16, 34001, 9514, 25849, 12157, 277, 1894, 8987, 1665, 11, 1304, 3738, 430, 79371, 21298, 315, 1820, 1735, 11, 602, 1770, 39188, 2940, 499, 14724, 2050, 430, 1735, 11, 374, 20384, 398, 8469, 315, 9514, 13, 1115, 690, 8823, 499, 48956, 27744, 7058, 287, 279, 2547, 16853, 17, 920, 263, 529, 259, 1456, 311, 12157, 4205, 3485, 17308, 2237, 627, 18, 920, 263, 529, 4483, 686, 1579, 38435, 41189, 477, 16111, 15653, 13, 5884, 11210, 21939, 1022, 22298, 2643, 5353, 198, 69, 4004, 11134, 662, 50674, 1174, 9493, 1778, 15653, 527, 86, 1540, 11, 279, 3133, 315, 71891, 6127, 71, 4935, 198, 1885, 3473, 494, 11, 8617, 21568, 459, 55977, 810, 4461, 311, 1497, 8335, 13, 5234, 34460, 1101, 198, 83, 408, 311, 1593, 36853, 311, 13724, 505, 872, 4725, 17632, 11, 264, 2513, 315, 2715, 4825, 41136, 1438, 198, 69758, 8631, 17738, 56836, 1555, 279, 32015, 44014, 627, 19, 920, 263, 529, 259, 41119, 998, 19553, 279, 66, 2648, 266, 39819, 311, 57489, 13, 61205, 287, 13544, 752, 291, 1147, 477, 71627, 18223, 261, 7058, 287, 13587, 12992, 279, 16029, 315, 279, 4827, 1203, 311, 5353, 26800, 627, 20, 51861, 11961, 304, 613, 1334, 1174, 15357, 1431, 3306, 1538, 13, 35106, 49448, 4741, 369, 3852, 782, 4930, 291, 3160, 315, 198, 1712, 13, 9683, 287, 279, 1203, 304, 420, 11827, 374, 95561, 311, 810, 6784, 627, 21, 34001, 22479, 33326, 374, 359, 19975, 2915, 8579, 11, 477, 1220, 2076, 11, 477, 58710, 762, 1136, 919, 304, 2642, 15995, 10716, 656, 198, 1962, 47530, 2539, 24249, 22068, 414, 15902, 1203, 11, 1304, 1063, 4442, 13, 17586, 2539, 24249, 11, 459, 198, 12092, 1203, 690, 3136, 311, 12544, 627, 4161, 13, 21, 13, 33918, 2345, 15777, 198, 4161, 13, 21, 13, 16, 91554, 48525, 311, 71872, 6468, 16741, 2987, 323, 311, 61205, 350, 220, 492, 5444, 19153, 198, 4161, 13, 21, 13, 17, 91554, 369, 31946, 11, 3962, 554, 11, 16741, 2987, 323, 74540, 48949, 2617, 198, 4161, 13, 21, 13, 18, 33918, 28780, 198, 4161, 13, 21, 13, 19, 350, 1855, 287, 279, 8589, 2650, 311, 2175, 279, 7648, 4470, 315, 33918, 198, 4161, 13, 21, 13, 16, 91554, 48525, 311, 71872, 6468, 16741, 2987, 323, 311, 61205, 75446, 5444, 19153, 198, 15200, 6104, 84854, 107216, 16, 815, 275, 9336, 24770, 389, 339, 830, 4081, 449, 2225, 14535, 267, 62837, 704, 258, 7096, 315, 9514, 13, 32928, 74, 69819, 709, 198, 998, 27417, 13, 68685, 13, 19898, 2010, 311, 339, 1247, 69819, 13, 68685, 13, 45901, 13, 2468, 3983, 11, 499, 18864, 539, 1395, 481, 311, 198, 82477, 31624, 682, 16142, 352, 577, 403, 354, 3102, 1124, 449, 279, 2025, 13, 65336, 690, 67156, 85365, 627, 17, 5450, 25030, 2361, 11, 2035, 279, 16293, 1234, 30280, 31624, 13, 4800, 1174, 89292, 268, 40228, 2531, 47450, 198, 998, 4113, 2361, 13, 46910, 268, 704, 2163, 2531, 13, 3494, 13, 45901, 11, 73462, 14535, 627, 18, 5450, 82, 15154, 2361, 449, 14535, 267, 62837, 704, 263, 31549, 304, 7096, 11, 37920, 4741, 505, 43523, 2567, 7058, 287, 1820, 1445, 7833, 449, 11977, 30280, 520, 301, 55631, 323, 28708, 528, 437, 579, 13, 23588, 30280, 2361, 345, 8248, 656, 539, 34782, 627, 19, 5450, 25030, 2361, 439, 258, 2201, 13, 18, 318, 44287, 3485, 11, 9041, 14535, 391, 472, 323, 73184, 1523, 1176, 198, 998, 700, 492, 2531, 438, 3473, 311, 1820, 2414, 11, 20958, 279, 89292, 1203, 520, 543, 15487, 13, 23588, 279, 198, 73184, 2361, 369, 279, 1797, 315, 220, 20, 1855, 892, 1603, 34948, 13, 20, 5450, 6509, 15154, 2361, 11, 2035, 43425, 1234, 65643, 438, 16611, 90713, 315, 2414, 1978, 11, 3473, 9139, 492, 198, 1978, 627, 15200, 6104, 46327, 107216, 16, 22338, 13671, 6206, 4920, 279, 1445, 13, 4800, 7833, 268, 279, 16293, 11, 28004, 11, 323, 1445, 13, 426, 1244, 383, 304, 198, 28863, 398, 311, 279, 1797, 315, 220, 19, 13, 68685, 323, 37397, 704, 311, 279, 1797, 315, 220, 22, 13, 45901, 627, 17, 91698, 11977, 311, 339, 830, 9598, 11, 27027, 304, 6539, 414, 4105, 279, 16293, 323, 327, 71, 6260, 439, 9514, 15115, 198, 49818, 60654, 11263, 512, 16, 91698, 311, 17308, 2673, 13, 5112, 4827, 311, 3185, 627, 17, 91698, 3485, 2010, 11, 14841, 311, 279, 22959, 13, 6914, 279, 6548, 1427, 520, 279, 22959, 13, 28636, 311, 3185, 627, 18, 91698, 3485, 279, 2010, 11, 2543, 279, 75818, 704, 13, 28636, 311, 3185, 627, 3563, 420, 10368, 449, 220, 18, 44694, 323, 27115, 923, 810, 439, 499, 2733, 10882, 627, 18, 87775, 6206, 49549, 3422, 6089, 304, 7096, 315, 2200, 82091, 13, 4800, 37920, 4741, 311, 1494, 8263, 198, 3571, 13, 13969, 1203, 7833, 13, 32833, 279, 73184, 304, 1820, 1445, 323, 73336, 13, 48838, 31624, 10284, 198, 438, 1243, 2586, 709, 311, 7833, 2361, 627, 19, 27216, 339, 46053, 1441, 80598, 10980, 11, 82012, 30280, 11, 17348, 28004, 4156, 311, 1445, 3892, 3115, 627, 46795, 323, 17348, 1203, 311, 4156, 627, 20, 56702, 22095, 37920, 13, 4702, 65, 408, 31624, 10284, 662, 2028, 690, 9620, 27781, 311, 64562, 1690, 3167, 7058, 19153, 2085, 19969, 279, 5655, 22095, 37920, 902, 1253, 99136, 553, 15902, 5596, 627, 15200, 6104, 445, 379, 287, 389, 279, 16990, 107216, 16, 1236, 648, 263, 1820, 1445, 449, 14535, 7833, 389, 31549, 662, 37168, 1314, 22095, 35435, 83071, 279, 27417, 13, 23588, 304, 198, 576, 3571, 311, 1868, 315, 605, 1823, 288, 554, 2458, 1983, 279, 60171, 304, 12260, 263, 51626, 11671, 33872, 4102, 627, 39818, 449, 2163, 22095, 627, 17, 98457, 21704, 14535, 7717, 5059, 478, 323, 6416, 304, 576, 3571, 449, 11977, 57220, 7018, 2212, 31624, 86084, 198, 1868, 315, 220, 605, 13, 4418, 529, 259, 10894, 311, 37397, 439, 499, 1797, 627, 18, 5450, 25030, 2361, 439, 258, 64562, 1403, 13, 220, 17, 11, 26103, 1314, 2531, 455, 438, 13741, 1139, 1820, 1334, 1236, 1223, 198, 36311, 398, 662, 39818, 449, 1314, 2531, 325, 17998, 3115, 323, 3473, 2804, 279, 25030, 7351, 449, 198, 1820, 2163, 2531, 627, 19, 844, 399, 438, 11828, 263, 3233, 579, 13, 11004, 1450, 1234, 279, 2025, 13, 48838, 279, 15205, 2531, 3306, 73048, 662, 7184, 198, 19223, 279, 1948, 2531, 709, 323, 1523, 11, 22364, 279, 45713, 13, 45901, 3892, 3115, 627, 20, 844, 399, 323, 10457, 389, 279, 1023, 3185, 323, 13454, 279, 1890, 10368, 627, 15200, 389, 279, 43396, 323, 735, 69819, 107216, 16, 2283, 258, 3571, 389, 89112, 323, 74, 69819, 323, 3833, 710, 13, 4800, 305, 1538, 279, 1445, 13, 23804, 433, 455, 300, 24470, 300, 198, 285, 10882, 13, 68685, 13, 45901, 627, 17, 815, 373, 10368, 439, 49532, 11, 3734, 439, 9514, 1132, 279, 1445, 11, 4546, 279, 2025, 1523, 13, 4800, 4546, 198, 1315, 22095, 528, 71839, 279, 2025, 11, 1243, 7833, 268, 2531, 412, 33871, 4920, 499, 6539, 414, 4105, 279, 198, 2025, 323, 89292, 268, 279, 1445, 13, 45901, 3892, 3115, 449, 1314, 2531, 11, 3473, 13454, 10368, 198, 985, 2163, 2531, 627, 18, 815, 275, 1445, 389, 1820, 73610, 13, 4800, 14841, 704, 22479, 11977, 323, 2025, 389, 339, 830, 4081, 304, 7096, 13, 23588, 369, 198, 64, 2478, 6622, 11, 1243, 471, 311, 4113, 2361, 13, 45901, 3892, 3115, 627, 19, 1236, 648, 6167, 478, 316, 613, 13, 5112, 2035, 279, 301, 55631, 389, 339, 830, 4081, 323, 566, 13671, 6206, 3871, 304, 2642, 380, 627, 17826, 52354, 389, 1820, 87363, 7018, 6206, 13, 4800, 7833, 268, 9139, 492, 2531, 412, 30998, 485, 323, 19223, 433, 198, 455, 4102, 439, 1579, 439, 499, 649, 13, 28636, 662, 45901, 3892, 3115, 13, 45901, 449, 2163, 2531, 627, 4161, 13, 21, 13, 17, 91554, 369, 31946, 11, 3962, 554, 11, 16741, 2987, 323, 74540, 48949, 2617, 198, 16, 87775, 7693, 998, 3522, 1174, 16293, 21363, 520, 6509, 3422, 13, 4800, 1174, 36069, 21704, 11977, 927, 279, 2025, 323, 11, 520, 198, 6509, 373, 892, 11, 37920, 279, 2414, 74, 34191, 81226, 1820, 27417, 439, 12156, 439, 10236, 13, 23588, 8136, 365, 17859, 627, 5715, 311, 3571, 13, 45901, 449, 1314, 22095, 304, 6509, 373, 11827, 662, 4599, 10882, 3815, 576, 64562, 11, 3016, 1288, 1456, 998, 76462, 11, 1701, 1176, 832, 1978, 438, 3473, 279, 1605, 1418, 198, 67913, 2101, 8335, 627, 17, 7914, 438, 449, 279, 1897, 53979, 3522, 1174, 606, 10888, 389, 16142, 543, 477, 391, 9286, 1022, 25597, 39674, 408, 1862, 627, 1090, 1146, 17206, 14921, 11, 19336, 279, 2414, 1978, 13741, 323, 1445, 13, 13969, 279, 1445, 7833, 11, 6958, 198, 1820, 370, 5717, 268, 709, 11, 23775, 3532, 349, 279, 27417, 12025, 383, 1978, 2332, 826, 1203, 13, 2052, 49818, 14797, 1288, 198, 1395, 258, 1820, 2200, 13, 19999, 22095, 7833, 323, 1820, 1978, 2332, 24992, 3208, 19030, 3825, 16903, 304, 582, 1039, 13, 1050, 7058, 11221, 449, 1023, 2531, 11108, 4011, 304, 67913, 2101, 8335, 1253, 28031, 3004, 555, 77751, 449, 198, 325, 424, 989, 62441, 3448, 291, 24569, 627, 4161, 13, 21, 13, 18, 33918, 28780, 198, 644, 21837, 449, 8403, 11, 433, 285, 33222, 69919, 1948, 2762, 279, 327, 48815, 304, 20473, 26, 430, 198, 285, 23224, 10476, 656, 45010, 11, 1828, 2046, 11, 2500, 743, 51526, 67156, 29845, 690, 14201, 2802, 555, 198, 70, 2299, 8205, 311, 339, 752, 87220, 13, 48508, 1288, 75607, 26451, 311, 29588, 23783, 11, 994, 1153, 7058, 82, 1260, 10390, 11785, 13, 666, 295, 22893, 315, 49818, 11785, 1288, 387, 959, 1142, 4184, 311, 1820, 425, 438, 1321, 72, 7058, 28491, 1073, 339, 752 ]
0xBreath/holistic-books
decide our nationality, our race, our heritage? Someone or something else does, I think. Get yourself quiet and listen. Perhaps you will hear a voice speak within you. Then you will learn whether you are to live or die.” The end seemed near. Surely it was useless to struggle further. For the first time in his life the painter was able to give over direction of his destiny to something other than his own ego. The bitter cold of approaching night descended on them. Just before dusk a British seaplane swooped out of the fog with a roar, saw them, landed on the sea, took them aboard. They were in a London hospital that night.After some weeks of convalescence, our painter once again tried his hand at his easel. What emer ged from the canvas startled him. It was as if a hand other than his own guided the brush, chose the colors, as though a mind other than his own envisaged the scene. V iewing the complete painting he felt a sur ge of joy. This was the talent he had fought to bring forth, and now it was flowing! In rapid succession he completed six paintings, packed them off to a London art dealer, where they were received with open arms. They were an instantaneous success, launching him on a long and remarkable career. Years later he was asked about his early period of struggle and how his talent happened to mature. “It didn’ t mature,” he answered. “It was there all the time. I just never could bring it out because I thought it belonged to me. As soon as I was able to see that it belonged to a being greater than I, it emer ged of its own accord and used me, where before I had been trying vainly to use it.” Mystical, yes, a kind of cosmic perception by the artist of his muse, but a far greater secret is hidden here. Our painter stumbled upon the psychological relationship of ego to Secret Self that brooks no failure, that inevitably leads to success, for it is a relationship in which all thought and action proceed out of a universal intelligence and omnipotent power that makes each work absolutely ef fective. Fall fr om Grace Our consciousness is anchored falsely in our surface selves, and it is this delusion that is our fall from grace, for by it we do not know who we truly are and fancy ourselves as tiny isolated selves in a vast and overwhelming universe. The gradual opening and unfolding of consciousness to that point where the vistas within our psyche are revealed is the goal of evolution itself, as life and intelligence and being manifest out of matter, and eventually control and dominate matter. As long as we remain chained tothe illusion of the surface self we are but puppets of sensation, reacting this way or that to every situation that confronts us, little more than absolutely predictive ciphers in an equation aimed at producing the free, thinking, omnipotent human. Y et this condition of freedom and omnipotence needs only perception, for without doubt the mere act of perceiving the Secret Self is akin to becoming one with the Secret Self. How then shall we see? How shall our eyes be opened? Perhaps the most important step in discerning the Secret Self is disillusionment with the ef fectiveness of the surface self, for how is it possible to see when we still rejoice in our blindness? So it is that spiritual awareness, psychic enlightenment, seldom comes to one in youth, for youth is preoccupied with the senses, pursues all manner of sensual inamorata, and is for the most part completely oblivious of the prison which the senses have erected. Passing years bring the disappointments, the frustrations and inadequacies that cause the seeking soul to cast about within psychic realms for a new foundation on which to erect a more reliable and ef fective sense of self. When this comes, eventual enlightenment is assured, for no one seeks but they find, knocks but the door is opened. The mere act of turning away from the senses and the surface self seems suf ficient. The veil is removed, the blinder disintegrated, and an event in psychic life that was brought about by suf fering and frustration and disillusionment turns out to be the greatest of blessings in disguise. A new world is revealed. The death of the surface self actually turns out to be a new birth. Resignation of the senses from control of the person turns out to be a seizing of the reins of the life by a new and dominant and ef fective force. When the inner eye of the soul is opened, there descends upon the whole being a unity of parts and force, a vitality and serenity that remake that life completely, that lend magic and grandeur to everything that is touched or taken into consciousness. Who sees with equal eye, as God of all A hero perish or a sparrow fall Atoms or systems into ruin hurl’dAnd now a bubble burst, and now a world. — ALEXANDER POPE Path to Illumination While it is true that perception of the indwelling Secret Self ordinarily comes to harassed mortals only after much suf fering and disillusionment, nevertheless there is a path by which such suf fering may be avoided in the main, provided that first the soul is dedicated and sincere in its desire to make the discovery. The Secret Self is never discovered alone within, but at the same time is discovered in all places, in all beings, and is found to be the same in all. Dif ferent forms of life are merely disguises donned for the moment by the single self that underlies all, that truly is all, a play in which for the moment the Divine is hidden, in which for that moment it actually has become in entirety each of the things it has become. All the power and effectiveness of the Supreme is within you, is yours to use, and is also in everyone and everything else, existing there behind the curtain of ego- consciousness, waiting to be discovered. Therefore there is a tremendous underlying equality to all things under the sun. Each is sprung from the same substance and has inherent within it the same omnipotent being, and we are not each of us dif ferent and individual and separate except insofar as we are incomplete. T o be complete is to be the Secret Self, whole and entire, without reservation or error. The most painless path to illumination, to perception of the Secret Self, is thus to arrive at a desire to know the truth that lies behind the surface facade of the senses and to seek this truth not only within but without, in every person you meet as well as in yourself. Once this sense of absolute equality of things and people begins to make itself known to you, then you will detect a presence in each stone and clod, in each tree and plant, in each animal and person you meet, locked in a prison dictated by its form to be sure, but a presence pure and simple of the Secret Self, which has chosenthe masquerade for its own purposes and is not truly locked away from consciousness of its real self but even now is developing it as we brush at the veil that separates us from our heritage. Once you sense the presence of the Divine in all things, you are able to arrive at a sense of equality that makes you in some secret and inviolable corner of your being untouched by victory or defeat, pleasure or pain, position or prestige. Y ou become so intent on doing the work of the Secret Self that you abandon almost altogether the uses of the ego and so achieve a kind of selflessness in your appearance to the world. Equality is a perfect psychic position but is impossible to the ego, which seeks forever to be better than all the egos around it, and if it is not better it is convinced it is worse and so either becomes blown-up and blind or wounded and fearful and thus provides the worst of all psychic bases for dealing with life, love, and accomplishment. T o be equal is to be unafraid. T o know that there inhabits all others the same being that inhabits you is to achieve a psychic confidence that enables you to place your life and hopes and ener gies in the hands of this being without a qualm, with absolute certainty that you will be guided to perform that work that you must do, in the best of all possible ways, at the best of all possible times. The Phantom Material W orld It is an established fact that our five senses perceive but the tiniest portion of the almost infinite spectrum of vibrations that prevails in the universe, that a million times more remains untold about each thing than can possibly be perceived by sensual means. Whistles can be made which are imperceptible to the human ear but are easily heard by certain animals. The frequency of vibration we know as light is strictly bounded as to the range that has an ef fect on the human eye, but nevertheless we know there are variations in what people can see — some are colorblind, others nearsighted, others farsighted; some have an artist’ s vision, to others materializations appear, as to Bernadette at Lourdes. In short, materialistswho pride themselves on accepting nothing but the evidence of their senses are accepting the sketchiest of evidence; they actually pride themselves on their blindness, accepting things as facts on the basis of knowing a mere
[ 10491, 1057, 59343, 1174, 1057, 7102, 11, 1057, 28948, 30, 35272, 477, 198, 34431, 775, 1587, 11, 358, 1781, 13, 2175, 6261, 11594, 323, 9020, 13, 19292, 499, 690, 198, 87160, 264, 7899, 6604, 2949, 499, 13, 5112, 499, 690, 4048, 3508, 499, 527, 311, 3974, 198, 269, 2815, 49216, 791, 842, 9508, 3221, 662, 65288, 433, 574, 29948, 311, 14993, 4726, 662, 1789, 279, 1176, 198, 1712, 304, 813, 2324, 279, 30581, 574, 3025, 311, 3041, 927, 5216, 315, 813, 47176, 311, 198, 34431, 1023, 1109, 813, 1866, 37374, 13, 578, 26242, 9439, 315, 31047, 3814, 198, 8784, 2954, 389, 1124, 13, 4702, 1603, 93985, 264, 8013, 513, 391, 38947, 34227, 16771, 704, 315, 279, 198, 69, 540, 449, 264, 78724, 1174, 5602, 1124, 11, 27212, 389, 279, 9581, 11, 3952, 1124, 37606, 13, 2435, 1051, 198, 258, 264, 7295, 8952, 430, 3814, 37992, 1063, 5672, 315, 5804, 3916, 36634, 11, 1057, 30581, 3131, 1578, 6818, 813, 1450, 520, 198, 26301, 2593, 301, 13, 3639, 991, 261, 53293, 505, 279, 10247, 89815, 1461, 13, 1102, 574, 439, 422, 264, 1450, 198, 1605, 1109, 813, 1866, 33687, 279, 15998, 11, 14896, 279, 8146, 11, 439, 3582, 264, 4059, 198, 1605, 1109, 813, 1866, 85775, 3359, 279, 6237, 13, 650, 220, 572, 287, 279, 4686, 19354, 568, 198, 66922, 264, 1765, 3980, 315, 16267, 662, 1115, 574, 279, 11005, 568, 1047, 21095, 311, 4546, 13544, 11, 323, 1457, 198, 275, 574, 36612, 0, 763, 11295, 50787, 568, 8308, 4848, 36692, 11, 19937, 1124, 198, 1885, 311, 264, 7295, 1989, 24204, 1174, 1405, 814, 1051, 4036, 449, 1825, 11977, 13, 2435, 198, 52898, 459, 96219, 2450, 11, 28818, 1461, 389, 264, 1317, 323, 23649, 198, 95637, 16853, 55519, 3010, 568, 574, 4691, 922, 813, 4216, 4261, 315, 14993, 323, 1268, 813, 198, 51977, 306, 7077, 311, 15196, 627, 17818, 3287, 529, 259, 15196, 2476, 568, 19089, 13, 1054, 2181, 574, 1070, 682, 279, 892, 13, 358, 1120, 2646, 1436, 198, 82477, 433, 704, 1606, 358, 3463, 433, 46959, 311, 757, 13, 1666, 5246, 439, 358, 574, 3025, 311, 198, 4151, 430, 433, 46959, 311, 264, 1694, 7191, 1109, 358, 11, 433, 991, 261, 53293, 315, 1202, 1866, 14902, 198, 438, 1511, 757, 11, 1405, 1603, 358, 1047, 1027, 4560, 46604, 398, 311, 1005, 433, 49216, 44, 599, 950, 11, 10035, 11, 264, 3169, 315, 55801, 21063, 555, 279, 10255, 315, 813, 39948, 11, 719, 264, 198, 24470, 7191, 6367, 374, 8340, 1618, 13, 5751, 30581, 50157, 5304, 279, 198, 92109, 5848, 5133, 315, 37374, 311, 8769, 10323, 430, 2967, 35322, 912, 8060, 11, 430, 198, 483, 85, 35768, 11767, 311, 2450, 11, 369, 433, 374, 264, 5133, 304, 902, 682, 3463, 323, 198, 1335, 10570, 704, 315, 264, 20789, 11478, 323, 95529, 64632, 2410, 430, 198, 80785, 1855, 990, 11112, 31469, 282, 96978, 627, 720, 50872, 1448, 8019, 32171, 27907, 8140, 25917, 374, 78219, 61456, 304, 1057, 7479, 84137, 11, 323, 433, 374, 420, 198, 9783, 7713, 430, 374, 1057, 4498, 505, 21507, 11, 369, 555, 433, 584, 656, 539, 1440, 889, 584, 9615, 198, 548, 323, 27555, 13520, 439, 13987, 25181, 84137, 304, 264, 13057, 323, 22798, 198, 359, 8194, 13, 578, 53722, 8736, 323, 33831, 315, 25917, 311, 430, 1486, 198, 2940, 279, 96241, 2949, 1057, 88909, 527, 10675, 374, 279, 5915, 315, 15740, 198, 275, 726, 11, 439, 2324, 323, 11478, 323, 1694, 14794, 704, 315, 5030, 1174, 323, 198, 3163, 1870, 2585, 323, 41836, 5030, 662, 1666, 1317, 439, 584, 7293, 68069, 311, 1820, 41919, 315, 279, 7479, 659, 584, 527, 719, 15241, 65301, 315, 37392, 11, 74150, 420, 198, 3195, 477, 430, 311, 1475, 6671, 430, 17302, 82, 603, 11, 2697, 810, 1109, 11112, 198, 35798, 535, 272, 83177, 304, 459, 24524, 20034, 520, 17843, 279, 1949, 11, 7422, 345, 316, 70873, 64632, 3823, 13, 816, 1880, 420, 3044, 315, 11542, 323, 95529, 98660, 3966, 198, 3323, 21063, 11, 369, 2085, 10712, 279, 17983, 1180, 315, 824, 47444, 279, 8769, 10323, 198, 285, 53007, 311, 10671, 832, 449, 279, 8769, 10323, 13, 2650, 1243, 4985, 584, 1518, 30, 2650, 198, 19549, 1057, 6548, 387, 9107, 5380, 32576, 279, 1455, 3062, 3094, 304, 42645, 287, 279, 8769, 10323, 374, 198, 4338, 82262, 479, 449, 279, 31469, 282, 440, 13071, 315, 279, 7479, 659, 11, 369, 1268, 374, 433, 198, 10236, 311, 1518, 994, 584, 2103, 92859, 304, 1057, 85515, 30, 2100, 433, 374, 430, 18330, 198, 20111, 2136, 11, 50217, 81869, 11, 56452, 4131, 311, 832, 304, 12822, 11, 369, 12822, 198, 285, 864, 41456, 449, 279, 38207, 11, 10037, 1157, 682, 11827, 315, 60717, 304, 309, 269, 460, 345, 438, 374, 369, 279, 1455, 961, 6724, 94370, 315, 279, 9527, 902, 279, 38207, 198, 19553, 66906, 13, 77392, 1667, 4546, 279, 14429, 1392, 11, 279, 90034, 323, 198, 258, 1037, 447, 27121, 430, 5353, 279, 11125, 13836, 311, 6445, 922, 2949, 50217, 77563, 198, 2000, 264, 502, 16665, 389, 902, 311, 38732, 264, 810, 15062, 323, 31469, 282, 96978, 5647, 198, 1073, 659, 13, 3277, 420, 4131, 11, 42835, 81869, 374, 28478, 11, 369, 912, 832, 198, 325, 21854, 719, 814, 1505, 11, 85769, 719, 279, 6134, 374, 9107, 13, 578, 17983, 1180, 315, 13353, 198, 14075, 505, 279, 38207, 323, 279, 7479, 659, 5084, 56868, 282, 5499, 13, 578, 59355, 374, 198, 46856, 11, 279, 1529, 5863, 834, 396, 48272, 11, 323, 459, 1567, 304, 50217, 2324, 430, 574, 198, 65, 6478, 922, 555, 56868, 282, 4776, 323, 33086, 323, 98009, 479, 10800, 704, 311, 198, 1395, 279, 12474, 315, 56650, 304, 65081, 13, 362, 502, 1917, 374, 10675, 13, 578, 4648, 198, 1073, 279, 7479, 659, 3604, 10800, 704, 311, 387, 264, 502, 7342, 13, 1838, 625, 367, 315, 279, 198, 82, 4377, 505, 2585, 315, 279, 1732, 10800, 704, 311, 387, 264, 98306, 315, 279, 90518, 315, 279, 198, 14789, 555, 264, 502, 323, 25462, 323, 31469, 282, 96978, 5457, 13, 3277, 279, 9358, 8071, 315, 279, 198, 82, 11206, 374, 9107, 11, 1070, 6697, 1438, 5304, 279, 4459, 1694, 264, 31426, 315, 5596, 323, 198, 9009, 11, 264, 75716, 323, 1446, 56685, 430, 59155, 430, 2324, 6724, 1174, 430, 39580, 198, 38551, 323, 6800, 12844, 311, 4395, 430, 374, 24891, 477, 4529, 1139, 198, 64589, 2136, 627, 720, 15546, 16008, 449, 6273, 8071, 11, 439, 4359, 315, 682, 198, 32, 12084, 83217, 477, 264, 993, 6172, 4498, 198, 92403, 477, 6067, 1139, 38339, 94831, 7070, 3112, 1457, 264, 24529, 21165, 11, 323, 1457, 264, 1917, 627, 2345, 362, 36345, 4064, 643, 13228, 1777, 27907, 1858, 311, 61720, 2617, 27907, 8142, 433, 374, 837, 430, 21063, 315, 279, 1280, 86, 6427, 8769, 10323, 98081, 198, 6716, 311, 68610, 10237, 1147, 1193, 1306, 1790, 56868, 282, 4776, 323, 98009, 479, 345, 37593, 20583, 1070, 374, 264, 1853, 555, 902, 1778, 56868, 282, 4776, 1253, 387, 31890, 304, 279, 198, 3902, 11, 3984, 430, 1176, 279, 13836, 374, 12514, 323, 49424, 304, 1202, 12876, 311, 198, 7072, 279, 18841, 662, 578, 8769, 10323, 374, 2646, 11352, 7636, 2949, 11, 719, 520, 198, 1820, 1890, 892, 374, 11352, 304, 682, 7634, 11, 304, 682, 23837, 11, 323, 374, 1766, 311, 387, 198, 1820, 1890, 304, 682, 13, 423, 333, 18728, 306, 7739, 315, 2324, 527, 16632, 41877, 5014, 1541, 19212, 369, 279, 198, 29699, 555, 279, 3254, 659, 430, 1234, 49201, 682, 11, 430, 9615, 374, 682, 11, 264, 1514, 304, 902, 198, 2000, 279, 4545, 279, 43361, 374, 8340, 11, 304, 902, 369, 430, 4545, 433, 3604, 198, 4752, 3719, 304, 49017, 1855, 315, 279, 2574, 433, 706, 3719, 13, 2052, 279, 2410, 323, 198, 27153, 13071, 315, 279, 13814, 374, 2949, 499, 11, 374, 18821, 311, 1005, 11, 323, 374, 1101, 304, 198, 93057, 323, 4395, 775, 11, 6484, 1070, 4920, 279, 46866, 315, 37374, 7058, 64589, 2136, 11, 8748, 311, 387, 11352, 13, 15636, 1070, 374, 264, 28040, 198, 8154, 6852, 22526, 311, 682, 2574, 1234, 279, 7160, 13, 9062, 374, 92310, 505, 279, 198, 25030, 20278, 323, 706, 38088, 2949, 433, 279, 1890, 95529, 64632, 1694, 11, 323, 198, 906, 527, 539, 1855, 315, 603, 1422, 18728, 306, 323, 3927, 323, 8821, 3734, 304, 94671, 439, 198, 906, 527, 33243, 13, 350, 297, 387, 4686, 374, 311, 387, 279, 8769, 10323, 11, 4459, 323, 198, 306, 556, 11, 2085, 28767, 477, 1493, 16853, 791, 1455, 6784, 1752, 1853, 311, 77052, 11, 311, 21063, 315, 279, 8769, 10323, 11, 374, 198, 34232, 311, 17782, 520, 264, 12876, 311, 1440, 279, 8206, 430, 15812, 4920, 279, 7479, 62716, 198, 1073, 279, 38207, 323, 311, 6056, 420, 8206, 539, 1193, 2949, 719, 2085, 11, 304, 1475, 198, 9164, 499, 3449, 439, 1664, 439, 304, 6261, 13, 9843, 420, 5647, 315, 10973, 22526, 198, 1073, 2574, 323, 1274, 12302, 311, 1304, 5196, 3967, 311, 499, 11, 1243, 499, 690, 198, 62343, 264, 9546, 304, 1855, 9998, 323, 1206, 347, 11, 304, 1855, 5021, 323, 6136, 11, 304, 1855, 198, 48999, 323, 1732, 499, 3449, 11, 16447, 304, 264, 9527, 81498, 555, 1202, 1376, 311, 387, 198, 19643, 11, 719, 264, 9546, 10748, 323, 4382, 315, 279, 8769, 10323, 11, 902, 706, 523, 437, 306, 383, 9427, 16339, 1037, 369, 1202, 1866, 10096, 323, 374, 539, 9615, 16447, 3201, 505, 198, 64589, 2136, 315, 1202, 1972, 659, 719, 1524, 1457, 374, 11469, 433, 439, 584, 15998, 520, 198, 1820, 59355, 430, 62849, 603, 505, 1057, 28948, 627, 12805, 499, 5647, 279, 9546, 315, 279, 43361, 304, 682, 2574, 11, 499, 527, 3025, 311, 198, 1138, 535, 520, 264, 5647, 315, 22526, 430, 3727, 499, 304, 1063, 6367, 323, 1558, 25947, 481, 198, 74525, 315, 701, 1694, 68622, 555, 12845, 477, 18506, 11, 17069, 477, 6784, 345, 3571, 477, 66221, 13, 816, 6033, 3719, 779, 7537, 389, 3815, 279, 990, 315, 279, 8769, 198, 12363, 430, 499, 15673, 4661, 31155, 279, 5829, 315, 279, 37374, 323, 779, 11322, 264, 198, 15674, 315, 659, 33028, 304, 701, 11341, 311, 279, 1917, 13, 52137, 374, 264, 4832, 198, 92109, 292, 2361, 719, 374, 12266, 311, 279, 37374, 11, 902, 26737, 16058, 311, 387, 198, 58234, 1109, 682, 279, 8866, 437, 2212, 433, 11, 323, 422, 433, 374, 539, 2731, 433, 374, 22954, 433, 374, 198, 86, 11073, 323, 779, 3060, 9221, 36574, 5352, 323, 18507, 477, 28593, 323, 63757, 198, 438, 8617, 5825, 279, 12047, 315, 682, 50217, 23963, 369, 14892, 449, 2324, 11, 3021, 345, 438, 61238, 13, 350, 297, 387, 6273, 374, 311, 387, 653, 2642, 14152, 13, 350, 297, 1440, 430, 1070, 198, 258, 10796, 1220, 682, 3885, 279, 1890, 1694, 430, 26318, 1220, 499, 374, 311, 11322, 264, 50217, 198, 83029, 430, 20682, 499, 311, 2035, 701, 2324, 323, 16388, 323, 38556, 342, 552, 304, 279, 198, 89112, 315, 420, 1694, 2085, 264, 5965, 76, 11, 449, 10973, 44743, 430, 499, 690, 387, 198, 66519, 311, 2804, 430, 990, 430, 499, 2011, 656, 11, 304, 279, 1888, 315, 682, 3284, 198, 2336, 11, 520, 279, 1888, 315, 682, 3284, 3115, 627, 720, 791, 47297, 10441, 468, 477, 509, 27907, 2181, 374, 459, 9749, 2144, 430, 1057, 4330, 38207, 45493, 719, 279, 259, 6729, 478, 13651, 198, 1073, 279, 4661, 24746, 20326, 315, 78352, 430, 8031, 6341, 304, 279, 15861, 345, 9210, 264, 3610, 3115, 810, 8625, 13365, 820, 922, 1855, 3245, 1109, 649, 11000, 198, 1395, 26617, 555, 60717, 3445, 13, 1254, 67043, 649, 387, 1903, 902, 527, 198, 318, 716, 1512, 1260, 311, 279, 3823, 2487, 719, 527, 6847, 6755, 555, 3738, 10099, 13, 578, 198, 47621, 315, 48913, 584, 1440, 439, 3177, 374, 26549, 62215, 439, 311, 279, 2134, 198, 9210, 706, 459, 31469, 282, 440, 389, 279, 3823, 8071, 11, 719, 38330, 584, 1440, 1070, 527, 198, 959, 17583, 304, 1148, 1274, 649, 1518, 2001, 1063, 527, 1933, 94009, 11, 3885, 198, 77, 7596, 65607, 11, 3885, 282, 1590, 65607, 26, 1063, 617, 459, 10255, 529, 274, 11376, 11, 311, 3885, 198, 8407, 8200, 5101, 1174, 439, 311, 14502, 329, 6672, 520, 445, 414, 5919, 13, 763, 2875, 11, 3769, 1705, 14965, 22519, 5694, 389, 25694, 4400, 719, 279, 6029, 315, 872, 38207, 198, 548, 25694, 279, 26610, 13744, 315, 6029, 26, 814, 3604, 22519, 5694, 389, 198, 50828, 85515, 11, 25694, 2574, 439, 13363, 389, 279, 8197, 315, 14392, 264, 17983, 198 ]
0xBreath/holistic-books
in the United States of Ameri ca. With Your Sword of Blue Flame, CUT FREE! (x3) every force that is not of the Light! Encapsulate these energies in Your Cosmic Circle of White Lightning. Lift every electron of this negativity into the arms of Divine Grace and instantly TRANSMUTE it cause, core, effect, record and memory back into Light! Beloved Ones, expand this Divine Service now into every country, nation, city, province, town and hamlet on Earth. With Your Sword of Blue Flame, CUT FREE! (x3) every force that is not of the Ligh t! Encapsulate these energies in Your Cosmic Circle of White Lightning. Lift every electron of this negativity into the arms of Divine Grace and instantly TRANSMUTE it cause, core, effect, record and memory back into the Light! Beloved Legions of Light, in the full Authority of God’s Will on Earth, I COMMAND that in every location where negativity was removed the Patterns of Perfection for Divine Government shall be established NOW and FOREVER! Through the Presence of God I AM, I ASK for a special Cosmic Dispensation. Beloved Father - Mother God and the Legions of Light throughout Infinity, envelop Washington, D.C., the United States of America and every country on Earth in the full embrace of God’s Will and the Sacred Flames of D ivine Love, Enlightenment, Wisdom, Truth, Eternal Peace, Justice, Freedom, Compassion and all of the Infinite Patterns of Perfection associated with Divine Government! I make this invocation, this command and this decree through the Power of God, I AM! And so It is, Beloved I AM! Invocation to the Elohim of God’s First Cause of Perfection Through the Presence of God, I AM, in me and in all of Humanity, I INVOKE the Mighty Elohim and the Legions of Light associated with the Sapphire -Blue Flame of God’s First Cause of Perfection! Blessed One, come forth now and blaze Your Sacred Flame into the cause and core of all human miscreation in Washington, D.C., and then ce, through every government capital in the World! Go forth now with Your Invincible Angelic Legions, and sweep through every government building, every office and every home in the city of Washington, D.C. and every state in the USA. Expand this purifying Activity of Light into every country in the World! Transmute the human desire to use free will destructively, and replace it with the intense desire to serve God and Humanity with Reverence for ALL Life! I ASK that You permanently station Your Angelic L egions in Washington, D.C., and in all Government Centers on Earth to ensure that all rates of vibration that tie any individual to activities of discord or imbalance be quickened to a point where they are set FREE in the Light! Protect every soul from a ccepting negative human suggestions, and help each one to be a receiver of the Forces and Inspirational Activities of God. Assist each one to be a willing participant in the fulfillment of the Divine Plan of establishing Divine Government on Earth: A Gover nment OF the I AM Presence, BY the I AM Presence, FOR the I AM Presence of ALL Humanity! Give added protection to those people who are already manifesting God’s Will through their Divine Plans, and protect them from all interference that would seek to disrupt the establishment of Divine Government on Earth. I consciously accept this done right now, eternally sustained, and all -powerfully active, ever - expanding and world -encompassing until Divine Government is manifest in every country of the World! And so It is, Beloved I AM! The Goddesses of Liberty, Justice, Freedom, Victory, Glory and Oneness In the Name of the Almighty Presence of God, I AM, and through the Creative Fire pulsating in every Heart Flame, I INVOKE the Goddess of Liberty, the Goddess of Justice, the Goddess of Freedom, the Goddess of Victory, the Goddess of Glory and the Goddess of Oneness! I also invoke the Silent Watcher for Washington, D.C., Beloved Columbia, and all of the Mighty Guardians and Cosmic Beings who dwell in the Etheric Complex over Washington, D.C. Blessed Ones come forth now, and assist me with the most powerful cleansing activity Humanity and the Earth are capable of receiving during this Cosmic Moment! As One Unified Heart, we now invoke the 5th -Dimensional Crystalline Solar Violet Flame of God’s Infinite Perfection. Blaze, blaze, blaze this Sacred Violet Fire in, through and around all inharmonious actions, all lower human consciousness and all obstructions of the Light, that I or any part of Life have ever placed on the Pathway of Life’s Perfection! Through the Divine Power of God’s Infinite Perfection, Transmute this discordant energy cause, core, effect, record and memory —NOW and FOREVER! BLAZE and SUSTAIN the Violet Flame of a Thousand Suns and the Cosmic Blue Lightning of Divine Will, Power, Faith and Authority from the very Heart of our Father -Mother God in, through and around: • The President of the United States of America and his Cabinet —now and forever! • The Senate and the House of Representatives for the United States of America —now and forever! • The Supreme Court and ALL Courts of Law, and ALL legal procedures —now and forever! • The United Nations and ALL of its members —now and forever! • Through ALL World leaders and those associated with the Governments of Earth at national, state and lo cal levels—now and forever! I accept this Victoriously accomplished through the power of God, I AM! And so It is! The Decree For The Earth And Her Nations In the Full Power and Authority of the Beloved Presence of God, I AM, we, the Children of Earth, humbly come to the Heart of our Father -Mother God to invoke into the physical plane of Earth the most intensified Activity of God’s Will ever manifested in the history of time! We invoke the Legions of Light serving this blessed Earth to absorb th is Divine Essence into every fiber of their Beings and project it into the Heart Flame and conscious mind of every person associated with the Governments of this Planet in any way, shape or form! Blaze the Cosmic Flame of God’s Will through every one of these people and clear away any destructive activity of their own free will which might rush in to try and impede their conscious desire to do God’s Will! Help them to become and remain obedient to the Law of Harmony and to BE God in action at ALL times. Seal all Governmental positions, individually and collectively, in the radiance of God’s Will! Reveal through Illumination’s Flame, the Divine Purpose and Divine Plan for each office and each individual, and give to each person the Spiritual Courage to fu lfill that Plan perfectly. Let the Will of God be manifest in, through and around ALL of the Governments of the World—NOW and FOREVER! Let the LIGHT OF GOD THAT IS ETERNALLY VICTORIOUS Enlighten and lead ALL Humanity everywhere! We accept this manifest ing NOW, even as we call! And so It is, Beloved I AM! For I Demand… BY THE MIGHTIEST…! (x3) THANK YOU! (x3) ALMIGHTY I AM! (x3) I AM America Decrees BELOVED MIGHTY I AM PRESENCE AND GREAT HOST OF ASCENDED MASTERS! Come forth in all outer activities! Seize possession and control of America, the government, Her people, and Her resources! Hold them forever in the Heart of Thy Perfection, and bless all with Thy Happiness and Transcendent Light! To You, our Beloved United States of America and the Americas, we say: “America, we love You! America, we love You! America, we love You with a Love that is Infinite, Eternal, and Almighty! Our Love shall guard You with Invincible Power forever, forever, and forever, against everything that is less than the Ascended Masters’ Perfection! ‘The Light of God That Never Fails’ shall rule forever within the Americas; and so long as the Stars remain and the Heavens send do wn dew, so long shall the Americas remain the Land of Light and Love, Freedom, and Justice! We have commanded by the Power of the Unfed Flame, the ‘Three times Three,’ and the Cosmic Light; so shall it be established to the people of the Americas forever!” I DEMAND, I COMMAND, AND I AM AN OPEN DOOR through which the Beloved Mighty I AM Presence, the Great Host of Ascended Masters, the Great Cosmic Beings, and the Great Angelic Host, can flood our Beloved Land of America with all the Divine Justice which en ables the Cup of the World to overflow with the Blessings of Life; and dissolve from the Planet all that has so long denied, defied, and disobeyed the Law of the Perfection of God, the Beloved Mighty I AM Presence, and the Ascended Host! America, we love You! America, we bless You! America, You are the “Cup of Light”
[ 304, 279, 3723, 4273, 315, 720, 32, 1195, 72, 2211, 13, 3161, 4718, 36751, 315, 8868, 49957, 11, 73957, 16655, 0, 220, 320, 87, 18, 8, 1475, 5457, 430, 374, 539, 315, 279, 720, 14235, 758, 49526, 7560, 2690, 6468, 1521, 49969, 304, 4718, 95789, 21918, 315, 5929, 34944, 13, 53535, 1475, 17130, 315, 720, 576, 93795, 1139, 279, 11977, 315, 43361, 32171, 323, 22571, 41447, 9691, 11701, 220, 433, 5353, 11, 6332, 11, 2515, 11, 720, 8716, 323, 5044, 1203, 1139, 8828, 758, 1084, 2355, 22404, 5047, 74933, 11, 9407, 420, 43361, 5475, 1457, 1139, 1475, 3224, 11, 7140, 11, 3363, 11, 17271, 11, 6424, 720, 438, 13824, 1169, 389, 9420, 13, 3161, 4718, 36751, 315, 8868, 49957, 11, 73957, 16655, 0, 220, 320, 87, 18, 8, 1475, 5457, 430, 374, 539, 720, 1073, 279, 445, 1108, 259, 0, 49526, 7560, 2690, 6468, 1521, 49969, 304, 4718, 95789, 21918, 315, 5929, 34944, 13, 53535, 1475, 17130, 315, 720, 576, 93795, 1139, 279, 11977, 315, 43361, 32171, 323, 22571, 41447, 9691, 11701, 220, 433, 5353, 11, 6332, 11, 2515, 11, 720, 8716, 323, 5044, 1203, 1139, 279, 8828, 758, 1084, 2355, 22404, 5047, 7765, 919, 315, 8828, 11, 304, 279, 2539, 22677, 315, 4359, 753, 4946, 389, 9420, 11, 358, 41318, 430, 304, 720, 30115, 3813, 1405, 93795, 574, 7108, 279, 63823, 315, 3700, 13421, 369, 43361, 10423, 720, 19549, 387, 9749, 23214, 323, 45023, 3848, 758, 49526, 24798, 279, 79723, 315, 4359, 358, 6912, 11, 220, 358, 5871, 42, 220, 369, 264, 3361, 95789, 70830, 42725, 13, 7984, 5047, 20941, 18722, 59978, 4359, 323, 279, 7765, 919, 315, 8828, 6957, 40989, 11, 54285, 6652, 11, 423, 732, 2637, 279, 720, 23175, 4273, 315, 5270, 323, 1475, 3224, 389, 9420, 304, 279, 2539, 27830, 315, 4359, 753, 4946, 323, 279, 720, 94528, 1171, 73297, 315, 423, 17967, 483, 10919, 11, 92931, 11, 57201, 11, 30198, 11, 67872, 26888, 11, 12007, 11, 720, 86872, 11, 60680, 290, 323, 682, 315, 279, 55643, 63823, 315, 3700, 13421, 5938, 449, 43361, 720, 62569, 758, 49526, 40, 1304, 420, 29796, 11, 420, 3290, 323, 420, 61634, 1555, 279, 7572, 315, 4359, 11, 358, 6912, 758, 1628, 779, 720, 2181, 374, 11, 7984, 5047, 358, 6912, 758, 720, 220, 79593, 311, 279, 100169, 40617, 315, 4359, 753, 5629, 45446, 315, 3700, 13421, 2355, 24798, 279, 79723, 315, 4359, 11, 358, 6912, 11, 304, 757, 323, 304, 682, 315, 83695, 11, 358, 2006, 59280, 220, 279, 75268, 720, 36, 385, 40617, 323, 279, 7765, 919, 315, 8828, 5938, 449, 279, 83099, 482, 10544, 49957, 315, 4359, 753, 5629, 45446, 720, 1073, 3700, 13421, 758, 49526, 33, 1752, 291, 3861, 11, 2586, 13544, 1457, 323, 63573, 4718, 61118, 49957, 1139, 279, 5353, 323, 6332, 315, 682, 720, 26380, 5906, 38475, 304, 6652, 11, 423, 732, 2637, 323, 1243, 3846, 11, 1555, 1475, 3109, 6864, 304, 279, 720, 10343, 758, 6122, 13544, 1457, 449, 4718, 19337, 77972, 23950, 292, 7765, 919, 11, 323, 24021, 1555, 1475, 720, 87863, 4857, 11, 1475, 5274, 323, 1475, 2162, 304, 279, 3363, 315, 6652, 11, 423, 732, 13, 323, 1475, 720, 2513, 304, 279, 7427, 13, 51241, 420, 4087, 7922, 220, 15330, 315, 8828, 1139, 1475, 3224, 304, 279, 4435, 758, 720, 3246, 53314, 279, 3823, 12876, 311, 1005, 1949, 690, 21443, 3210, 11, 323, 8454, 433, 449, 279, 19428, 12876, 720, 998, 8854, 4359, 323, 83695, 449, 83279, 768, 369, 13398, 9601, 758, 49526, 40, 5871, 42, 220, 430, 1472, 31859, 8216, 4718, 23950, 292, 445, 8866, 919, 304, 6652, 11, 423, 732, 2637, 323, 304, 682, 720, 62569, 41991, 389, 9420, 311, 6106, 430, 682, 7969, 315, 48913, 430, 18623, 904, 3927, 311, 720, 33078, 315, 32141, 477, 68331, 387, 4062, 6901, 311, 264, 1486, 1405, 814, 527, 743, 16655, 304, 279, 8828, 758, 49526, 62647, 1475, 13836, 505, 264, 272, 1512, 287, 8389, 3823, 18726, 11, 323, 1520, 1855, 832, 311, 387, 264, 720, 38653, 315, 279, 30500, 323, 89957, 1697, 44382, 315, 4359, 13, 54349, 1855, 832, 311, 387, 264, 10032, 720, 59613, 304, 279, 57383, 315, 279, 43361, 9878, 315, 31692, 43361, 10423, 389, 9420, 25, 362, 720, 38, 2017, 308, 479, 3083, 279, 358, 6912, 79723, 11, 7866, 279, 358, 6912, 79723, 11, 4716, 279, 358, 6912, 79723, 315, 13398, 720, 35075, 488, 758, 49526, 36227, 3779, 9313, 311, 1884, 1274, 889, 527, 2736, 14794, 287, 4359, 753, 4946, 1555, 872, 720, 12792, 483, 35695, 11, 323, 6144, 1124, 505, 682, 32317, 430, 1053, 6056, 311, 24927, 279, 720, 34500, 479, 315, 43361, 10423, 389, 9420, 13, 31879, 40, 70903, 4287, 420, 2884, 1314, 1457, 11, 1880, 944, 750, 29759, 11, 323, 682, 482, 13477, 3725, 4642, 11, 3596, 18722, 4683, 26673, 323, 1917, 482, 268, 31929, 287, 3156, 43361, 10423, 374, 14794, 304, 1475, 3224, 315, 720, 1820, 4435, 758, 1628, 779, 1102, 374, 11, 7984, 5047, 358, 6912, 758, 33006, 791, 61785, 288, 315, 32492, 11, 12007, 11, 25320, 11, 2355, 37225, 683, 11, 59261, 323, 1952, 24639, 2355, 644, 279, 4076, 315, 279, 92414, 79723, 315, 4359, 11, 358, 6912, 11, 323, 1555, 279, 25248, 6785, 56037, 1113, 304, 720, 30115, 18449, 49957, 11, 358, 2006, 59280, 220, 279, 61785, 315, 32492, 11, 279, 61785, 220, 315, 12007, 11, 279, 61785, 315, 720, 86872, 11, 279, 61785, 315, 49427, 11, 279, 61785, 315, 59261, 323, 279, 61785, 315, 1952, 24639, 758, 358, 1101, 720, 23238, 279, 60555, 10573, 261, 369, 6652, 11, 423, 732, 2637, 7984, 5047, 19326, 11, 323, 682, 315, 279, 75268, 720, 21471, 5493, 323, 95789, 2893, 826, 889, 44935, 304, 279, 35978, 292, 22872, 927, 6652, 11, 423, 732, 13, 31879, 33, 1752, 291, 74933, 2586, 13544, 1457, 11, 323, 7945, 757, 449, 279, 1455, 8147, 60052, 5820, 720, 35075, 488, 323, 279, 9420, 527, 13171, 315, 12588, 2391, 420, 95789, 40096, 758, 1666, 3861, 73534, 720, 46484, 11, 584, 1457, 20466, 279, 220, 20, 339, 482, 27213, 278, 4656, 599, 543, 483, 25450, 74574, 49957, 315, 4359, 753, 55643, 720, 3976, 13421, 13, 220, 84527, 11, 63573, 11, 63573, 420, 61118, 74574, 6785, 304, 11, 1555, 323, 2212, 682, 304, 13279, 1677, 1245, 6299, 11, 682, 4827, 3823, 25917, 323, 682, 1536, 20232, 315, 279, 8828, 11, 430, 358, 477, 904, 961, 315, 720, 26833, 617, 3596, 9277, 389, 279, 8092, 3195, 315, 9601, 753, 3700, 13421, 758, 31879, 24798, 279, 43361, 7572, 315, 4359, 753, 55643, 3700, 13421, 11, 4149, 53314, 420, 32141, 519, 4907, 720, 1593, 11, 6332, 11, 2515, 11, 3335, 323, 5044, 2001, 45029, 323, 45023, 3848, 758, 33006, 9574, 91960, 323, 328, 8721, 6979, 279, 74574, 49957, 315, 264, 75453, 74068, 323, 279, 95789, 8868, 34944, 315, 720, 12792, 483, 4946, 11, 7572, 11, 34053, 323, 22677, 505, 279, 1633, 18449, 315, 1057, 20941, 482, 59978, 4359, 304, 11, 720, 20322, 323, 2212, 25, 5351, 6494, 6806, 578, 4900, 315, 279, 3723, 4273, 315, 5270, 323, 813, 34046, 2001, 3409, 323, 16058, 758, 5351, 16554, 6806, 578, 10092, 323, 279, 4783, 315, 40845, 369, 279, 3723, 4273, 315, 5270, 2001, 3409, 323, 720, 1348, 424, 758, 2355, 6806, 578, 13814, 7301, 323, 13398, 66563, 315, 7658, 11, 323, 13398, 5897, 16346, 2001, 3409, 323, 720, 1348, 424, 758, 2355, 6806, 578, 3723, 19687, 323, 13398, 315, 1202, 3697, 2001, 3409, 323, 16058, 758, 2355, 6806, 17331, 13398, 4435, 6164, 323, 1884, 5938, 449, 279, 88799, 315, 9420, 520, 720, 42240, 11, 1614, 323, 781, 1652, 5990, 2345, 3409, 323, 16058, 758, 720, 5996, 40, 4287, 420, 33412, 13610, 27332, 1555, 279, 2410, 315, 4359, 11, 358, 6912, 758, 1628, 779, 1102, 374, 0, 33006, 791, 3799, 770, 1789, 578, 9420, 1628, 6385, 19687, 2355, 644, 279, 8797, 7572, 323, 22677, 315, 279, 7984, 5047, 79723, 315, 4359, 11, 358, 6912, 11, 584, 11, 279, 15394, 315, 720, 44924, 11, 2854, 65, 398, 2586, 311, 279, 18449, 315, 1057, 20941, 482, 59978, 4359, 311, 20466, 1139, 279, 7106, 11277, 315, 720, 44924, 279, 1455, 79849, 15330, 315, 4359, 753, 4946, 3596, 79754, 304, 279, 3925, 315, 892, 758, 49526, 1687, 20466, 279, 7765, 919, 315, 8828, 13788, 420, 33944, 9420, 311, 35406, 270, 374, 43361, 84870, 1139, 720, 30115, 24722, 315, 872, 2893, 826, 323, 2447, 433, 1139, 279, 18449, 49957, 323, 17371, 4059, 315, 1475, 720, 9164, 5938, 449, 279, 88799, 315, 420, 29935, 304, 904, 1648, 11, 6211, 477, 1376, 758, 49526, 5028, 10033, 279, 95789, 49957, 315, 4359, 753, 4946, 1555, 1475, 832, 315, 1521, 1274, 323, 2867, 3201, 904, 720, 61368, 535, 5820, 315, 872, 1866, 1949, 690, 902, 2643, 13270, 304, 311, 1456, 323, 3242, 15686, 872, 17371, 720, 5919, 556, 311, 656, 4359, 753, 4946, 758, 11736, 1124, 311, 3719, 323, 7293, 96756, 311, 279, 7658, 315, 66480, 323, 720, 998, 7354, 4359, 304, 1957, 520, 13398, 3115, 13, 31879, 1542, 278, 682, 10423, 278, 10093, 11, 32399, 323, 45925, 11, 304, 279, 12164, 685, 315, 4359, 753, 4946, 758, 720, 697, 41711, 1555, 61720, 2617, 753, 49957, 11, 279, 43361, 30145, 323, 43361, 9878, 369, 1855, 5274, 323, 720, 9739, 3927, 11, 323, 3041, 311, 1855, 1732, 279, 63849, 99630, 311, 18922, 326, 7712, 430, 9878, 14268, 13, 31879, 10267, 279, 4946, 315, 4359, 387, 14794, 304, 11, 1555, 323, 2212, 13398, 315, 279, 88799, 315, 279, 720, 10343, 2345, 45029, 323, 45023, 3848, 0, 6914, 279, 53303, 3083, 59478, 26336, 3507, 469, 11114, 29555, 720, 53, 15149, 878, 43752, 75150, 268, 323, 3063, 13398, 83695, 17277, 0, 31879, 1687, 4287, 420, 14794, 6892, 23214, 11, 1524, 439, 584, 1650, 758, 1628, 779, 1102, 374, 11, 7984, 5047, 358, 6912, 758, 33006, 2520, 358, 55353, 1981, 220, 7866, 3247, 386, 4735, 40, 5288, 1981, 0, 320, 87, 18, 8, 81957, 15334, 0, 320, 87, 18, 8, 8927, 44, 4735, 56, 358, 6912, 0, 320, 87, 18, 8, 220, 358, 6912, 5270, 3799, 8016, 2355, 33006, 720, 11855, 1623, 22449, 386, 4735, 56, 358, 6912, 21626, 45856, 2152, 3651, 62093, 45678, 3083, 20382, 45262, 386, 6483, 4419, 0, 2355, 29951, 13544, 304, 682, 16335, 7640, 0, 1369, 553, 19243, 323, 2585, 315, 5270, 11, 279, 3109, 11, 720, 21364, 1274, 11, 323, 6385, 5070, 0, 23588, 1124, 16058, 304, 279, 18449, 315, 67675, 3700, 13421, 11, 323, 16458, 682, 720, 4291, 67675, 79244, 323, 4149, 66, 29293, 8828, 0, 2355, 720, 1271, 1472, 11, 1057, 7984, 5047, 3723, 4273, 315, 5270, 323, 279, 52248, 11, 584, 2019, 25, 1054, 32132, 11, 584, 3021, 720, 2675, 0, 5270, 11, 584, 3021, 1472, 0, 5270, 11, 584, 3021, 1472, 449, 264, 10919, 430, 374, 55643, 11, 67872, 11, 323, 720, 2149, 68405, 0, 5751, 10919, 4985, 7771, 1472, 220, 449, 19337, 77972, 7572, 16058, 11, 16058, 11, 323, 16058, 11, 720, 69849, 4395, 430, 374, 2753, 1109, 279, 40660, 2954, 34722, 529, 3700, 13421, 0, 3451, 791, 8828, 315, 4359, 3011, 720, 27247, 435, 6341, 529, 4985, 6037, 16058, 2949, 279, 52248, 26, 323, 779, 1317, 439, 279, 25676, 7293, 323, 279, 720, 1548, 402, 729, 3708, 656, 66580, 67532, 11, 779, 1317, 4985, 279, 52248, 7293, 279, 11680, 315, 8828, 323, 10919, 11, 720, 86872, 11, 323, 12007, 0, 1226, 617, 54757, 555, 279, 7572, 315, 279, 1252, 52223, 49957, 11, 279, 3451, 20215, 3115, 720, 20215, 23189, 323, 279, 95789, 8828, 26, 779, 4985, 433, 387, 9749, 311, 279, 1274, 315, 279, 52248, 16058, 18319, 2355, 720, 40, 51914, 4064, 11, 358, 41318, 11, 3651, 358, 6912, 2147, 30941, 9503, 878, 1555, 902, 279, 7984, 5047, 75268, 720, 40, 6912, 79723, 11, 279, 8681, 16492, 315, 40660, 2954, 34722, 11, 279, 8681, 95789, 2893, 826, 11, 323, 279, 8681, 720, 10976, 43723, 16492, 11, 649, 18197, 1057, 7984, 5047, 11680, 315, 5270, 449, 682, 279, 43361, 12007, 902, 665, 671, 645, 720, 1820, 11098, 315, 279, 4435, 311, 16891, 449, 279, 44361, 826, 315, 9601, 26, 323, 73739, 505, 279, 29935, 682, 2355, 9210, 706, 779, 1317, 15164, 11, 711, 1142, 11, 323, 68735, 49059, 279, 7658, 315, 279, 3700, 13421, 315, 4359, 11, 279, 7984, 5047, 720, 44, 492, 88, 358, 6912, 79723, 11, 220, 323, 279, 40660, 2954, 16492, 0, 2355, 720, 32132, 11, 584, 3021, 1472, 0, 5270, 11, 584, 16458, 1472, 0, 5270, 11, 1472, 527, 279, 1054, 34, 455, 315, 8828, 863 ]
0xBreath/holistic-books
ject the statements after due deliberation. Thus we feel this volume should not be considered a dangerous book for the layman but a thought provoking treatise. The Publisher. PREFACE For the past 2000 years physicians have been looking in the wrong direction for the cure of disease. Their worse than useless practice of killing germs with poison drugs has never—and can never—solve the problem of disease. During the Dark Ages, before the introduction of improved nutrition and sanitation, the world was intermittently visited with epidemics of smallpox. The cause was stubbornly ignored and the seeds for more disease were sown when vaccination was brought into popular use. This infusion of poison injected into the bloodstream of the masses only served to intensify the disease in some cases, suppress the symptoms in others and create new and more serious diseases in still others. So, with the passing of years we have seen this misbegotten child of ignorance grow into a Frankenstein monster of immense proportions that moves relentlessly forward, grinding under foot the multitudes that throng its path. Through the lethal power of this poisoned needle, the simple zymotic (contagious) diseases of the past have been devolved into the horrors of the present—our terrifying and expanding crop of "killer diseases". Many of these strange "mystery diseases" that baffle the entire medical world, are the sordid products of vaccine poisons that disturb the chemical balance of the body and interfere with normal functioning. All these medically-made atrocities are far worse than smallpox or any of the other eruptive diseases that nature provides as a means of expelling the accumulated poison waste from the abused body. This interference with the balanced economy of nature has multiplied the problems beyond the power of science to control. Our worst epidemics now are epidemics of vaccination in which more people are killed every year by "vaccinal diseases" than by the diseases that the vaccinations were supposed to combat. Complete freedom from disease can scarcely be found except in remote islands or isolated communities that have not been invaded by medical mischief and commercialized products. Is our proud civilization to be degraded, corrupted, and destroyed by its own inventions designed for selfish profit and exploitation of the race? Vaccination, instead of being the promised blessing to the world, has proved to be a curse of such sweeping devastation that it has caused more death and disease than war, pestilence, and plague combined. There is no scourge (with the possible exception of atomic radiation) that is more destructive to our nation’s health than this monument of human deception—this slayer of the innocent— this crippler of body and brain—THE POISONED NEEDLE. Eleanor McBean, PhD, ND CHAPTER 1 THE POISONED NEEDLE "Truth wears no mask, seeks neither place nor applause, bows to no human shrine; she only asks a hearing." The increasing flood of evidence against vaccination and the growing for the unsuppressed facts about this "touchy" subject have literally forced this book into being. As this work has progressed and the extensive research has been carried to trace down and organize the material for this manuscript, other valuable long concealed records, that I had not expected, have come into my hands as if by some unseen power. It is to be hoped that the information contained within these pages will help to sweep away the tragic errors that cloud the minds of the people as well as the physicians. It is urgent that the living words of TRUTH or some other force be applied to abolish that deadly weapon, THE POISONED NEEDLE, which has been the menacing road block standing m the way of progress in the healing field for these many years. Vaccination and the false germ theory upon which it is hinged has led mankind far astray and has severed the fragile thread that offered medical theory and practice a hope of becoming a science. Under the sway of our present degenerative medical methods the health of our people has declined to the lowest point in history. The 1955 survey showed that over 90% of our population is below par mentally or physically. According to life insurance records, army reports, hospital statements, government statistics and physical examinations for marriage certificates and employment, etc., it is revealed that there is hardly one normal, healthy person in a hundred. The Cancer Foundation states that one out of every four is marked for cancer. The figures on heart trouble are even worse than that and the other "killer diseases" come in for their toll. Practically all the rest of the people have symptoms of less serious diseases; these symptoms being headaches. constipation, weak eves, dental caries, colds, pain, stomach trouble, etc. Most, if not all, diseases are avoidable and curable (at a certain stage) but not under the deceptive medical method of poisoning the well and the sick with vaccines and drugs and mutilating them with unnecessary operations. When socialized medicine was threatening, a meeting of medical officials was called to discuss just how many and which operations would really be necessary if there was no profit in it . It was decided that only 3% would be considered essential under those conditions. This information came from a medical student whose instructor had attended the meeting. WHERE HAVE THE "GREAT STRIDES OF MEDICAL SCIENCE" TAKEN US? After a glance at the medical records covering the past 70 years of what boastfully called "our great strides of medical science" we can hardly help wondering if those seven league strides haven’t been in reverse, because there a marked decline in our nation’s health and a shocking increase in the killer diseases during those very years. The acute diseases that were to have been conquered by vaccination have only been masked and "save face" or suppressed until the retained poisons corroded the internal organs and developed into dangerous chronic diseases. The following table gives us an idea of what our present faulty methods are doing to our race: INCREASE IN KILLER DISEASES DURING THE PAST 70 YEARS (1887-1957) -Insanity increased 400% -Cancer increased 308% -Anemia increased 300% -Epilepsy increased 397% -Bright’s Disease increased 65
[ 585, 33188, 79185, 3808, 197, 10924, 2765, 361, 70609, 8799, 367, 627, 1602, 45600, 197, 906, 1186, 96551, 2090, 5306, 4765, 197, 5562, 98366, 74242, 197, 25742, 291, 11575, 2765, 4091, 788, 197, 2239, 2066, 33188, 18108, 6789, 1543, 2282, 332, 11575, 197, 61665, 197, 44047, 10979, 3324, 1244, 1082, 627, 1602, 791, 10230, 15536, 627, 1602, 47, 6124, 5693, 18108, 2520, 33188, 3303, 561, 197, 1049, 15, 197, 42820, 197, 42305, 9818, 9793, 525, 74242, 268, 197, 20986, 17886, 33188, 6831, 14684, 83572, 2066, 18108, 1820, 1470, 554, 44323, 2765, 56407, 13, 33026, 404, 6831, 11073, 197, 54895, 42919, 1752, 26736, 34101, 44323, 16868, 9585, 197, 1414, 1026, 48048, 18108, 5481, 3416, 2765, 81, 13602, 64355, 197, 37593, 17223, 94036, 197, 37593, 2345, 60519, 33188, 197, 35686, 44323, 2765, 56407, 627, 1602, 16397, 33188, 11198, 847, 23845, 4282, 11, 64334, 33188, 2129, 17158, 44323, 55992, 96608, 9215, 332, 17462, 53577, 18108, 34182, 7709, 11, 33188, 77608, 6831, 300, 2129, 4289, 1468, 4501, 197, 29968, 48048, 97726, 307, 38305, 44323, 1942, 30632, 79, 5241, 13, 33026, 198, 197, 1593, 6831, 300, 18895, 392, 16381, 398, 197, 59571, 53577, 33188, 85786, 6910, 2066, 2157, 461, 2765, 56407, 6831, 486, 1942, 785, 61280, 18108, 85, 4575, 2617, 6831, 300, 2282, 6478, 2129, 78, 75913, 1299, 42919, 13, 41065, 197, 13885, 7713, 44323, 3303, 78, 3416, 17886, 29403, 2129, 78, 18108, 1820, 2282, 4659, 4116, 44323, 33188, 2157, 52090, 197, 3323, 1942, 2841, 32809, 2129, 729, 1463, 33188, 2765, 56407, 17886, 1942, 638, 1470, 2315, 345, 1602, 98060, 33188, 1942, 1631, 52273, 17886, 23021, 3058, 53577, 40363, 8808, 53577, 2157, 461, 197, 94427, 2765, 1082, 2315, 17886, 18108, 44466, 23021, 3058, 13, 78012, 11, 48048, 33188, 42531, 287, 44323, 197, 42820, 197, 906, 9793, 525, 197, 29412, 2090, 2157, 285, 52253, 10503, 59491, 44323, 18108, 625, 269, 685, 3253, 654, 2129, 78, 11575, 13017, 13430, 62756, 197, 51619, 44323, 197, 12828, 1137, 197, 782, 403, 919, 64442, 2157, 10296, 18108, 3833, 306, 16117, 2066, 1637, 11, 91159, 4049, 197, 8154, 197, 5447, 33188, 2157, 495, 21237, 64442, 71579, 14684, 197, 1220, 27879, 627, 1602, 24798, 33188, 197, 273, 31392, 3303, 1223, 44323, 2090, 3303, 78, 3416, 291, 197, 60619, 11, 33188, 1942, 6592, 197, 21436, 14546, 18108, 38946, 351, 1245, 8, 2765, 1082, 2315, 44323, 33188, 3303, 561, 9793, 525, 74242, 268, 28402, 8905, 2129, 78, 33188, 9793, 17847, 1105, 44323, 33188, 18108, 29844, 2345, 414, 197, 69769, 7922, 53577, 49658, 26673, 1470, 897, 44323, 197, 1, 73178, 2765, 1082, 2315, 3343, 197, 8607, 44323, 197, 45010, 18108, 496, 853, 197, 1, 76, 96357, 2765, 1082, 2315, 1, 64442, 2282, 45190, 33188, 78755, 556, 197, 69216, 77608, 11, 197, 548, 33188, 1942, 541, 307, 18108, 10354, 44323, 5306, 89121, 3303, 78, 19941, 64442, 75582, 9225, 33188, 197, 32056, 2282, 5085, 44323, 33188, 36502, 53577, 18108, 2295, 69, 486, 48048, 197, 8416, 7679, 287, 627, 1602, 2460, 197, 45010, 197, 2106, 2740, 27975, 36547, 28787, 1385, 197, 548, 1186, 277, 6831, 11073, 197, 54895, 1942, 30632, 79, 5241, 82266, 197, 3852, 44323, 33188, 18108, 1605, 197, 261, 7717, 535, 2765, 1082, 2315, 64442, 9215, 1598, 197, 782, 68254, 61551, 11575, 50394, 598, 44323, 49658, 6427, 33188, 18108, 40031, 7913, 3303, 78, 3416, 6831, 5642, 43827, 33188, 197, 370, 2656, 36502, 13, 41065, 60015, 2251, 48048, 33188, 18108, 59502, 7883, 71171, 44323, 9215, 1598, 64355, 2157, 7213, 3523, 33188, 197, 96440, 2282, 23478, 33188, 3303, 1223, 44323, 18108, 40657, 32809, 83886, 627, 1602, 8140, 6831, 66396, 97726, 307, 38305, 82022, 197, 548, 97726, 307, 38305, 44323, 5306, 4575, 2617, 17886, 197, 8370, 2157, 461, 197, 16455, 197, 548, 18108, 74, 4473, 7883, 1225, 197, 3236, 197, 1729, 197, 1, 85, 4575, 992, 2765, 1082, 2315, 1, 197, 54895, 197, 1729, 33188, 2765, 1082, 2315, 64442, 33188, 18108, 85, 4575, 12922, 6831, 486, 1942, 455, 3950, 32809, 33910, 14034, 627, 1602, 12833, 1186, 265, 8944, 43827, 2765, 56407, 94036, 1942, 7063, 66, 989, 74242, 59202, 35699, 17886, 197, 18643, 20501, 8329, 18108, 269, 20501, 81619, 197, 3705, 6165, 64442, 9793, 525, 98366, 74242, 268, 197, 14386, 14589, 197, 1729, 197, 69216, 2157, 16438, 4843, 53577, 18108, 84707, 1534, 197, 10354, 13, 197, 3957, 197, 414, 3303, 43376, 1470, 6362, 2065, 32809, 74242, 59451, 24228, 11, 1470, 269, 87054, 345, 1602, 438, 197, 15886, 291, 197, 1729, 197, 1220, 197, 785, 17886, 31759, 54012, 1571, 2066, 5311, 819, 197, 26466, 53577, 49658, 385, 7709, 18108, 1073, 33188, 7145, 580, 5380, 1602, 53, 4575, 2617, 11, 197, 65937, 44323, 197, 35214, 33188, 3303, 442, 4147, 2282, 1752, 287, 32809, 33188, 77608, 11, 64355, 197, 96608, 32809, 18108, 1395, 11575, 1470, 30385, 44323, 1942, 1412, 1942, 49642, 287, 28402, 561, 367, 64442, 24263, 64355, 197, 936, 2656, 2157, 461, 59451, 589, 53577, 18108, 67, 56407, 197, 54895, 6831, 277, 11, 197, 30223, 321, 768, 11, 53577, 73313, 4768, 197, 67407, 13, 197, 3947, 20501, 73204, 31028, 414, 713, 197, 17411, 33188, 18108, 10236, 197, 7959, 44323, 79839, 7145, 2836, 367, 8, 64442, 20501, 2157, 461, 59451, 1257, 535, 32809, 197, 414, 9215, 367, 753, 18108, 12393, 197, 54895, 2090, 197, 1677, 1143, 44323, 9793, 7282, 59451, 1010, 2345, 576, 1942, 10546, 44323, 33188, 197, 6258, 511, 306, 2345, 198, 576, 197, 745, 79, 13206, 44323, 36502, 53577, 197, 54160, 2345, 17673, 197, 2089, 53076, 1507, 197, 4031, 1507, 877, 627, 1602, 36, 77780, 9391, 66, 10654, 11, 197, 3438, 35, 11, 197, 8225, 197, 88539, 197, 16, 198, 17673, 197, 2089, 53076, 1507, 197, 4031, 1507, 877, 198, 1, 25025, 6831, 7596, 73204, 76012, 11, 85786, 21854, 197, 818, 2544, 197, 2050, 9215, 269, 70998, 501, 3538, 11, 2282, 4336, 32809, 73204, 9793, 7282, 18108, 939, 40101, 26, 1942, 383, 197, 3323, 197, 4707, 11575, 197, 383, 3329, 10246, 1602, 791, 17886, 76562, 1186, 4659, 44323, 7883, 28580, 197, 69849, 5306, 4575, 2617, 53577, 33188, 3253, 25156, 2066, 33188, 18108, 11099, 455, 14655, 1186, 11613, 197, 9274, 2090, 197, 1, 22794, 88, 1, 29724, 585, 9793, 525, 8986, 2058, 750, 2066, 2041, 2090, 197, 2239, 18108, 18614, 197, 35214, 627, 1602, 2170, 2090, 98138, 64355, 90071, 291, 53577, 33188, 96550, 4114, 17643, 1874, 64355, 74242, 268, 1470, 277, 4588, 32809, 66158, 18108, 2996, 53577, 197, 8629, 553, 33188, 2157, 2229, 2066, 2090, 197, 1543, 355, 1250, 11, 197, 1605, 19860, 13429, 17972, 18108, 444, 346, 5962, 197, 27295, 11, 64442, 25494, 9793, 329, 98366, 43500, 11, 9793, 525, 1470, 638, 2129, 78, 13938, 9793, 2914, 61551, 748, 197, 1729, 18108, 15031, 21113, 29412, 3303, 1223, 13, 62635, 20501, 32809, 74242, 9793, 16771, 64442, 33188, 17886, 1659, 197, 53615, 48048, 258, 197, 45010, 18108, 11014, 6831, 484, 88740, 32809, 1942, 49642, 197, 14075, 33188, 26665, 13070, 74524, 64442, 197, 12641, 33188, 2157, 8843, 44323, 33188, 18108, 16455, 61551, 6831, 616, 61551, 33188, 197, 42305, 9818, 13, 62635, 20501, 197, 86153, 64442, 33188, 8986, 2299, 197, 5880, 44323, 96176, 9331, 82266, 18108, 15031, 197, 1605, 2066, 346, 74242, 70998, 3523, 32809, 197, 53904, 819, 64442, 197, 34854, 398, 197, 23722, 11, 10473, 1837, 197, 2089, 53076, 1507, 18108, 4031, 1507, 877, 11, 197, 8370, 64355, 74242, 268, 33188, 2157, 268, 4628, 197, 8714, 49096, 197, 10276, 2157, 33188, 197, 3195, 44323, 18108, 14703, 17886, 33188, 197, 383, 6260, 40350, 2066, 197, 45010, 197, 35676, 197, 42820, 627, 1602, 53, 4575, 2617, 53577, 33188, 37112, 197, 1414, 76, 33188, 683, 197, 59723, 197, 8370, 24263, 20501, 9793, 57658, 64355, 197, 839, 2157, 70370, 18108, 24470, 11575, 496, 352, 53577, 64355, 85786, 424, 291, 33188, 1186, 4193, 458, 69314, 64442, 197, 1885, 12616, 197, 69216, 33188, 683, 53577, 18108, 60621, 11575, 9793, 2862, 44323, 2282, 762, 18238, 11575, 31028, 1873, 13, 16360, 910, 33188, 1942, 3195, 44323, 197, 414, 3303, 2762, 18108, 451, 7642, 1413, 197, 69216, 43357, 82, 33188, 197, 12393, 44323, 197, 414, 197, 16455, 64355, 197, 10210, 1619, 32809, 33188, 8986, 363, 478, 18108, 2837, 17886, 9793, 2644, 13, 33026, 197, 6280, 20, 1942, 39378, 33827, 291, 64442, 197, 2017, 197, 1954, 4, 44323, 197, 414, 75913, 2987, 20501, 18108, 54277, 197, 1768, 197, 479, 750, 82266, 197, 42305, 2740, 13, 197, 11439, 32809, 8986, 1643, 197, 71054, 197, 27295, 11, 197, 2227, 88, 18108, 38006, 11, 9793, 6432, 79185, 3808, 11, 3253, 26112, 197, 55220, 53577, 197, 47692, 8285, 8778, 811, 2066, 18108, 5730, 8950, 1470, 531, 25409, 53577, 197, 21093, 11, 197, 12380, 2637, 24263, 20501, 17643, 588, 5962, 64442, 197, 19041, 20501, 9793, 569, 398, 197, 606, 18108, 8416, 11, 197, 38128, 99905, 17886, 11575, 9793, 7259, 13, 33026, 6391, 11967, 13017, 4159, 18895, 988, 64442, 197, 606, 14294, 18108, 1073, 7883, 1225, 1186, 414, 20501, 2157, 43161, 2066, 1470, 11967, 13, 33026, 197, 99127, 25653, 197, 18207, 26665, 1222, 197, 548, 7883, 1055, 6831, 11073, 18108, 54895, 64442, 53577, 33188, 197, 1605, 197, 1, 73178, 2765, 1082, 2315, 1, 1470, 638, 17886, 2066, 33188, 404, 3324, 980, 13, 197, 3617, 533, 2740, 52060, 33188, 18108, 4014, 44323, 33188, 197, 16455, 9793, 525, 1942, 1631, 52273, 44323, 197, 1752, 197, 94427, 2765, 1082, 2315, 26, 197, 45010, 1942, 1631, 52273, 197, 35214, 18108, 2025, 14576, 13, 4882, 49686, 11, 197, 13451, 7883, 2396, 11, 2765, 6430, 1470, 5548, 11, 1470, 18938, 11, 3303, 467, 11, 18895, 316, 613, 26665, 1222, 345, 1602, 12380, 627, 11367, 13622, 11, 748, 98366, 52060, 11, 2765, 1082, 2315, 197, 548, 197, 48956, 481, 53577, 1470, 18835, 197, 19917, 11575, 1470, 7770, 92675, 8, 2282, 332, 98366, 198, 197, 8154, 33188, 59451, 59374, 197, 69216, 43357, 44323, 3303, 78, 3416, 287, 33188, 6831, 616, 53577, 33188, 1942, 875, 48048, 18108, 85, 4575, 1572, 53577, 2765, 81, 13602, 53577, 2157, 1338, 1113, 197, 49818, 48048, 197, 15278, 20726, 197, 39263, 627, 1602, 4599, 1942, 2772, 1534, 197, 83543, 6831, 300, 71579, 1244, 6147, 11, 11575, 50394, 11880, 44323, 197, 69216, 197, 33912, 82, 6831, 300, 18108, 44982, 32809, 2765, 3510, 1892, 197, 4345, 197, 5269, 197, 35676, 53577, 197, 8370, 197, 39263, 6831, 619, 17643, 750, 74242, 9215, 20726, 18108, 333, 197, 19041, 6831, 300, 73204, 197, 26466, 17886, 24263, 198, 13, 62635, 6831, 300, 197, 8332, 4591, 64442, 197, 3323, 197, 18, 4, 6831, 619, 74242, 197, 25742, 291, 18108, 49582, 197, 8154, 197, 54719, 197, 16902, 13, 41065, 17886, 1659, 1470, 373, 43827, 11575, 197, 69216, 197, 12307, 18108, 86243, 17886, 3162, 9793, 329, 197, 86006, 33188, 50394, 11880, 627, 1602, 27611, 13595, 9682, 10473, 1837, 197, 90299, 31832, 197, 6805, 86914, 197, 12766, 9391, 1507, 15942, 18108, 3624, 57782, 1, 10473, 12173, 965, 197, 2078, 5380, 6153, 11575, 9123, 685, 36547, 33188, 197, 69216, 197, 27295, 197, 93013, 33188, 3303, 561, 197, 2031, 197, 42820, 44323, 197, 12840, 18108, 754, 561, 3725, 1470, 4841, 197, 1, 414, 3253, 1244, 11609, 3422, 44323, 197, 69216, 31028, 1873, 1, 197, 906, 94036, 9793, 569, 398, 88740, 18108, 86, 14518, 287, 748, 197, 54719, 197, 81285, 197, 47831, 11609, 3422, 9793, 5389, 1431, 74242, 268, 17886, 17643, 4550, 11, 2282, 6769, 197, 19041, 11575, 18108, 47462, 197, 10210, 483, 17886, 197, 414, 9215, 367, 753, 197, 12393, 53577, 11575, 37296, 71191, 17886, 20542, 17886, 33188, 197, 73178, 18108, 67, 1082, 2315, 2765, 1711, 197, 54719, 197, 1225, 197, 42820, 13, 33026, 197, 32590, 2765, 1082, 2315, 64442, 6831, 486, 32809, 9793, 525, 74242, 268, 18108, 444, 447, 12616, 197, 1729, 5306, 4575, 2617, 9793, 525, 197, 3323, 74242, 268, 76012, 291, 53577, 197, 1, 6766, 1186, 580, 1, 82266, 1942, 455, 14655, 18108, 39830, 33188, 11512, 2692, 3303, 78, 19941, 1470, 68669, 9988, 33188, 34443, 88725, 598, 53577, 197, 16219, 291, 2129, 78, 18108, 32550, 788, 197, 7562, 292, 2765, 1082, 2315, 627, 1602, 791, 1186, 1573, 287, 27579, 3253, 1924, 71275, 80557, 197, 42877, 44323, 197, 12840, 197, 414, 3303, 2762, 1186, 957, 88, 43357, 82, 197, 548, 18108, 45359, 32809, 197, 414, 7145, 580, 512, 1602, 691, 80691, 41266, 40440, 9410, 643, 11198, 9311, 4157, 50, 11198, 88355, 10473, 1837, 10230, 6483, 197, 2031, 197, 60744, 17485, 18108, 7, 9367, 22, 12, 6280, 22, 340, 1602, 12, 15841, 39370, 17886, 846, 1503, 197, 3443, 14062, 7813, 11967, 17886, 846, 1503, 197, 14498, 14062, 59016, 22689, 17886, 846, 1503, 197, 3101, 14062, 13737, 12470, 46246, 17886, 846, 1503, 197, 20698, 14062, 7826, 1315, 753, 11198, 56407, 17886, 846, 1503, 197, 2397 ]
0xBreath/holistic-books
be caused by the same mechanism. How severe a disease becomes may depend on other psychological, energetic and nutritional factors but its nature and location are determined by the content of the conflict shock. Hamer believes that the correlation between key emotional shock events, the target brain areas and the related organs has developed as an adaptation of our human evolution from similar programs in the animal world. When we unexpectedly experience emotional distress, an emergency repair program is set in motion, a biological conflict program with the aim of returning the individual to normal. Such programs can even apply to families or other groups. Hamer gives the following example. A mother sees her child in a bad accident. In evolutionary terms small children recover faster when they receive extra milk. Theref ore, the biological conflict program tries to stimulate milk production by increasing the number of breast cells. If the mother is right-handed, that will instantly cause the appearance of a Hamer Herd in a specific part of her right brain, which in turn relates to the left breast. When the child is well again, conflict resolution begins and extra milk is no longer needed. The mother gets a benign form of tuberculosis in that breast which breaks up the excess breast cells. However, if the mycobacteria required for this are lacking, then the area may just calcify and remain as a dormant tumor. The same process applies also to animals. A sheep that loses its lamb to a wolf is prone to develop teat cancer; the side depends on whether it is right or left footed. However, commonly the sheep resolves this conflict by bearing another lamb. The following example may illustrate the original survival value of this mechanism. Lets assume a lion chases an antelope. The antelope must immediately mobilize all its resources to survive. The sympathetic nervous system takes over and in addition a specific brain center becomes active that stimulates lung activity. After the successful escape the animal rests and the parasympathetic nervous system becomes dominant for a while to normalize body functions. If instead a human gets a cancer diagnosis, even if the diagnosis is wrong, the same biological program is set in motion by the same fear of death that helped the animal to escape. The stress level jumps and the brain-lung connection is activated but now there is Home About Diseases Healing the Body Healing Foods Healing the Mind Healing the Emotions Energies Science & Spirituality Spirituality Contact10/30/24, 4:56 PM Health-Science-Spirit - The New Medicine of Dr Hamer https://health-science-spirit.com/Diseases/Cancer/The-New-Medicine-of-DrHamer.html 1/6nowhere to run. Until the conflict is resolved, which may take years, there will be constant stress as well as brain-induced stimulation of lung activity, which now takes the form of increasing lung capacity by the incessant division of cells. This process can only be stopped by switching off the trigger in the brain through defusing the original conflict shock. This happens when the patient subsequently has surgery or natural therapy, which he or she fully believes will lead to a cure. However, the same procedure in a patient who has doubts about its effectiveness will leave the conflict unresolved and the disease to progress. Thanks to Dr Hamer ’s work, this is no longe r just an unsubstantiated assumption but rather scientific fact that can be verified anytime with a CT brain scan.        The selection of the conflict focus occurs by subconscious association. For instance biological conflicts involving water but also other fluids, such as milk or oil, lead to kidney cancer, fear of death to lung cancer and psychologically swallowing a bigger chunk then we can digest to stomach or intestinal cancer. Originally, in the animal world, it really was a big chunk of food, but for us it may be a financial over-commitment or any other obligation that we have taken on and cannot fulfill. However, the target focus is not determined by the event itself, but rather by the psychological significance that it has for us at the time of the event. Hamer illustrates this with another example, a woman who finds her husband in bed with another female. As a sexual frustration conflict it causes uterus cancer. If she instead experiences it as a partner conflict, then in a right-handed woman it leads to cancer of the right breast. If the conflict feeling is fear and revulsion then it causes hypoglycemia and with lack of self-worth cancer may develop in the pubic bone. If the lack of self-worth had been due to a failure in sportsmanship rathe r than being sexually related, then the problem would have arisen in an arm or leg instead or possibly in the fingers or shoulder. Other typical situations that may lead to biological conflicts are loss situations, loss of a loved one, of a job, a valued possession or a territory. Dr Hamer believes that most metast ases or secondary tumors are cause d by the cancer-fear or death-fear resulting from the patient given the cancer diagnosis or a negative prognosis. However, also in this case the resulting conflict shock may not be fear of death but rather anger, resentment or a separation conflict from partner or children and then tumors would appear in different places. Also a diagnosis of colon cancer commonly leads to liver cancer because of a subconscious fear of starvation. Generally hopelessness, despair and meaninglessness create chronic stress, which prevent the healing from cancer and other diseases but they are not the cause. According to Hamer the real cause of cancer and other diseases is an unexpected traumatic shock for which we are emotionally unprepared. The following list shows some of the relationships between conflict emotions and target organs. Adrenal cortex - Wrong direction, gone astray Bladder - Ugly conflict, dirty tricks Bone  – Lack of self-worth, inferiority feeling Breast milk gland – Involving care or disharmony Breast milk duct - Separation conflict Breast, left (right-handed) – Conflict concerning child, home, mother Breast, right (right-handed)  – Conflict with partner or others Bronchials – Territorial conflict Cervix  – Severe frustration Colon – Ugly indigestible conflict Esophagus  – Cannot have it or swallow it Gall Bladder  - Rivalry conflict Heart  – Perpetual conflict Intestines - Indigestible chunk of anger Kidneys  – Not wanting to live, water or fluid conflict Larynx - Conflict of fear and fright Liver  – Fear of starvation Lung  – Fear of dying or suf focation, including fear for someone else Lymph glands – Loss of self-worth associated with the location Melanoma – feeling dirty, soiled, defiled10/30/24, 4:56 PM Health-Science-Spirit - The New Medicine of Dr Hamer https://health-science-spirit.com/Diseases/Cancer/The-New-Medicine-of-DrHamer.html 2/6Middle ear – Not being able to get some vital information Mouth - Cannot chew or hold it Pancreas – Anxiety-anger conflict with family members, inheritance Prostate – Ugly conflict with sexual connections or connotations Rectum – Fear of being useless Skin  – Loss of integrity Spleen – Shock of being physically or emotionally wounded Stomach – Indigestible anger, swallowed too much Testes and Ovaries – Loss conflict Thyroid  – Feeling powerless Uterus – Sexual conflict The conflicts for some other diseases are as follows: Diabetes and hypoglycemia: A right-handed female develops hypoglycemia from anxiety and revulsion, if left-handed she develops insulin-dependent diabetes. A right-h anded male develops insulin-diabete s from a conflict of resisting or struggling against something, if left-handed he develops hypoglycemia. Heart infarct: fight for territory or its content. Hemorrhoids: both, a right-handed woman with an identity conflict and also a left-handed man with territorial anger in the healing phase will get hemorrhoids. Multiple sclerosis and Paralysis: inability to escape or continue on or to hold on to or not knowing what to do. Facial paralysis: fear of losing face, having been made a laughing stock. Psoriasis involves separation conflict concerning mother, father, family, home, friends or pets. Psychoses of all kinds have one or more active Hamer Herds in each of the two parts of the brain. Vitiligo, Leukoderma: ugly or brutal separation conflict.   In regard to AIDS Dr Hamer observes that no one ever died of AIDS without having previously been told that they are HIV positive or believe that they are. The implication is that just as with cancer, it is the negative perception associated with AIDS that causes its
[ 387, 9057, 555, 279, 1890, 17383, 13, 2650, 15748, 264, 8624, 198, 17106, 20969, 1253, 6904, 389, 1023, 24064, 11, 45955, 323, 43226, 9547, 719, 1202, 7138, 323, 3813, 527, 11075, 555, 279, 198, 1834, 315, 279, 390, 171, 120912, 858, 10988, 627, 39, 15589, 13919, 430, 279, 26670, 1990, 1401, 14604, 10988, 4455, 11, 279, 2218, 8271, 5789, 323, 279, 5552, 36853, 706, 198, 16219, 291, 439, 459, 34185, 315, 1057, 3823, 15740, 505, 4528, 7620, 304, 279, 10065, 1917, 13, 3277, 584, 51709, 3217, 198, 336, 41964, 35104, 11, 459, 13147, 13023, 2068, 374, 743, 304, 11633, 11, 264, 24156, 390, 171, 120912, 858, 2068, 449, 279, 9395, 315, 13758, 279, 3927, 198, 998, 4725, 13, 15483, 7620, 649, 1524, 3881, 311, 8689, 477, 1023, 5315, 627, 39, 15589, 6835, 279, 2768, 3187, 13, 362, 6691, 16008, 1077, 1716, 304, 264, 3958, 11677, 13, 763, 41993, 3878, 2678, 2911, 11993, 10819, 198, 9493, 814, 5371, 5066, 14403, 13, 2684, 69, 16536, 11, 279, 24156, 390, 171, 120912, 858, 2068, 16696, 311, 51077, 14403, 5788, 555, 7859, 279, 1396, 315, 198, 21152, 561, 7917, 13, 1442, 279, 6691, 374, 1314, 37240, 11, 430, 690, 22571, 5353, 279, 11341, 315, 264, 9777, 261, 6385, 67, 304, 264, 118020, 171, 71831, 66, 961, 315, 1077, 1314, 198, 54160, 11, 902, 304, 2543, 36716, 311, 279, 2163, 17659, 13, 3277, 279, 1716, 374, 1664, 1578, 11, 390, 171, 120912, 858, 11175, 12302, 323, 5066, 14403, 374, 912, 5129, 198, 41917, 13, 578, 6691, 5334, 264, 65309, 220, 1376, 315, 88234, 304, 430, 17659, 902, 18808, 709, 279, 13937, 17659, 7917, 13, 4452, 1174, 422, 279, 198, 2465, 86656, 78852, 2631, 369, 420, 527, 32161, 11, 1243, 279, 3158, 1253, 1120, 10241, 1463, 323, 7293, 439, 264, 89460, 36254, 16853, 791, 1890, 1920, 17208, 1101, 311, 10099, 13, 362, 33012, 430, 33291, 1202, 39406, 311, 264, 37642, 374, 38097, 311, 2274, 1028, 266, 9572, 26, 279, 3185, 14117, 389, 198, 49864, 433, 374, 1314, 477, 2163, 4579, 291, 13, 4452, 1174, 17037, 279, 33012, 64397, 420, 390, 171, 120912, 858, 555, 18534, 2500, 39406, 627, 791, 2768, 3187, 1253, 41468, 279, 4113, 20237, 907, 315, 420, 17383, 13, 58166, 9855, 264, 40132, 523, 2315, 459, 3276, 82665, 13, 578, 198, 519, 82665, 2011, 7214, 29905, 553, 682, 1202, 5070, 311, 18167, 13, 578, 53464, 23418, 1887, 5097, 927, 323, 304, 5369, 264, 118020, 171, 71831, 66, 198, 54160, 4219, 9221, 4642, 430, 95455, 21271, 5820, 662, 4740, 279, 6992, 12731, 279, 10065, 54331, 323, 279, 1370, 6539, 1331, 589, 5411, 198, 77, 651, 788, 1887, 9221, 25462, 369, 264, 1418, 311, 22436, 2547, 5865, 627, 2746, 4619, 264, 3823, 5334, 264, 9572, 23842, 11, 1524, 422, 279, 23842, 374, 5076, 11, 279, 1890, 24156, 2068, 374, 743, 304, 11633, 555, 279, 1890, 198, 69, 686, 315, 4648, 430, 9087, 279, 10065, 311, 12731, 13, 578, 8631, 2237, 35308, 323, 279, 8271, 2922, 2234, 3717, 374, 22756, 719, 1457, 1070, 374, 198, 7778, 10180, 70674, 49741, 279, 14285, 49741, 40160, 49741, 279, 23754, 49741, 279, 5867, 41356, 75101, 552, 10170, 612, 17326, 10965, 17326, 10965, 9359, 605, 14, 966, 14, 1187, 11, 220, 19, 25, 3487, 5975, 6401, 12, 36500, 6354, 53829, 482, 578, 1561, 19152, 315, 2999, 9777, 261, 198, 2485, 1129, 12393, 31419, 1873, 1355, 53829, 916, 15302, 1082, 2315, 11547, 11967, 48848, 90837, 5364, 92001, 8838, 12, 9023, 39, 15589, 2628, 220, 16, 14, 21, 3409, 6881, 311, 1629, 13, 30070, 279, 390, 171, 120912, 858, 374, 20250, 11, 902, 1253, 1935, 1667, 11, 1070, 690, 387, 6926, 8631, 439, 1664, 439, 8271, 38973, 41959, 198, 1073, 21271, 5820, 1174, 902, 1457, 5097, 279, 1376, 315, 7859, 21271, 8824, 555, 279, 92947, 519, 13096, 315, 7917, 627, 2028, 1920, 649, 1193, 387, 10717, 555, 28865, 1022, 279, 8346, 304, 279, 8271, 1555, 711, 985, 279, 4113, 390, 171, 120912, 858, 10988, 13, 1115, 8741, 198, 9493, 279, 8893, 28520, 706, 15173, 477, 5933, 15419, 1174, 902, 568, 477, 1364, 7373, 13919, 690, 3063, 311, 264, 27208, 13, 4452, 1174, 279, 1890, 198, 21826, 304, 264, 8893, 889, 706, 40017, 922, 1202, 27375, 690, 5387, 279, 390, 171, 120912, 858, 81261, 323, 279, 8624, 311, 5208, 13, 11361, 198, 998, 2999, 9777, 261, 18217, 82, 990, 11, 420, 374, 912, 1317, 68, 436, 1120, 459, 80304, 4811, 10234, 25329, 719, 4856, 7330, 72, 171, 71831, 66, 2144, 430, 649, 387, 113985, 171, 71831, 291, 30194, 449, 264, 198, 1182, 8271, 8737, 13, 87310, 198, 791, 6727, 315, 279, 390, 171, 120912, 858, 5357, 13980, 555, 84951, 15360, 13, 1789, 2937, 24156, 390, 171, 120912, 31095, 16239, 3090, 719, 1101, 1023, 198, 171, 120912, 92316, 11, 1778, 439, 14403, 477, 5707, 11, 3063, 311, 39042, 9572, 1174, 8850, 315, 4648, 311, 21271, 9572, 323, 96655, 91747, 264, 11493, 12143, 1243, 584, 198, 4919, 21552, 311, 23152, 477, 63900, 9572, 16853, 38363, 1174, 304, 279, 10065, 1917, 11, 433, 2216, 574, 264, 2466, 12143, 315, 3691, 11, 719, 369, 603, 433, 1253, 387, 264, 33595, 71831, 77, 5003, 927, 97498, 479, 477, 904, 1023, 198, 677, 7864, 367, 430, 584, 617, 4529, 389, 323, 4250, 5716, 171, 71831, 657, 13, 4452, 1174, 279, 2218, 5357, 374, 539, 11075, 555, 279, 1567, 5196, 11, 719, 4856, 555, 279, 198, 92109, 5848, 1879, 72, 171, 71831, 66, 685, 430, 433, 706, 369, 603, 520, 279, 892, 315, 279, 1567, 627, 39, 15589, 46480, 420, 449, 2500, 3187, 11, 264, 5333, 889, 33595, 71831, 82103, 1077, 10177, 304, 4950, 449, 2500, 8954, 13, 1666, 264, 7392, 33086, 198, 444, 171, 120912, 858, 433, 11384, 85656, 9572, 662, 1442, 1364, 4619, 11704, 433, 439, 264, 8427, 390, 171, 120912, 858, 11, 1243, 304, 264, 1314, 37240, 5333, 433, 11767, 311, 9572, 315, 198, 1820, 1314, 17659, 13, 1442, 279, 390, 171, 120912, 858, 8430, 374, 8850, 323, 5891, 34003, 1243, 433, 11384, 9950, 540, 398, 66, 22689, 323, 449, 6996, 315, 659, 2695, 2419, 9572, 1253, 198, 16219, 304, 279, 6814, 292, 17685, 627, 2746, 279, 6996, 315, 659, 2695, 2419, 1047, 1027, 4245, 311, 264, 8060, 304, 10034, 58832, 11494, 383, 436, 1109, 1694, 27681, 5552, 11, 1243, 279, 3575, 1053, 617, 198, 277, 24004, 304, 459, 6916, 477, 2531, 4619, 477, 11000, 304, 279, 33595, 71831, 983, 388, 477, 17308, 16853, 11663, 14595, 15082, 430, 1253, 3063, 311, 24156, 390, 171, 120912, 31095, 527, 4814, 15082, 11, 4814, 315, 264, 10456, 832, 11, 315, 264, 2683, 11, 264, 33647, 19243, 477, 264, 198, 96315, 683, 16853, 9023, 9777, 261, 13919, 430, 1455, 68370, 439, 288, 477, 14580, 56071, 527, 5353, 294, 555, 279, 9572, 2269, 686, 477, 4648, 2269, 686, 13239, 505, 279, 8893, 198, 43068, 279, 9572, 23842, 477, 264, 8389, 95350, 13, 4452, 1174, 1101, 304, 420, 1162, 279, 13239, 390, 171, 120912, 858, 10988, 1253, 539, 387, 8850, 315, 4648, 198, 8248, 4856, 19788, 1174, 71654, 477, 264, 25768, 390, 171, 120912, 858, 505, 8427, 477, 2911, 323, 1243, 56071, 1053, 5101, 304, 2204, 7634, 13, 7429, 264, 198, 8747, 50915, 315, 15235, 9572, 17037, 11767, 311, 26587, 9572, 1606, 315, 264, 84951, 8850, 315, 78245, 627, 77641, 3987, 33028, 11, 46996, 323, 7438, 33028, 1893, 21249, 220, 8631, 11, 902, 5471, 279, 21730, 505, 9572, 323, 1023, 198, 67, 1082, 2315, 719, 814, 527, 539, 279, 5353, 13, 10771, 311, 9777, 261, 279, 1972, 5353, 315, 9572, 323, 1023, 19338, 374, 459, 16907, 54286, 198, 939, 1197, 369, 902, 584, 527, 38683, 653, 61212, 13, 578, 2768, 1160, 5039, 1063, 315, 279, 12135, 1990, 390, 171, 120912, 858, 21958, 323, 198, 5775, 36853, 627, 2654, 47738, 49370, 220, 482, 41856, 5216, 11, 8208, 23112, 352, 198, 5028, 21473, 220, 482, 549, 23797, 390, 171, 120912, 858, 11, 19108, 29862, 198, 63429, 220, 4194, 4235, 68502, 315, 659, 2695, 2419, 11, 38279, 488, 8430, 198, 51329, 561, 14403, 67169, 220, 1389, 763, 12821, 4504, 2512, 477, 12269, 277, 65527, 198, 51329, 561, 14403, 45339, 220, 482, 34199, 367, 390, 171, 120912, 858, 198, 51329, 561, 11, 2163, 320, 1315, 37240, 8, 220, 1389, 1221, 171, 120912, 858, 18815, 1716, 11, 2162, 11, 6691, 198, 51329, 561, 11, 1314, 320, 1315, 37240, 8, 4194, 1389, 1221, 171, 120912, 858, 449, 8427, 477, 3885, 198, 42059, 331, 10522, 220, 1389, 18122, 1960, 532, 390, 171, 120912, 858, 198, 34, 651, 953, 220, 4194, 4235, 1369, 19846, 33086, 198, 89765, 220, 1389, 549, 23797, 1280, 15505, 1260, 390, 171, 120912, 858, 198, 17812, 5237, 59838, 256, 4194, 4235, 35755, 617, 433, 477, 42276, 433, 198, 38, 543, 2563, 21473, 220, 4194, 12, 432, 4023, 894, 390, 171, 120912, 858, 198, 46484, 256, 4194, 4235, 3700, 7005, 940, 390, 171, 120912, 858, 198, 1090, 478, 1572, 220, 482, 2314, 15505, 1260, 12143, 315, 19788, 198, 99608, 36371, 220, 4194, 4235, 2876, 19762, 311, 3974, 11, 3090, 477, 33595, 120912, 2480, 390, 171, 120912, 858, 198, 43, 661, 24244, 220, 482, 1221, 171, 120912, 858, 315, 8850, 323, 30647, 198, 83995, 220, 4194, 4235, 43067, 315, 78245, 198, 43, 2234, 220, 4194, 4235, 43067, 315, 23069, 477, 56868, 282, 2328, 11, 2737, 8850, 369, 4423, 775, 198, 43, 32800, 82375, 220, 1389, 25733, 315, 659, 2695, 2419, 5938, 449, 279, 3813, 198, 40249, 276, 7942, 220, 1389, 8430, 19108, 1174, 779, 2230, 11, 409, 171, 71831, 839, 605, 14, 966, 14, 1187, 11, 220, 19, 25, 3487, 5975, 6401, 12, 36500, 6354, 53829, 482, 578, 1561, 19152, 315, 2999, 9777, 261, 198, 2485, 1129, 12393, 31419, 1873, 1355, 53829, 916, 15302, 1082, 2315, 11547, 11967, 48848, 90837, 5364, 92001, 8838, 12, 9023, 39, 15589, 2628, 220, 17, 14, 21, 45035, 2487, 220, 1389, 2876, 1694, 3025, 311, 636, 1063, 16595, 2038, 198, 44, 2969, 220, 482, 35755, 37433, 477, 3412, 433, 198, 36793, 846, 300, 220, 1389, 81469, 12, 4091, 390, 171, 120912, 858, 449, 3070, 3697, 11, 42922, 198, 1360, 2513, 220, 1389, 549, 23797, 390, 171, 120912, 858, 449, 7392, 13537, 477, 390, 14632, 198, 4515, 372, 220, 1389, 43067, 315, 1694, 29948, 198, 38286, 220, 4194, 4235, 25733, 315, 17025, 198, 50, 698, 268, 220, 1389, 48083, 315, 1694, 22655, 477, 38683, 28593, 198, 626, 316, 613, 220, 1389, 2314, 15505, 1260, 19788, 1174, 64437, 2288, 1790, 198, 2323, 288, 323, 507, 959, 552, 220, 1389, 25733, 390, 171, 120912, 858, 198, 1016, 88, 1607, 220, 4194, 4235, 74658, 85452, 198, 52, 466, 355, 220, 1389, 39767, 390, 171, 120912, 858, 198, 791, 390, 171, 120912, 31095, 369, 1063, 1023, 19338, 527, 439, 11263, 512, 22427, 16629, 323, 9950, 540, 398, 66, 22689, 25, 220, 362, 1314, 37240, 8954, 39671, 9950, 540, 398, 66, 22689, 505, 18547, 323, 5891, 34003, 11, 422, 2163, 37240, 1364, 39671, 198, 1354, 24292, 43918, 20335, 13, 362, 1314, 2902, 323, 291, 8762, 39671, 32152, 51389, 370, 7870, 274, 505, 264, 390, 171, 120912, 858, 315, 70441, 477, 20558, 2403, 2555, 345, 333, 2163, 37240, 568, 39671, 9950, 540, 398, 66, 22689, 627, 46484, 4225, 277, 302, 25, 220, 33595, 71831, 2121, 369, 18455, 477, 1202, 2262, 627, 39, 336, 54308, 17390, 25, 220, 2225, 11, 264, 1314, 37240, 5333, 449, 459, 9764, 390, 171, 120912, 858, 323, 1101, 264, 2163, 37240, 893, 449, 52482, 19788, 304, 279, 21730, 198, 26199, 690, 636, 71417, 17390, 627, 33189, 91357, 323, 4366, 9270, 25, 220, 38550, 311, 12731, 477, 3136, 389, 477, 311, 3412, 389, 311, 477, 539, 14392, 1148, 311, 656, 627, 29802, 532, 86139, 25, 220, 8850, 315, 13490, 3663, 11, 3515, 1027, 1903, 264, 32681, 5708, 627, 21051, 93003, 220, 18065, 25768, 390, 171, 120912, 858, 18815, 6691, 1174, 7126, 1174, 3070, 1174, 2162, 11, 4885, 477, 26159, 627, 69803, 20274, 220, 315, 682, 13124, 617, 832, 477, 810, 4642, 9777, 261, 6385, 5469, 304, 1855, 315, 279, 1403, 5596, 315, 279, 8271, 627, 53, 275, 321, 7992, 11, 2009, 3178, 4414, 1764, 25, 220, 28360, 477, 28860, 25768, 390, 171, 120912, 858, 13, 106050, 644, 5363, 311, 46060, 2999, 9777, 261, 81299, 430, 912, 832, 3596, 8636, 315, 46060, 2085, 3515, 8767, 1027, 3309, 430, 814, 527, 23495, 6928, 477, 198, 9978, 19704, 430, 814, 527, 13, 578, 61636, 374, 430, 1120, 439, 449, 9572, 1174, 433, 374, 279, 8389, 21063, 5938, 449, 46060, 430, 11384, 1202 ]
0xBreath/holistic-books
QUESTIONS • 105 Obviously, none of these harmful substances are advocated in the pro­ gram. My reason for discussing them here is to heighten the awareness among pregnant women of what their effects can be on the unborn child. In 12 percent or more of all births in our country defects now occur, and this number is increasing every year as more and more chemicals and poisons enter our environment and our diet. Being pregnant is a special time requiring more than any other time a special consciousness about the body's needs. Following the program will help insure the right food and the fresh air and sunshine that are integral factors to a healthy pregnancy. Plenty of rest and regular exercise are also necessary. Sometimes individuals have special requirements. All changes in diet during pregnancy should be made gradually and under the supervision of your midwife, health adviser, or doctor. This concludes Part I, in which I have endeavored to give you a clear under­ standing of what changes in life-style are necessary for you to overcome your weight problem once and for all, and why you would want to make these changes. In Part II Marilyn will give you some important hints on how to make these changes so that your new life-style will be a lasting one. Drawing from her understanding of American dietary addictions, from her back­ ground as a creative teacher of gourmet home cooking, and from her solid grasp of the Natural Hygiene principles, she has outlined a four-week pro­ gram that will show you how to prepare a variety of delicious, properly com­ bined, high-water-content meals. The program has been designed to speed you toward your goal of weight loss while comfortably initiating the all- important detoxification of your body. An effective WEIGHT LOSS AND HIGH-ENERGY LIFE-STYLE is now only one meal away, so let's turn over a new leaf in our lives by turning the page to begin.... 106 • FIT FOR LIFE PART Program BY Marilyn Diamond ^ INTRODUCTION _w. hen I first consulted Harvey in his capacity as a nutritional counselor in 1975, I was going through the most critical health crisis of my life. I came to him in a very discouraged frame of mind. I had a strong medical background1 and a long history of medical treatment, but for as long as I could remember, I had never really felt well. Excess weight was not my major concern at that time, although I'm not saying it wasn't one of my concerns. 1 must confess, though, from my early teens 1 had not been happy with the shape of my body, and since that time I had always worn high heels to achieve a thinner look. My real problem, although I did not know it at the time, was that I was totally out of energy. I felt terrible, and I was having a great deal of trouble coping with my life. Actually what I was experiencing was not an 1 During my childhood my father was a biochemist at the National Institutes of Health in Bcthcsda, Maryland. He subsequently held positions as department head of Microbiology and Molecular Biol­ ogy at New York University Medical School and Albert Einstein College of Medicine. He is pres­ ently the dean of the Graduate School of Medicine at Cornell University. The medical and scientific professions have an all-encompassing life-style in which I was very much involved as my father's child. I worked in his laboratory during summer vacations, and under his influence 1 studied biology and chemistry in college. • 109 • uncommon phenomenon. Conditions of negative energy are the basis of many of the physical, psychological, and emotional problems being expe­ rienced by men, women, and children in this country. My symptoms were not unusual: stomach pain, embarrassing skin eruptions, depression, confusion, sudden mood swings, and emotional outbursts. What fright­ ened me was that they were becoming progressively worse. After having been so highly motivated in college that I had been Phi Beta Kappa and magna cum laude, at the age of thirty-one, with two small children, I spent much of my time in depression and tears, wondering how I was ever going to feel well enough to get on with my life. No amount of drugs, treatment, or therapy that I had had over the years had done any­ thing to change or improve my situation. In all the time that I had been medicated for a nervous stomach and debilitated digestive tract, been tranquilized for nervous tension, taken injection therapy for pain, and theorized with the "experts" about my physical, mental, and emotional "dis-ease," no one ever asked me what I was eating! Harvey did! Natural Hygiene, as Harvey was teaching it, supplied me with answers about my health that I had all but given up on finding. What did I learn? Everything I needed to know to help myself feel well! I learned that I was in pain and out of energy because for most of my life I had been overtax­ ing my system with the wrong kinds of foods. Because for so many de­ cades in this country breast-feeding had not been in vogue, I had been among the millions of babies who never received breast milk, the only food naturally intended for and suitable to the young of the human spe­ cies. In his most recent book, How to Raise a Healthy Child in Spite of Your Doctor, Dr. Robert S. Mendelsohn writes, "Breast-feeding lays the foundation for healthy physical and emotional growth... Mother's milk, time-tested for millions of years, is the best nutrient for babies be­ cause it is nature's perfect food."2 How did we in our society arrive at that place of ignorance where we actually didn't know what a difference breast-feeding would make in the future health of our children? Dr. Mendelsohn places the blame firmly with the commercially motivated formula manufacturers and the pedi­ atricians who help them sell their formulas. He faults obstetricians and pediatricians for failing to emphasize strongly enough the importance of breast-feeding. As a result, millions of children in our society have been and continue to be raised on formula and cow's milk, which are over­ laden with protein and which some researchers feel contain a coarser and therefore less absorbable calcium than that found in mother's milk. In my case, this led to a highly acidic condition in my young body, incredi- 2Robcrt S. Mendelsohn. M.D. How to Raise a Healthy Child in Spite of Your Doctor. Chicago: Contemporary Books, Inc., 1984: 46-47. (Italics are Dr. Mendelsohn's.) 110'FIT FOR LIFE bly debilitating bouts of hives, joint problems that ultimately necessitated surgery in both knees, and a weakened nervous system. As is typical in our country I had been raised on meat from a very early age. As a natural vegetarian (although I didn't find this out until the age of thirty-one), my inability to digest meat resulted in persistent and painful digestive diffi­ culties. I had a gourmet background (my mother was a talented hostess and an accomplished gourmet cook) and had traveled considerably from early childhood. I was exposed to international cuisine at an early age. As a college student I had the opportunity to work with a French provincial cook, Armand Ducellier, in Avignon, France. All of this was very much part of my identity and my life-style, and at first it was hard for me to see it as the root of my health problems. But the plain fact was that the foods I had been eating were wreaking havoc on my body, leaving me with no energy to cope with anything else in my life. When I put into practice the principles that Harvey recommended, which are the same that he has just outlined for you, / lost twenty pounds! In a matter of only six weeks, and for the first time in my adult life, I was proud of and comfortable with the shape of my body. That is an exhilarating feeling that everyone deserves! Even more important for me, however, was my change in outlook. The cloud of depression under which I had been living for years began to lift. I began to experience whole days of tranquillity. Only someone who has suffered the drain of mental and physical depression can understand what a breakthrough that can be. As my body worked to put itself back into balance, I could see that I was going to be able to live the productive and fulfilling life that had once been my dream. I felt as if I were coming back to the land of the living! One thing was apparent from the outset: It would be necessary to shed my traditional gourmet approach to food preparation if I was determined to feel consistently well. This became apparent for me during detoxifica­ tion? as my taste buds would periodically yearn for past addictions, and the indulging of those addictions would immediately make me feel un­ well again. Working with Harvey, 1 began to focus on what people would do when they, like me, became aware of the importance of healthy weight loss. How would they make a comfortable transition from their traditional eating habits? What I needed and what others would need was an exciting new approach to delicious yet nutritious food that would
[ 57828, 43486, 7436, 220, 6550, 36530, 11, 7000, 315, 1521, 28856, 33155, 527, 64854, 304, 279, 463, 5879, 198, 1549, 13, 3092, 2944, 369, 25394, 1124, 1618, 374, 311, 2673, 268, 279, 17985, 720, 77405, 20895, 3278, 315, 1148, 872, 6372, 649, 387, 389, 279, 86333, 1716, 13, 720, 644, 220, 717, 3346, 477, 810, 315, 682, 66332, 304, 1057, 3224, 42655, 1457, 12446, 11, 323, 720, 576, 1396, 374, 7859, 1475, 1060, 439, 810, 323, 810, 26333, 323, 720, 5481, 19941, 3810, 1057, 4676, 323, 1057, 10173, 13, 720, 34242, 20895, 374, 264, 3361, 892, 23537, 810, 1109, 904, 1023, 892, 264, 720, 15495, 25917, 922, 279, 2547, 596, 3966, 13, 23548, 279, 2068, 690, 720, 8823, 70632, 279, 1314, 3691, 323, 279, 7878, 3805, 323, 52495, 430, 527, 26154, 720, 69, 21846, 311, 264, 9498, 20209, 13, 69489, 315, 2800, 323, 5912, 10368, 527, 1101, 720, 95317, 13, 720, 32148, 7931, 617, 3361, 8670, 13, 2052, 4442, 304, 10173, 720, 82977, 20209, 1288, 387, 1903, 27115, 323, 1234, 279, 38217, 315, 720, 22479, 5209, 48841, 11, 2890, 32853, 11, 477, 10896, 13, 720, 2028, 45537, 3744, 358, 11, 304, 902, 358, 617, 29705, 76486, 311, 3041, 499, 264, 2867, 1234, 5879, 198, 10276, 315, 1148, 4442, 304, 2324, 11549, 527, 5995, 369, 499, 311, 23075, 701, 720, 4870, 3575, 3131, 323, 369, 682, 11, 323, 3249, 499, 1053, 1390, 311, 1304, 1521, 720, 19926, 13, 763, 3744, 8105, 77460, 690, 3041, 499, 1063, 3062, 31743, 389, 1268, 311, 720, 7072, 1521, 4442, 779, 430, 701, 502, 2324, 11549, 690, 387, 264, 29869, 832, 13, 38859, 720, 1527, 1077, 8830, 315, 3778, 34625, 923, 22155, 11, 505, 1077, 1203, 5879, 198, 1993, 439, 264, 11782, 11326, 315, 73585, 2162, 17677, 11, 323, 505, 1077, 6573, 720, 911, 13671, 315, 279, 18955, 10320, 43312, 16565, 11, 1364, 706, 33740, 264, 3116, 30609, 463, 5879, 198, 1549, 430, 690, 1501, 499, 1268, 311, 10772, 264, 8205, 315, 18406, 11, 10489, 470, 5879, 198, 65, 1619, 11, 1579, 55051, 6951, 21644, 13, 578, 2068, 706, 1027, 6319, 311, 4732, 720, 9514, 9017, 701, 5915, 315, 4785, 4814, 1418, 45769, 79516, 279, 682, 7058, 15693, 61987, 2461, 315, 701, 2547, 13, 720, 2127, 7524, 96920, 28453, 3651, 38717, 12, 12545, 42570, 61094, 12, 83077, 374, 1457, 1193, 832, 720, 42880, 3201, 11, 779, 1095, 596, 2543, 927, 264, 502, 16312, 304, 1057, 6439, 555, 13353, 279, 2199, 311, 720, 7413, 13, 5354, 662, 720, 7461, 7436, 7608, 4716, 61094, 6909, 720, 10920, 720, 20507, 720, 44, 6751, 77, 25328, 6440, 720, 3301, 91199, 720, 1704, 13, 48916, 358, 1176, 61302, 34422, 304, 720, 26301, 8824, 439, 264, 43226, 62475, 304, 220, 4468, 20, 11, 358, 574, 2133, 1555, 279, 720, 3646, 9200, 2890, 11501, 315, 856, 2324, 13, 358, 3782, 311, 1461, 304, 264, 1633, 64770, 720, 6906, 315, 4059, 13, 358, 1047, 264, 3831, 6593, 4092, 16, 323, 264, 1317, 3925, 315, 720, 69216, 6514, 11, 719, 369, 439, 1317, 439, 358, 1436, 6227, 11, 358, 1047, 2646, 720, 54760, 6612, 1664, 13, 1398, 1140, 4785, 574, 539, 856, 3682, 4747, 520, 430, 892, 11, 720, 37241, 358, 2846, 539, 5605, 433, 5828, 956, 832, 315, 856, 10742, 13, 220, 16, 2011, 48466, 11, 720, 4636, 11, 505, 856, 4216, 27294, 220, 16, 1047, 539, 1027, 6380, 449, 279, 6211, 315, 856, 720, 2664, 11, 323, 2533, 430, 892, 358, 1047, 2744, 24634, 1579, 34460, 311, 11322, 264, 720, 339, 4481, 1427, 13, 720, 5159, 1972, 3575, 11, 8051, 358, 1550, 539, 1440, 433, 520, 279, 892, 11, 574, 430, 358, 574, 720, 28879, 750, 704, 315, 4907, 13, 358, 6612, 17936, 11, 323, 358, 574, 3515, 264, 2294, 3568, 315, 720, 376, 1222, 63082, 449, 856, 2324, 13, 34863, 1148, 358, 574, 25051, 574, 539, 459, 720, 16, 12220, 856, 20587, 856, 7126, 574, 264, 17332, 75188, 520, 279, 5165, 73828, 315, 6401, 304, 426, 92921, 4942, 3315, 11, 720, 42584, 1974, 13, 1283, 28520, 5762, 10093, 439, 9476, 2010, 315, 18654, 81162, 323, 60825, 81894, 5879, 198, 16035, 520, 1561, 4356, 3907, 13235, 6150, 323, 17971, 55152, 9304, 315, 19152, 13, 1283, 374, 1685, 5879, 198, 4501, 279, 73962, 315, 279, 44825, 6150, 315, 19152, 520, 56819, 3907, 13, 720, 791, 6593, 323, 12624, 69792, 617, 459, 682, 21430, 31929, 287, 2324, 11549, 304, 902, 358, 574, 1633, 720, 59178, 6532, 439, 856, 7126, 596, 1716, 13, 358, 6575, 304, 813, 27692, 2391, 7474, 75667, 11, 323, 1234, 720, 26301, 10383, 220, 16, 20041, 34458, 323, 30903, 304, 7926, 13, 720, 6806, 220, 7743, 7436, 41296, 25885, 13, 32934, 315, 8389, 4907, 527, 279, 8197, 315, 720, 35676, 315, 279, 7106, 11, 24064, 11, 323, 14604, 5435, 1694, 506, 375, 5879, 198, 462, 5886, 555, 3026, 11, 3278, 11, 323, 2911, 304, 420, 3224, 13, 3092, 13803, 720, 52898, 539, 19018, 25, 23152, 6784, 11, 45105, 6930, 61354, 1324, 11, 18710, 11, 720, 6263, 7713, 11, 11210, 20247, 57890, 11, 323, 14604, 704, 11490, 37379, 13, 3639, 30647, 5879, 198, 6901, 757, 574, 430, 814, 1051, 10671, 72859, 11201, 13, 4740, 3515, 720, 82850, 779, 7701, 27762, 304, 7926, 430, 358, 1047, 1027, 64913, 35343, 735, 28279, 323, 720, 76, 56057, 12454, 1208, 799, 11, 520, 279, 4325, 315, 27219, 19101, 11, 449, 1403, 2678, 2911, 11, 358, 720, 95464, 1790, 315, 856, 892, 304, 18710, 323, 24014, 11, 20910, 1268, 358, 574, 720, 2099, 2133, 311, 2733, 1664, 3403, 311, 636, 389, 449, 856, 2324, 13, 2360, 3392, 315, 720, 3696, 13602, 11, 6514, 11, 477, 15419, 430, 358, 1047, 1047, 927, 279, 1667, 1047, 2884, 904, 5879, 198, 1626, 311, 2349, 477, 7417, 856, 6671, 13, 763, 682, 279, 892, 430, 358, 1047, 1027, 720, 2106, 10297, 369, 264, 23418, 23152, 323, 4316, 3748, 660, 60071, 42929, 11, 1027, 720, 44469, 88684, 1534, 369, 23418, 24408, 11, 4529, 26127, 15419, 369, 6784, 11, 323, 720, 1820, 269, 1534, 449, 279, 330, 4683, 15916, 1, 922, 856, 7106, 11, 10723, 11, 323, 14604, 720, 1, 4338, 5773, 521, 1359, 912, 832, 3596, 4691, 757, 1148, 358, 574, 12459, 0, 34422, 1550, 0, 720, 55381, 10320, 43312, 11, 439, 34422, 574, 12917, 433, 11, 17665, 757, 449, 11503, 720, 9274, 856, 2890, 430, 358, 1047, 682, 719, 2728, 709, 389, 9455, 13, 3639, 1550, 358, 4048, 30, 720, 36064, 358, 4460, 311, 1440, 311, 1520, 7182, 2733, 1664, 0, 358, 9687, 430, 358, 574, 720, 258, 6784, 323, 704, 315, 4907, 1606, 369, 1455, 315, 856, 2324, 358, 1047, 1027, 927, 18081, 5879, 198, 287, 856, 1887, 449, 279, 5076, 13124, 315, 15657, 13, 9393, 369, 779, 1690, 409, 5879, 198, 66, 3536, 304, 420, 3224, 17659, 12, 46519, 1047, 539, 1027, 304, 348, 28523, 11, 358, 1047, 1027, 720, 77405, 279, 11990, 315, 24869, 889, 2646, 4036, 17659, 14403, 11, 279, 1193, 720, 14239, 18182, 10825, 369, 323, 14791, 311, 279, 3995, 315, 279, 3823, 2395, 5879, 198, 70107, 13, 763, 813, 1455, 3293, 2363, 11, 2650, 311, 43646, 264, 44454, 9576, 304, 3165, 635, 315, 720, 7927, 19150, 11, 2999, 13, 8563, 328, 13, 46211, 301, 708, 25105, 14238, 11, 330, 51329, 561, 12, 46519, 57622, 279, 720, 73407, 369, 9498, 7106, 323, 14604, 6650, 662, 662, 662, 21720, 596, 720, 76, 34263, 11, 892, 97173, 369, 11990, 315, 1667, 11, 374, 279, 1888, 50123, 369, 24869, 387, 5879, 198, 1593, 433, 374, 7138, 596, 4832, 3691, 1210, 17, 720, 4438, 1550, 584, 304, 1057, 8396, 17782, 520, 430, 2035, 315, 41660, 1405, 584, 720, 74128, 3287, 956, 1440, 1148, 264, 6811, 17659, 12, 46519, 1053, 1304, 304, 279, 720, 21733, 2890, 315, 1057, 2911, 30, 2999, 13, 46211, 301, 708, 25105, 7634, 279, 19065, 32620, 720, 4291, 279, 54453, 27762, 15150, 17032, 323, 279, 10696, 72, 5879, 198, 266, 2265, 5493, 889, 1520, 1124, 4662, 872, 55179, 13, 1283, 57790, 18345, 16743, 5493, 323, 720, 7018, 23336, 5493, 369, 22109, 311, 47032, 16917, 3403, 279, 12939, 315, 720, 21152, 561, 12, 46519, 13, 1666, 264, 1121, 11, 11990, 315, 2911, 304, 1057, 8396, 617, 1027, 720, 438, 3136, 311, 387, 9408, 389, 15150, 323, 19923, 596, 14403, 11, 902, 527, 927, 5879, 198, 89651, 449, 13128, 323, 902, 1063, 12074, 2733, 6782, 264, 1080, 10642, 323, 720, 19041, 1348, 2753, 35406, 481, 35719, 1109, 430, 1766, 304, 6691, 596, 14403, 13, 763, 720, 2465, 1162, 11, 420, 6197, 311, 264, 7701, 84903, 3044, 304, 856, 3995, 2547, 11, 2333, 8747, 7058, 17, 14804, 66, 3423, 328, 13, 46211, 301, 708, 25105, 13, 386, 920, 13, 2650, 311, 43646, 264, 44454, 9576, 304, 3165, 635, 315, 4718, 19150, 13, 10780, 25, 720, 825, 14084, 18312, 11, 4953, 2637, 220, 3753, 19, 25, 220, 2790, 12, 2618, 13, 320, 2181, 278, 1233, 527, 2999, 13, 46211, 301, 708, 25105, 596, 6266, 720, 5120, 364, 7608, 4716, 61094, 293, 398, 92890, 96271, 315, 305, 1924, 11, 10496, 5435, 430, 13967, 4541, 33337, 720, 82, 85392, 304, 2225, 31624, 11, 323, 264, 58764, 23418, 1887, 13, 1666, 374, 14595, 304, 720, 414, 3224, 358, 1047, 1027, 9408, 389, 13339, 505, 264, 1633, 4216, 4325, 13, 1666, 264, 5933, 720, 83571, 8997, 320, 37241, 358, 3287, 956, 1505, 420, 704, 3156, 279, 4325, 315, 27219, 19101, 705, 856, 720, 258, 2968, 311, 21552, 13339, 19543, 304, 26048, 323, 26175, 60071, 3722, 72, 5879, 198, 93113, 552, 13, 358, 1047, 264, 73585, 4092, 320, 2465, 6691, 574, 264, 23944, 3552, 434, 720, 438, 459, 27332, 73585, 4394, 8, 323, 1047, 31796, 33452, 505, 720, 22928, 20587, 13, 358, 574, 15246, 311, 6625, 36105, 520, 459, 4216, 4325, 13, 1666, 720, 64, 7926, 5575, 358, 1047, 279, 6776, 311, 990, 449, 264, 8753, 36031, 720, 87895, 11, 1676, 1969, 80873, 616, 1291, 11, 304, 7671, 62799, 11, 9822, 13, 2052, 315, 420, 574, 1633, 1790, 720, 4581, 315, 856, 9764, 323, 856, 2324, 11549, 11, 323, 520, 1176, 433, 574, 2653, 369, 757, 311, 1518, 720, 275, 439, 279, 3789, 315, 856, 2890, 5435, 13, 2030, 279, 14733, 2144, 574, 430, 279, 15657, 720, 40, 1047, 1027, 12459, 1051, 83675, 287, 66592, 389, 856, 2547, 11, 9564, 757, 449, 912, 720, 17947, 311, 37586, 449, 4205, 775, 304, 856, 2324, 13, 720, 4599, 358, 2231, 1139, 6725, 279, 16565, 430, 34422, 11349, 11, 720, 8370, 527, 279, 1890, 430, 568, 706, 1120, 33740, 369, 499, 11, 611, 5675, 17510, 720, 79, 3171, 0, 763, 264, 5030, 315, 1193, 4848, 5672, 11, 323, 369, 279, 1176, 892, 304, 856, 6822, 720, 14789, 11, 358, 574, 12691, 315, 323, 10882, 449, 279, 6211, 315, 856, 2547, 13, 3011, 374, 459, 720, 327, 71, 3653, 1113, 8430, 430, 5127, 30675, 0, 7570, 810, 3062, 369, 757, 11, 720, 98936, 11, 574, 856, 2349, 304, 36721, 13, 578, 9624, 315, 18710, 1234, 720, 8370, 358, 1047, 1027, 5496, 369, 1667, 6137, 311, 12157, 13, 358, 6137, 311, 3217, 720, 67733, 2919, 315, 41664, 484, 488, 13, 8442, 4423, 889, 706, 16654, 279, 24659, 315, 720, 93221, 323, 7106, 18710, 649, 3619, 1148, 264, 42445, 430, 720, 4919, 387, 13, 1666, 856, 2547, 6575, 311, 2231, 5196, 1203, 1139, 8335, 11, 358, 1436, 1518, 720, 9210, 358, 574, 2133, 311, 387, 3025, 311, 3974, 279, 27331, 323, 50698, 2324, 430, 720, 32345, 3131, 1027, 856, 8063, 13, 358, 6612, 439, 422, 358, 1051, 5108, 1203, 311, 279, 4363, 315, 720, 1820, 5496, 0, 720, 4054, 3245, 574, 10186, 505, 279, 68864, 25, 1102, 1053, 387, 5995, 311, 25351, 720, 2465, 8776, 73585, 5603, 311, 3691, 18459, 422, 358, 574, 11075, 720, 998, 2733, 21356, 1664, 13, 1115, 6244, 10186, 369, 757, 2391, 61987, 30588, 5879, 198, 28491, 30, 439, 856, 12945, 68543, 1053, 48582, 1060, 77, 369, 3347, 923, 22155, 11, 323, 720, 1820, 37960, 3252, 315, 1884, 923, 22155, 1053, 7214, 1304, 757, 2733, 653, 5879, 198, 9336, 1578, 13, 22938, 449, 34422, 11, 220, 16, 6137, 311, 5357, 389, 1148, 1274, 1053, 720, 3055, 994, 814, 11, 1093, 757, 11, 6244, 8010, 315, 279, 12939, 315, 9498, 720, 4870, 4814, 13, 2650, 1053, 814, 1304, 264, 10882, 9320, 505, 872, 720, 88008, 12459, 26870, 30, 3639, 358, 4460, 323, 1148, 3885, 1053, 1205, 574, 720, 276, 13548, 502, 5603, 311, 18406, 3686, 78216, 3691, 430, 1053 ]
0xBreath/holistic-books
 F7   $ 6 8   ## !   ##   #     #  $    !    " 9      $       #   #:  ; 8          <"      %                  G   (    EH *         >    (7'  EH * ?8('          ('  =  ?      (          +D        (=         "!        !      # %>      !    ?   @        !" $     %    @   #      !"            %   G =      (       I        (        G      (                 *              (   (   
[ 211, 192, 202, 194, 206, 205, 203, 205, 209, 194, 192, 195, 209, 206, 192, 202, 194, 206, 205, 203, 195, 193, 192, 203, 204, 271, 205, 203, 204, 193, 195, 37, 22, 199, 198, 193, 192, 197, 195, 199, 3, 193, 195, 216, 193, 196, 202, 271, 191, 21, 193, 208, 191, 192, 197, 208, 203, 208, 23, 193, 205, 198, 203, 195, 196, 198, 202, 193, 203, 208, 196, 192, 208, 191, 216, 193, 203, 208, 193, 199, 208, 192, 193, 208, 23438, 191, 193, 4999, 192, 192, 198, 191, 218, 193, 205, 208, 191, 271, 23438, 196, 192, 195, 219, 198, 218, 193, 216, 198, 5062, 191, 193, 198, 199, 203, 193, 196, 16176, 720, 191, 193, 208, 220, 192, 195, 208, 199, 216, 193, 2, 208, 191, 193, 192, 191, 271, 192, 195, 199, 3, 193, 196, 197, 191, 208, 199, 195, 196, 193, 203, 195, 216, 271, 216, 198, 193, 4999, 196, 198, 190, 216, 198, 192, 1602, 1, 193, 202, 198, 196, 24, 193, 192, 1602, 192, 193, 720, 191, 192, 195, 196, 190, 202, 198, 191, 193, 192, 191, 198, 195, 199, 195, 199, 3, 193, 198, 199, 203, 193, 198, 19124, 191, 193, 192, 208, 193, 1602, 219, 198, 193, 202, 195, 192, 192, 202, 198, 193, 191, 198, 216, 720, 196, 192, 193, 2, 208, 191, 193, 192, 1602, 219, 198, 202, 190, 198, 193, 208, 2, 193, 25, 190, 199, 220, 191, 208, 219, 198, 199, 26, 193, 198, 199, 192, 195, 208, 23, 195, 203, 198, 199, 192, 218, 193, 219, 195, 192, 198, 205, 195, 199, 218, 193, 205, 195, 199, 198, 191, 198, 202, 218, 193, 198, 205, 195, 199, 208, 193, 198, 196, 195, 203, 218, 193, 198, 199, 203, 198, 199, 99606, 205, 198, 193, 216, 190, 220, 220, 202, 198, 205, 198, 199, 192, 198, 192, 195, 208, 199, 4, 218, 196, 208, 207, 190, 209, 214, 192, 189, 203, 208, 209, 196, 199, 205, 198, 195, 203, 214, 192, 191, 200, 194, 208, 198, 214, 217, 192, 205, 202, 199, 193, 205, 194, 196, 192, 191, 200, 195, 191, 192, 205, 191, 192, 200, 195, 196, 192, 212, 194, 194, 209, 192, 199, 208, 196, 196, 205, 212, 193, 194, 192, 191, 208, 192, 206, 194, 203, 194, 205, 213, 194, 192, 195, 209, 192, 194, 209, 191, 205, 198, 194, 199, 198, 208, 211, 194, 196, 196, 205, 208, 209, 216, 192, 192, 195, 209, 206, 192, 191, 208, 192, 212, 198, 195, 205, 209, 220, 195, 196, 200, 192, 191, 200, 194, 192, 199, 204, 212, 193, 205, 203, 216, 192, 196, 205, 202, 199, 193, 214, 192, 212, 214, 192, 191, 200, 194, 192, 211, 198, 194, 38, 204, 194, 209, 191, 192, 204, 196, 194, 192, 208, 211, 192, 191, 200, 194, 192, 220, 208, 198, 206, 189, 196, 203, 205, 194, 209, 203, 194, 7, 217, 192, 218, 200, 194, 198, 194, 192, 195, 198, 194, 192, 191, 200, 194, 192, 46689, 204, 195, 203, 210, 212, 204, 196, 191, 194, 198, 196, 216, 9, 192, 220, 200, 208, 192, 220, 208, 198, 210, 192, 191, 208, 192, 206, 205, 196, 203, 198, 194, 206, 205, 191, 192, 195, 193, 191, 194, 198, 209, 195, 191, 205, 213, 194, 196, 192, 191, 208, 199, 198, 194, 196, 203, 198, 205, 199, 191, 205, 208, 209, 192, 206, 198, 204, 207, 196, 29, 192, 205, 209, 203, 193, 204, 206, 205, 209, 207, 192, 191, 200, 208, 196, 194, 192, 220, 200, 208, 192, 195, 206, 213, 208, 203, 195, 191, 194, 192, 196, 204, 203, 200, 192, 195, 193, 191, 194, 198, 209, 195, 191, 205, 213, 194, 196, 7, 192, 22, 6, 191, 192, 205, 196, 192, 206, 205, 211, 211, 205, 203, 204, 193, 191, 192, 191, 208, 212, 194, 193, 205, 194, 213, 194, 192, 191, 200, 195, 191, 192, 191, 200, 194, 192, 46689, 204, 195, 203, 210, 212, 204, 196, 191, 194, 198, 196, 9, 192, 205, 209, 211, 193, 204, 194, 209, 203, 194, 192, 202, 194, 206, 205, 203, 195, 193, 192, 203, 193, 195, 196, 196, 198, 208, 208, 202, 196, 192, 195, 209, 206, 192, 191, 194, 30, 191, 196, 23, 7, 192, 6, 191, 192, 200, 195, 198, 206, 193, 214, 192, 196, 194, 194, 202, 196, 193, 205, 210, 194, 193, 214, 192, 191, 200, 195, 191, 192, 202, 194, 206, 205, 203, 195, 193, 192, 194, 206, 204, 203, 195, 191, 205, 208, 209, 192, 203, 208, 204, 193, 206, 192, 212, 194, 192, 196, 208, 192, 191, 205, 207, 200, 191, 193, 214, 192, 203, 208, 209, 191, 198, 208, 193, 193, 194, 206, 216, 192, 191, 200, 195, 191, 192, 195, 193, 193, 192, 206, 208, 203, 191, 208, 198, 196, 192, 195, 198, 194, 192, 203, 204, 191, 192, 211, 198, 208, 202, 191, 200, 194, 192, 196, 195, 202, 194, 192, 202, 208, 193, 206, 7, 192, 6, 209, 192, 195, 209, 214, 192, 203, 195, 196, 194, 216, 192, 191, 200, 194, 192, 209, 204, 191, 198, 205, 191, 205, 208, 209, 28, 213, 195, 203, 204, 204, 202, 192, 205, 209, 192, 208, 198, 191, 200, 208, 206, 208, 30, 192, 202, 194, 206, 205, 203, 195, 193, 192, 194, 206, 204, 203, 195, 191, 205, 208, 209, 192, 205, 196, 199, 194, 198, 213, 195, 196, 205, 213, 194, 216, 192, 196, 194, 198, 213, 205, 209, 207, 192, 202, 208, 198, 194, 192, 191, 200, 195, 209, 192, 208, 209, 194, 192, 202, 195, 196, 191, 194, 198, 7, 192, 218, 200, 194, 192, 193, 194, 207, 195, 193, 192, 198, 205, 207, 200, 191, 192, 191, 208, 192, 199, 198, 194, 196, 203, 198, 205, 212, 194, 192, 206, 198, 204, 207, 196, 216, 192, 195, 211, 191, 194, 198, 192, 195, 193, 193, 216, 192, 205, 196, 220, 200, 195, 191, 192, 196, 194, 199, 195, 198, 195, 191, 194, 196, 192, 10, 35, 196, 192, 211, 198, 208, 202, 192, 203, 200, 205, 198, 208, 199, 198, 195, 203, 191, 208, 198, 196, 192, 195, 209, 206, 192, 208, 191, 200, 194, 198, 192, 199, 200, 214, 196, 205, 203, 205, 195, 209, 196, 121110, 1602, 192, 198, 219, 198, 191, 193, 192, 1602, 193, 191, 271, 216, 208, 199, 218, 193, 205, 198, 203, 195, 196, 198, 202, 193, 216, 192, 190, 203, 198, 199, 192, 216, 193, 192, 191, 190, 202, 1, 193, 4999, 202, 195, 198, 219, 198, 193, 192, 1602, 192, 193, 192, 1602, 195, 191, 193, 198, 203, 190, 196, 198, 192, 195, 208, 199, 193, 195, 216, 4999, 216, 198, 203, 193, 190, 220, 208, 199, 193, 192, 1602, 193, 220, 190, 191, 216, 190, 195, 192, 193, 208, 2, 193, 192, 191, 190, 192, 197, 4, 193, 29, 208, 69862, 219, 198, 191, 218, 193, 192, 1602, 193, 198, 190, 192, 197, 208, 191, 193, 1602, 216, 193, 208, 0, 216, 198, 191, 219, 198, 203, 193, 192, 1602, 205, 195, 199, 203, 30, 196, 208, 199, 192, 191, 208, 202, 193, 192, 198, 196, 197, 199, 195, 31, 190, 198, 216, 193, 190, 216, 198, 203, 193, 195, 199, 193, 205, 198, 203, 195, 196, 198, 202, 193, 216, 196, 197, 208, 208, 202, 216, 218, 193, 205, 208, 216, 192, 193, 199, 208, 192, 198, 0, 202, 1, 193, 203, 190, 191, 195, 199, 3, 196, 202, 198, 216, 216, 198, 216, 193, 208, 199, 193, 199, 190, 192, 191, 195, 192, 195, 208, 199, 4, 193, 214, 1602, 216, 198, 193, 192, 198, 196, 197, 199, 195, 31, 190, 198, 216, 193, 198, 191, 198, 193, 208, 2, 192, 198, 199, 193, 198, 203, 208, 220, 192, 198, 203, 193, 198, 199, 203, 193, 190, 216, 198, 203, 193, 9135, 205, 198, 203, 195, 196, 198, 202, 193, 198, 190, 192, 197, 208, 191, 195, 192, 195, 198, 216, 193, 198, 199, 203, 193, 200, 191, 195, 192, 198, 191, 216, 193, 195, 199, 193, 192, 1602, 193, 205, 198, 203, 195, 198, 4, 218, 200, 194, 192, 211, 205, 198, 196, 191, 192, 191, 194, 203, 200, 209, 205, 38, 204, 194, 192, 205, 196, 192, 191, 208, 192, 199, 198, 194, 196, 194, 209, 191, 192, 195, 209, 214, 192, 212, 194, 209, 194, 211, 205, 191, 192, 208, 211, 192, 195, 209, 214, 192, 209, 208, 209, 28, 199, 198, 194, 196, 203, 198, 205, 199, 191, 205, 208, 209, 192, 196, 204, 212, 196, 191, 195, 209, 203, 194, 192, 205, 209, 192, 195, 192, 220, 195, 214, 191, 200, 195, 191, 192, 203, 195, 196, 191, 196, 192, 206, 208, 204, 212, 191, 192, 204, 199, 208, 209, 192, 205, 191, 196, 192, 213, 195, 193, 204, 194, 7, 192, 190, 204, 191, 200, 208, 198, 205, 191, 205, 194, 196, 192, 204, 196, 194, 192, 191, 200, 194, 192, 220, 208, 198, 206, 196, 192, 189, 202, 195, 214, 217, 192, 208, 198, 192, 189, 202, 205, 207, 200, 191, 217, 192, 205, 209, 203, 208, 209, 40, 204, 209, 203, 191, 205, 208, 209, 192, 220, 205, 191, 200, 192, 195, 209, 214, 192, 209, 208, 209, 199, 198, 194, 196, 203, 198, 205, 199, 191, 205, 208, 209, 192, 196, 204, 212, 196, 191, 195, 209, 203, 194, 192, 195, 209, 206, 192, 195, 192, 191, 200, 194, 198, 195, 199, 194, 204, 191, 205, 203, 192, 213, 195, 193, 204, 194, 7, 192, 218, 200, 194, 192, 199, 208, 196, 205, 191, 205, 213, 194, 203, 193, 205, 209, 205, 203, 195, 193, 192, 198, 194, 196, 199, 208, 209, 196, 194, 196, 192, 191, 208, 192, 206, 198, 204, 207, 196, 192, 195, 198, 194, 192, 198, 195, 198, 194, 193, 214, 192, 38, 204, 195, 193, 205, 211, 205, 194, 206, 216, 192, 193, 194, 195, 206, 205, 209, 207, 192, 191, 208, 192, 195, 192, 212, 205, 195, 196, 194, 206, 192, 195, 209, 206, 192, 200, 205, 207, 200, 193, 214, 192, 206, 205, 196, 191, 208, 198, 191, 194, 206, 213, 205, 194, 220, 192, 208, 211, 192, 191, 200, 194, 192, 202, 194, 206, 205, 203, 195, 193, 192, 204, 209, 205, 213, 194, 198, 196, 194, 7, 219, 204, 191, 198, 205, 194, 209, 191, 196, 192, 195, 198, 194, 192, 208, 211, 191, 194, 209, 192, 205, 207, 209, 208, 198, 194, 206, 192, 194, 209, 191, 205, 198, 194, 193, 214, 192, 205, 209, 192, 202, 194, 206, 205, 203, 195, 193, 192, 196, 203, 200, 208, 208, 193, 192, 203, 208, 204, 198, 196, 194, 192, 202, 195, 191, 194, 198, 205, 195, 193, 196, 216, 192, 212, 204, 191, 192, 205, 211, 192, 191, 200, 194, 214, 192, 202, 204, 196, 191, 212, 194, 192, 203, 208, 213, 194, 198, 194, 206, 192, 191, 200, 194, 192, 199, 198, 208, 211, 194, 196, 196, 208, 198, 192, 220, 205, 193, 193, 192, 199, 69862, 195, 196, 194, 192, 196, 194, 209, 191, 194, 209, 203, 194, 196, 192, 191, 200, 195, 191, 192, 203, 198, 194, 195, 191, 194, 192, 206, 208, 204, 212, 191, 192, 205, 209, 192, 191, 200, 194, 192, 196, 191, 204, 206, 194, 209, 191, 9, 196, 192, 202, 205, 209, 206, 216, 196, 204, 203, 200, 192, 195, 196, 192, 189, 219, 198, 195, 207, 69862, 199, 197, 189, 197, 191, 197, 206, 193, 196, 193, 204, 210, 205, 193, 197, 193, 199, 204, 191, 195, 190, 193, 192, 198, 207, 192, 197, 204, 198, 194, 220, 210, 199, 205, 195, 198, 191, 199, 7, 217, 218, 200, 194, 214, 192, 203, 195, 196, 191, 192, 193, 205, 191, 191, 193, 194, 192, 206, 208, 204, 212, 191, 192, 195, 196, 192, 191, 208, 192, 191, 200, 194, 192, 199, 208, 196, 196, 205, 212, 193, 194, 192, 196, 205, 206, 194, 192, 194, 211, 211, 194, 203, 191, 196, 192, 208, 211, 192, 213, 205, 191, 195, 202, 205, 209, 196, 7, 216, 192, 196, 191, 195, 191, 205, 209, 207, 192, 191, 200, 195, 191, 192, 189, 219, 198, 195, 207, 69862, 199, 197, 189, 196 ]
0xBreath/holistic-books
withdrawal from a fast) ............................................. 363 13.7. How to prepare Bolotov’s whey (serum) .... 369 13.8. What are the potential complications during withdrawal from fasting? .......................................... 371 14. What’s the ideal scheme for conducting a dry fractional fast at home? .......................................... 379 15. How many kinds of dry fasting exist? ............ 384 15.1. Interesting facts: Secrets of Japanese monks ...................................................................................... 392 15.2. Interesting facts: Dry fasting and dousing with cold water ........................................................... 399 16. How should you conduct a long dry fast? ...... 401 17. Dry fractional fasting. Who do we recommend it to?............................................................................ 473 18. How to come out of a 9 -day dry fasting course? ................................................................................. 480 A nutritional program for coming out of a fast .. 495 19. What diseases can be cured through dry fasting? ................................................................................. 499 19.1. Dry fasting for acute diseases. ...................... 499 19.1.1. Fasting for acute infections (acute respiratory diseases, influenza) ........................... 502 19.1.2. Dry fasting for the relapse of gastric ulcer or duodenal ulcer, chronic pancreatitis, cholecystitis, colitis, etc. ....................................... 516 19.1.3. Dry fasting for diabetes ......................... 521 19.2. Dry Fasting for chronic diseases .................. 524 19.2.1. Dry Fasting for endointoxication and atherosclerosis............................................................ 529 19.2.2. Dry Fasting for hypertension .................... 532 19.2.3. Why dry fasting helps fight chronic diseases ...................................................................................... 539 19.2.4. Dry fasting for cystic tumors in the body 543 19.2.5. Dry Fasting for Infertility .......................... 546 19.2.6. Toxemia in Pregnant Women .................. 551 19.2.7. Endometriosis ............................................. 558 19.2.8. Dry Fasting for Benign Tumors ................ 561 19.2.9. Mastopathy .................................................. 566 19.2.10. Prostatitis and benign prostatic hyperplasia ...................................................................................... 568 19.2.11. Dry Fasting for Bronchopulmonary Diseases....................................................................... 573 19.2.12. Cardiovascular Diseases: Hypertension and Atherosclerosis ................................................... 591 19.2.13. Neurological diseases: degenerative disc disease, protrusions, disk herniation, migraine. ................................................................................. 600 19.2.14. Rheumatoid arthritis, ankylos ing spondylitis, deforming osteoarthrosis, infectious polyarthritis........................................................... 604 19.2.15. Can dry fasting treat AIDS and hepatitis C?............................................................................ 627 19.2.16. Dry Fasting against Cancer ................ 631 19.2.17. Dry Fasting against Skin Diseases ..... 637 19.2.18. Functional Nervous System Disorders ................................................................................. 649 19.2.19. Dry Fasting against Obesity ............... 652 20. How does doctor Filonov debunk myths about dry therapeutic fasting? .......................................... 679 Literature .............................................................. 722 Foreword by the curator of English and Italian edition Vera Giovanna Bani Between 29 June and 13 July 2019 I had the honor and the privilege of organizing the first dry fasting practice in Europe (Strunjan - Slove- nia), with Dr. Filonov and his team of masseurs: his daughters Olga Kulikova, Anastasiya An- tonova and nephew Andrey Cherkasskyj. We worked with a fantastic group of almost thirty people, all Italians except for one German girl, one French and one Swiss. The experience was wonderful, effective and constructive for every- one (see the p hoto dossier at the end of the book). But how did this project of disseminating dry fasting begin?... …In October 2016, I began to get interested in dry fasting without suspecting that this path Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] eventually propel me into an unexpected world. I disco vered that in the post -war Soviet Union, where pharmaceutical lobbies were en- tirely inexistent, and a strong spirit of innova- tion and scientific research prevailed, a medical - scientific approach entailing therapeutic fasting was formally consolidated. Drawing on a tradi- tion previously established in Russia, the mech- anisms of therapeutic fasting had been success- fully investigated and clinically tested on thou- sands of patients over the course of 60 years. This provided the scientific foundation that eventuall y made it possible for the Ministry of Health to approve its methodological indica- tions. Many Russian doctors had the oppor- tunity to cultivate this approach and even Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] a radical branch, as the dry fast could be defined. In November 2016, I worked to meet Dr. Fi- lonov, who is considered the top dry fasting ex- pert in Russia. I offered him to become the fore- runner of dry fasting in Italy and he gave me “carte blanche”. Thus, in March 2017, thanks to the invitation of the Italian University of Health heade d by Dr. Valdo Vaccaro, I had the oppor- tunity to introduce Dr. Filonov to the Italian au- dience. In the summer of 2017, I tested this fantastic method on myself at Dr. Filonov’s headquarters in Altai Republic (Ust -Sema, West Siberia) and finally in mid -December 2017 the monograph, Digiuno secco. Gli ultimi sviluppi della digiuno- terapia in Russia (Dry Fasting: the latest Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] in fasting in Russia), came to life. It’s the first non -Russian book about dry fasting! This 687 -page volume comprises the al most complete version of the first book by Dr Filonov, Suchoe lechebnoe golodanie. Mify i realnost (Dry medical fasting. Myths and reality) and selected chapters of his second book, Lechenie organizma sobstvennymi silami (Curing the body with its own strengths)1. 1 Our monograph in italian: Digiuno secco. Gli ultimi sviluppi della digiunoterapia in Russia (Dry fast: the latest developments in fasting in Russia), Macerata, edizioni Simple 2017, brings together the translation of the two writings of S. Filonov and is composed as fol- lows: - Suchoe lechebnoe golodanie. Mify i realnost - (Therapeutic dry fasting. Myths and reality), 2008. This book is reported here in an almost integral version, separated into the shorter chapters: Interesnye svedeniya o suchom golodanii (Interesting facts about Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] book was received with great interest in It- aly: its emergence attracted the attention of the community of complementary medicine sup- porters, and many bought it without hesitation, despite its weight and hefty price. Nonetheless, we’d like to emphasize, however, is that the subject of our work has had repercus- sions outside of a circle of enthusiasts of the al- ternative medicine scene: today, our website Si- berika.it receives continuous requests for dry fasting), Zenshchina, kotoraya ne est (The woman who does not eat ), Solntseedy (The sun -eaters) - Lechenie organizma sobstvennymi silami (Curing the body with its own strengths), 2015 - the chapters regarding the vetero - slavic massage Staroslaviyanskie metody lecheniya (Vetero - slavic treatment methods) have been omittedy Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] from ordinary people who are in
[ 63546, 278, 505, 264, 5043, 8, 220, 82472, 4095, 18575, 220, 18199, 2355, 1032, 13, 22, 13, 2650, 311, 10772, 25007, 354, 869, 753, 15240, 88, 320, 805, 372, 8, 220, 22666, 220, 19929, 2355, 1032, 13, 23, 13, 3639, 527, 279, 4754, 36505, 2391, 720, 63546, 278, 505, 54560, 30, 220, 82472, 4095, 497, 220, 18650, 2355, 975, 13, 3639, 753, 279, 10728, 13155, 369, 31474, 264, 9235, 720, 82190, 278, 5043, 520, 2162, 30, 220, 82472, 4095, 497, 220, 220, 19867, 720, 868, 13, 2650, 1690, 13124, 315, 9235, 54560, 3073, 30, 220, 46196, 1975, 220, 220, 12910, 720, 868, 13, 16, 13, 71770, 13363, 25, 53179, 315, 11002, 66477, 198, 82472, 8054, 497, 82472, 1975, 220, 19695, 220, 220, 868, 13, 17, 13, 71770, 13363, 25, 31941, 54560, 323, 294, 22485, 720, 4291, 9439, 3090, 220, 82472, 8054, 497, 22666, 18575, 220, 18572, 2355, 845, 13, 2650, 1288, 499, 6929, 264, 1317, 9235, 5043, 30, 220, 75208, 220, 10841, 720, 1114, 13, 31941, 69309, 54560, 13, 10699, 656, 584, 7079, 433, 720, 998, 30, 87172, 4095, 1975, 220, 220, 21505, 720, 972, 13, 2650, 311, 2586, 704, 315, 264, 220, 24, 482, 1316, 9235, 54560, 3388, 5380, 87172, 4095, 62073, 220, 220, 11738, 720, 32, 43226, 2068, 369, 5108, 704, 315, 264, 5043, 220, 5354, 220, 21038, 2355, 777, 13, 3639, 19338, 649, 387, 64688, 1555, 9235, 54560, 5380, 87172, 4095, 62073, 220, 220, 18162, 720, 777, 13, 16, 13, 31941, 54560, 369, 30883, 19338, 13, 220, 90014, 29249, 220, 18162, 2355, 777, 13, 16, 13, 16, 13, 435, 15067, 369, 30883, 30020, 320, 32590, 720, 417, 5682, 5382, 19338, 11, 62937, 8, 220, 220, 57341, 1131, 220, 17824, 2355, 777, 13, 16, 13, 17, 13, 31941, 54560, 369, 279, 1375, 7629, 315, 89385, 96971, 720, 269, 3930, 55836, 278, 96971, 11, 21249, 62268, 82801, 11, 720, 971, 35853, 599, 20000, 11, 1400, 20000, 11, 5099, 13, 220, 82472, 49711, 220, 20571, 2355, 777, 13, 16, 13, 18, 13, 31941, 54560, 369, 20335, 220, 90014, 62073, 220, 20767, 2355, 777, 13, 17, 13, 31941, 435, 15067, 369, 21249, 19338, 220, 90014, 497, 220, 21177, 220, 220, 777, 13, 17, 13, 16, 13, 31941, 435, 15067, 369, 842, 787, 5241, 20901, 323, 720, 1894, 437, 91711, 13, 82472, 4095, 497, 46196, 62073, 220, 21618, 2355, 777, 13, 17, 13, 17, 13, 31941, 435, 15067, 369, 63308, 220, 90014, 1975, 220, 20711, 2355, 777, 13, 17, 13, 18, 13, 8595, 9235, 54560, 8779, 4465, 21249, 19338, 198, 82472, 8054, 497, 82472, 1975, 220, 23033, 2355, 777, 13, 17, 13, 19, 13, 31941, 54560, 369, 63581, 292, 56071, 304, 279, 2547, 220, 220, 19642, 720, 777, 13, 17, 13, 20, 13, 31941, 435, 15067, 369, 15268, 62587, 220, 220, 57341, 497, 220, 22048, 2355, 777, 13, 17, 13, 21, 13, 2057, 87, 22689, 304, 60747, 519, 11215, 220, 90014, 497, 220, 21860, 2355, 777, 13, 17, 13, 22, 13, 4060, 4512, 462, 10934, 220, 82472, 4095, 18575, 220, 22895, 2355, 777, 13, 17, 13, 23, 13, 31941, 435, 15067, 369, 7505, 625, 350, 372, 1105, 220, 90014, 220, 20460, 2355, 777, 13, 17, 13, 24, 13, 37582, 54042, 220, 82472, 8054, 497, 220, 220, 23477, 720, 777, 13, 17, 13, 605, 13, 1322, 10079, 20000, 323, 65309, 463, 2020, 17508, 501, 36259, 198, 82472, 8054, 497, 82472, 1975, 220, 22049, 2355, 777, 13, 17, 13, 806, 13, 31941, 435, 15067, 369, 20407, 110459, 360, 55892, 720, 35, 1082, 2315, 82472, 8054, 90014, 49711, 220, 22529, 2355, 777, 13, 17, 13, 717, 13, 92976, 33945, 70674, 25, 39515, 531, 2711, 720, 438, 362, 91882, 91711, 220, 82472, 8054, 497, 662, 220, 24380, 220, 220, 777, 13, 17, 13, 1032, 13, 32359, 31356, 19338, 25, 5367, 75989, 2624, 720, 67, 56407, 11, 81458, 36807, 11, 13668, 72909, 7246, 11, 92981, 627, 82472, 8054, 497, 220, 57341, 49711, 220, 5067, 2355, 777, 13, 17, 13, 975, 13, 71636, 46313, 590, 55652, 11, 459, 8050, 2353, 6892, 720, 82, 3595, 4010, 20000, 11, 409, 55857, 52368, 78, 47601, 63412, 11, 50600, 720, 34535, 277, 40485, 82472, 62073, 90014, 497, 220, 20354, 2355, 777, 13, 17, 13, 868, 13, 3053, 9235, 54560, 4322, 46060, 323, 73975, 720, 34, 30, 82472, 4095, 62073, 220, 57341, 1131, 220, 23103, 2355, 777, 13, 17, 13, 845, 13, 31941, 435, 15067, 2403, 26211, 220, 90014, 220, 21729, 2355, 777, 13, 17, 13, 1114, 13, 31941, 435, 15067, 2403, 28049, 70674, 220, 68229, 220, 21788, 2355, 777, 13, 17, 13, 972, 13, 55550, 452, 651, 788, 744, 73133, 198, 82472, 8054, 497, 220, 57341, 49711, 220, 24734, 2355, 777, 13, 17, 13, 777, 13, 31941, 435, 15067, 2403, 95171, 220, 46196, 49711, 220, 23181, 2355, 508, 13, 2650, 1587, 10896, 16807, 263, 869, 78293, 51286, 922, 720, 54310, 37471, 54560, 30, 220, 82472, 4095, 497, 220, 220, 25136, 720, 87115, 1598, 220, 82472, 57341, 29249, 220, 220, 23024, 33006, 8371, 1178, 555, 279, 87805, 315, 6498, 323, 720, 70211, 14002, 68200, 61678, 12930, 426, 5676, 1084, 26556, 220, 1682, 5651, 323, 220, 1032, 5887, 220, 679, 24, 358, 1047, 279, 720, 71, 55137, 323, 279, 26632, 315, 35821, 279, 1176, 720, 54310, 54560, 6725, 304, 4606, 320, 2645, 359, 23685, 482, 26685, 588, 7058, 21557, 705, 449, 2999, 13, 16807, 263, 869, 323, 813, 2128, 315, 58617, 1759, 25, 720, 26301, 30968, 12225, 6885, 85606, 1609, 12949, 11, 94425, 10426, 7911, 1556, 7058, 783, 12949, 323, 63904, 1628, 8233, 921, 17172, 395, 8050, 73, 13, 1226, 720, 71214, 449, 264, 14964, 1912, 315, 4661, 27219, 720, 16455, 11, 682, 97333, 3734, 369, 832, 6063, 3828, 11, 720, 606, 8753, 323, 832, 30791, 13, 578, 3217, 574, 720, 86, 14518, 1285, 11, 7524, 323, 54584, 369, 1475, 7058, 606, 320, 4151, 279, 281, 305, 2117, 53576, 520, 279, 842, 315, 279, 720, 2239, 570, 220, 2030, 1268, 1550, 420, 2447, 315, 34000, 65383, 720, 54310, 54560, 3240, 30, 1131, 2355, 1981, 644, 6664, 220, 679, 21, 11, 358, 6137, 311, 636, 8173, 304, 720, 54310, 54560, 2085, 15562, 287, 430, 420, 1853, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 41450, 9778, 89483, 757, 1139, 459, 16907, 720, 14957, 13, 358, 54969, 2807, 291, 430, 304, 279, 1772, 482, 11710, 19953, 720, 33758, 11, 1405, 35410, 326, 41412, 1051, 665, 7058, 83, 556, 398, 55981, 18620, 11, 323, 264, 3831, 9090, 315, 9721, 64, 7058, 28491, 323, 12624, 3495, 85814, 11, 264, 6593, 18722, 85930, 5603, 1218, 14612, 37471, 54560, 720, 16514, 37402, 60391, 13, 38859, 389, 264, 124979, 7058, 28491, 8767, 9749, 304, 8524, 11, 279, 84596, 7058, 276, 13978, 315, 37471, 54560, 1047, 1027, 2450, 7058, 3725, 27313, 323, 70432, 12793, 389, 34223, 7058, 82, 2914, 315, 6978, 927, 279, 3388, 315, 220, 1399, 1667, 13, 720, 2028, 3984, 279, 12624, 16665, 430, 720, 3163, 84, 543, 379, 1903, 433, 3284, 369, 279, 20214, 315, 720, 14884, 311, 29251, 1202, 1749, 5848, 75780, 7058, 83, 919, 13, 9176, 8690, 16410, 1047, 279, 4083, 269, 7058, 83, 2498, 311, 67632, 420, 5603, 323, 1524, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 16219, 264, 18336, 9046, 11, 439, 279, 9235, 5043, 1436, 387, 720, 9910, 13, 2355, 644, 6841, 220, 679, 21, 11, 358, 6575, 311, 3449, 2999, 13, 40971, 7058, 12490, 869, 11, 889, 374, 6646, 279, 1948, 9235, 54560, 506, 7058, 77468, 304, 8524, 13, 358, 9076, 1461, 311, 3719, 279, 2291, 7058, 42836, 315, 9235, 54560, 304, 15704, 323, 568, 6688, 757, 720, 2118, 11707, 68, 1529, 29097, 11453, 14636, 11, 304, 5587, 220, 679, 22, 11, 9523, 311, 720, 1820, 29788, 315, 279, 15155, 3907, 315, 6401, 720, 383, 1037, 294, 555, 2999, 13, 4196, 3055, 59788, 17606, 11, 358, 1047, 279, 4083, 269, 7058, 83, 2498, 311, 19678, 2999, 13, 16807, 263, 869, 311, 279, 15155, 8065, 7058, 67, 1873, 13, 2355, 644, 279, 7474, 315, 220, 679, 22, 11, 358, 12793, 420, 14964, 720, 4492, 389, 7182, 520, 2999, 13, 16807, 263, 869, 753, 26097, 720, 258, 24610, 2192, 5545, 320, 52, 267, 482, 50, 9355, 11, 4410, 68600, 689, 8, 323, 720, 40276, 304, 5209, 482, 33246, 220, 679, 22, 279, 1647, 3257, 11, 720, 35, 30637, 16711, 513, 58761, 13, 480, 747, 8675, 25877, 13871, 321, 455, 2554, 15587, 4170, 72, 16711, 7058, 466, 80470, 304, 8524, 220, 320, 86315, 435, 15067, 25, 279, 5652, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 16219, 1392, 304, 54560, 304, 8524, 705, 3782, 311, 2324, 13, 2355, 2181, 753, 279, 1176, 2536, 482, 48807, 2363, 922, 9235, 54560, 0, 720, 2028, 220, 21897, 482, 2964, 8286, 41095, 279, 453, 1455, 720, 15079, 2373, 315, 279, 1176, 2363, 555, 2999, 16807, 263, 869, 11, 720, 37559, 971, 68, 514, 1557, 65, 2201, 68, 45549, 347, 19700, 13, 386, 1463, 602, 1972, 32557, 320, 86315, 720, 69216, 54560, 13, 3092, 17323, 323, 8903, 8, 323, 4183, 720, 331, 17881, 315, 813, 2132, 2363, 11, 2009, 7674, 648, 25286, 1764, 720, 101035, 267, 1055, 49221, 72, 5554, 10830, 220, 320, 34, 1711, 279, 2547, 449, 1202, 720, 785, 36486, 8, 16, 13, 2355, 720, 16, 5751, 1647, 3257, 304, 29048, 25, 423, 30637, 16711, 513, 58761, 13, 480, 747, 8675, 25877, 13871, 321, 455, 2554, 15587, 720, 67, 30637, 359, 26464, 80470, 304, 8524, 220, 320, 86315, 5043, 25, 279, 5652, 26006, 304, 54560, 720, 258, 8524, 705, 7553, 261, 460, 11, 1608, 79259, 9170, 220, 679, 22, 11, 12716, 3871, 279, 2355, 3129, 315, 279, 1403, 43422, 315, 328, 13, 16807, 263, 869, 323, 374, 24306, 439, 9630, 7058, 75, 4336, 25, 2355, 12, 17360, 971, 68, 514, 1557, 65, 2201, 68, 45549, 347, 19700, 13, 386, 1463, 602, 1972, 32557, 220, 482, 320, 1016, 261, 32486, 9235, 720, 9533, 287, 13, 220, 3092, 17323, 323, 8903, 705, 220, 1049, 23, 13, 1115, 2363, 374, 5068, 1618, 304, 720, 276, 4661, 26154, 2373, 11, 19180, 1139, 279, 24210, 30732, 25, 720, 3386, 288, 3919, 68, 274, 2111, 34229, 7911, 297, 1778, 316, 45549, 347, 276, 3893, 320, 85415, 13363, 922, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 791, 2363, 574, 4036, 449, 2294, 2802, 304, 1102, 7058, 5893, 25, 1202, 49179, 29123, 279, 6666, 315, 279, 720, 29502, 315, 58535, 16088, 1043, 7058, 403, 388, 11, 323, 1690, 11021, 433, 2085, 65437, 11, 720, 5919, 6100, 1202, 4785, 323, 65242, 3430, 13, 2355, 8284, 27163, 11, 584, 7070, 1093, 311, 47032, 11, 4869, 11, 720, 285, 430, 279, 3917, 315, 1057, 990, 706, 1047, 74488, 355, 7058, 82, 919, 4994, 315, 264, 12960, 315, 43448, 315, 279, 453, 7058, 4253, 1413, 16088, 6237, 25, 3432, 11, 1057, 3997, 12095, 7058, 655, 11755, 15965, 21879, 19815, 7540, 369, 33006, 54310, 54560, 705, 1901, 729, 71, 81236, 11, 597, 10088, 12874, 841, 1826, 220, 320, 791, 5333, 889, 1587, 720, 1962, 8343, 7026, 11730, 406, 325, 9497, 220, 320, 791, 7160, 482, 68, 11796, 8, 5996, 12, 2009, 7674, 648, 25286, 1764, 11752, 267, 1055, 49221, 72, 5554, 10830, 320, 34, 1711, 279, 2547, 449, 720, 1220, 1866, 36486, 705, 220, 679, 20, 482, 279, 30732, 9002, 279, 12854, 78, 18722, 3306, 89545, 6378, 7834, 48558, 6321, 88, 598, 31422, 2322, 1094, 514, 7674, 80574, 220, 320, 91177, 78, 18722, 3306, 89545, 6514, 5528, 8, 617, 1027, 40542, 88, 2355, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 13115, 2461, 505, 19664, 1274, 889, 527, 304 ]
0xBreath/holistic-books
my home. On more than one visit h e had proclaimed that his writing was for the public, that he wanted it to go to good use. He generously made the offer that I should r eprint his writing wherever I saw fit. This is one of those occasions. I have incorporated several short piece s of Terry’s writing into The 80/10/10 Diet. His comparative anatomy assessment of the natural diet for humans, whic h I have included in a somewhat revised form as Chapter 1, is the longest of them. Acknowledgments I wish to offer my gratitude to the many people who made this book possible. It is not possible to name them all, as so many folks played an important part in its creation. First, my special thanks go to the following people, each of whom worked with me a nd helped me to clarify my thoughts on the subject matter in this book: Gail Davis, Dave Klein, Ken Lyle, Laur ie Masters, Tim Trader, Laurie Clifford, Robert Sniadach, Bruce Brazis, David Rodenbucher, Catherine Galipeau, and John Pierre. Contributions came in many forms, from information to editing, from resea rch to relief. Some of you provided me with the necessary sounding board that I needed, others asked the questions that broug ht clarity to some aspect of this project or another. Some folks provided help simply by sharing the details of their program with m e, including the problems and solutions they had discovered along the way. I wish all of you could know how important your influe nce really was. For their behind-the-scenes contributions, I would like to especially th ank Dennis Nelson, David Taylor, Justin Lelia, Josh Steinhauser, Tom Cushwa, Gideon and Jackie Graff, Nancy Parlette, Todd Ew en, Dr. Deborah Wood, Charlie Mort, Craig Bishop, Coby Siegenthaler, Suzanne Slusser, and Shari Leiterman. I wish to thank John Robbins and Michael Greger for giving me their kind per mission to reprint some of their previously published work, and also Antonia Horne for allowing me the privilege of including excerpts from her late husband Ross Horne’s work. Many people simply pushed for me to put this body of work into print, as they wanted to s how it to their dear ones. Each of you contributed in your own special way, giving something that made it poss ible for me to get on with my work. For this I thank you. It means a great deal to me that you would think my work so valuable as to be wil ling to take the energy to prod me into writing this book. Those of you who actually gave up your precious time in order for me to move forw ard with this project provided invaluable support. Many people helped with the creation of the Frequently Asked Questions s ection, providing questions and, in many instances, appropriate responses. My appreciation goes to Randall Phelps, Janie Gardene r, and Jack Whitley for their help with editing the FAQs. Marr Nealon, your efforts to help me promote this cause were (and continue to be) stupendous, thank you. To my niece, Shyella Joy Mayk, thank you for all your fitness motivation, su pport, and your endless help with my website. And to Liati Natanya Mayk, her sister, thank you for keeping me intellect ually honest and helping me maintain my perspective through the relaxation of music. To Gail Davis, my publicist, thank you for the long nights of proofreading and y our continual input on how to illuminate this book and my business so that they would evolve into everything I knew they cou ld be. The hours just kept speeding by while I worked on The 80/10/10 Diet. I often lost track of time, and sometimes also lost track of commitments, appointments, meals, my personal needs for physical a ctivity, and even sleep. Fortunately, I am extremely blessed, in that I have a personal angel i n my life who makes it her full-time job to look after me. I wish to thank my beautiful wife Rozi, for her selfless and endless atte ntion while I worked on this book. Without her constant help and support, I would never have been able to have made time for this book. Even if I h ad been forced to try, I do not think I would have successfully or healthfully been able to complete it without he r. Thank you, Rozi, for paying attention to so many of life’s little and big details. I would have let them slip in pursuit of finishing this task. I can only hope that you feel as rewarded by me as I do by you, and as support ed. I am forever indebted to my loving parents, Marty and Bea, who have always t aught me how to be a successful adult by their shining example. My wish is that in raising my own child, Faychesca, I am able to employ the same parenting skills that they have shown me, with at least a modicum of their competence and grace. Special Thanks I would especially like to extend sincere appreciation to my editor, Laurie Masters of Precision Revision (www.GreenSongPress.org) and to Carina Honga, whose position is as varie d as all the tasks we have encountered. The time these wonderful women have devoted to researching, editing, and organizing thi s book amounts to years. Their dedication, writing skills, and teamwork have taken this book to a new level. Laurie, thank you for keeping me honest through your amazing research s kills and for distilling my writing down to what I was actually trying to say. Y our signature knack for “rototilling” a disj ointed manuscript and turning it into a coherent book has once again proven invaluable. I am forever grateful for your steadfast comm itment to me and to this project and for your tenacity in keeping its zillion details on track. Thank you in particular for your person al contributions to this book (notably Chapter 8 and Appendix D). I am convinced you are the best editor this side of the universe. Carina, adding you to our team was one of the best things I have ever done. Tha nk you for your tireless efforts to complete any and every thing that was asked of you with incredible speed and skill. Introduction Americans have been told for more than forty years that we are eating too much fat, yet our consumption of this nutrient has remained essentially unchanged during that time. 1 We have made no headway in eating less fat, despite massive educationa l programs, the carbohydrate-loading craze, leaner meats, low-fat fiber- filled cereals and bars, and low-fat desserts, dairy products, and entrées. We Are Fatter (and Sicker) Than Ever Meanwhile, as a nation, we have become the fattest people on Earth and are still getting fatter. Two-thirds of all Americans are overweight, half of them obese. Because obesity is so common, few of us realize that our current view of “normal” body fat levels has been skewed to allow for several dozen extra pounds. Sadly, mor bid obesity is rapidly moving up in the ranks of “causes of preventable death” statistics in our nation. Consider the followi ng: Nearly One-Third of the Calories in the U.S. Diet Come from Junk Food 2 by Sarah Yang, Media Relations | 01 June 2004 U. C. Berkeley News Gladys Block, professor of epidemiology and public health nutrition at the Uni versity of California, Berkeley, published a study in the June 2004 issue of the Journal of Food Composition and Analysis. The study reveals that three food groups—sweets and desserts, soft drin ks and alcoholic beverages—comprise almost 25 percent of all calories consumed by Americans. Salty snacks and fruit -flavored drinks make up another five percent, bringing the total energy contributed by nutrient-poor foods to at least 30 percent of the tot al calorie intake. “What is really alarming is the major contribution of ‘empty calor ies’ in the American diet,” said Block. “W e know people are eating a lot of junk food, but to have almost one-third of Americans’ cal ories coming from those categories is a shocker. It’s no wonder there’s an obesity epidemic in this country.” The standard American diet (SAD) is a sad testament to the rampant ph ysical and mental decay of the most prosperous nations on Earth. As our consumption of junk foods, animal products, chemical a dditives, toxic pesticides, and genetically modified organisms have increased, our health has plummeted. The numbers are s taggering: Obesity: In 2000, poor diet including obesity and physical inactivity caused more than 320,000 U.S. deaths and numbered among the top preventable causes of disease. 3 Obesity is the leading cause of all three of our top killers: heart disea se, cancer, and stroke. 4 Heart disease: Although the first recorded heart attack is said to have appeared in Brit ish medical literature just over a hundred years ago (1878), more than one in five Americans now suffers from some form of cardiovascular disease, and more than 2,500 Americans die from it each day. 5 In 2001, just under 700,000 Americans died of heart disease
[ 856, 2162, 13, 1952, 810, 1109, 832, 4034, 305, 384, 1047, 63011, 430, 813, 4477, 574, 369, 279, 586, 11, 720, 9210, 568, 4934, 433, 311, 733, 311, 1695, 1005, 13, 1283, 80220, 1903, 279, 3085, 430, 358, 1288, 436, 384, 1374, 813, 4477, 28578, 358, 5602, 5052, 13, 720, 2028, 374, 832, 315, 1884, 25975, 13, 358, 617, 32762, 3892, 2875, 6710, 274, 315, 32618, 753, 4477, 1139, 578, 220, 1490, 14, 605, 14, 605, 220, 27304, 662, 5414, 720, 884, 1768, 1413, 62690, 15813, 315, 279, 5933, 10173, 369, 12966, 11, 421, 292, 305, 358, 617, 5343, 304, 264, 14738, 32828, 1376, 439, 15957, 220, 16, 11, 374, 720, 1820, 22807, 315, 1124, 13, 33006, 2355, 91336, 27231, 33006, 40, 6562, 311, 3085, 856, 46135, 311, 279, 1690, 1274, 889, 1903, 420, 2363, 3284, 13, 1102, 374, 539, 220, 3284, 311, 836, 1124, 682, 11, 439, 779, 1690, 720, 8566, 2857, 6476, 459, 3062, 961, 304, 1202, 9886, 13, 720, 5451, 11, 856, 3361, 9523, 733, 311, 279, 2768, 1274, 11, 1855, 315, 8884, 6575, 449, 757, 264, 15953, 9087, 757, 311, 38263, 856, 11555, 389, 720, 1820, 3917, 5030, 304, 420, 2363, 25, 480, 607, 17200, 11, 20851, 43241, 11, 14594, 445, 982, 11, 54300, 30958, 34722, 11, 9538, 67531, 11, 80623, 86783, 11, 8563, 328, 7907, 329, 613, 11, 720, 79579, 73411, 285, 11, 6941, 13611, 268, 73143, 261, 11, 42663, 10845, 3527, 2933, 11, 323, 3842, 38077, 662, 720, 54084, 4065, 3782, 304, 1690, 7739, 11, 505, 2038, 311, 16039, 11, 505, 312, 37541, 436, 331, 311, 16337, 13, 4427, 315, 499, 3984, 757, 449, 279, 720, 95317, 49227, 4580, 430, 358, 4460, 11, 3885, 4691, 279, 4860, 430, 293, 583, 70, 35423, 32373, 311, 1063, 13189, 315, 420, 2447, 477, 2500, 13, 720, 8538, 15687, 3984, 1520, 5042, 555, 11821, 279, 3649, 315, 872, 2068, 449, 296, 384, 11, 2737, 279, 5435, 323, 10105, 814, 1047, 720, 4338, 21468, 3235, 279, 1648, 13, 358, 6562, 682, 315, 499, 1436, 1440, 1268, 3062, 701, 4704, 361, 308, 346, 2216, 574, 13, 720, 2520, 872, 4920, 10826, 80645, 19564, 11, 358, 1053, 1093, 311, 5423, 270, 71572, 35727, 27562, 11, 6941, 16844, 11, 23278, 445, 37029, 11, 18747, 720, 21573, 44338, 882, 11, 8529, 84759, 10196, 11, 480, 100242, 323, 51965, 40113, 544, 11, 35336, 4366, 10010, 11, 30534, 469, 86, 665, 11, 2999, 13, 70625, 12404, 11, 25972, 22806, 11, 29517, 720, 33, 20765, 11, 356, 28113, 8663, 16149, 12130, 261, 11, 85252, 6995, 355, 805, 11, 323, 1443, 2850, 2009, 2058, 1543, 13, 720, 40, 6562, 311, 9901, 3842, 88315, 323, 8096, 13842, 1414, 369, 7231, 757, 872, 3169, 824, 9131, 311, 81571, 1063, 315, 872, 8767, 720, 33966, 990, 11, 323, 1101, 17958, 689, 15083, 818, 369, 10923, 757, 279, 26632, 315, 220, 2737, 84490, 505, 1077, 3389, 10177, 21116, 15083, 818, 753, 720, 1816, 13, 720, 8607, 1274, 5042, 15753, 369, 757, 311, 2231, 420, 2547, 315, 990, 1139, 1194, 11, 439, 814, 4934, 311, 274, 1268, 433, 311, 872, 25237, 6305, 13, 9062, 315, 720, 9514, 20162, 304, 701, 1866, 3361, 1648, 11, 7231, 2555, 430, 1903, 433, 2278, 220, 1260, 369, 757, 311, 636, 389, 449, 856, 990, 13, 1789, 420, 358, 9901, 499, 13, 720, 2181, 3445, 264, 2294, 3568, 311, 757, 430, 499, 1053, 1781, 856, 990, 779, 15525, 439, 311, 387, 31331, 38172, 311, 1935, 279, 4907, 311, 14814, 757, 1139, 4477, 420, 720, 2239, 13, 13266, 315, 499, 889, 3604, 6688, 709, 701, 27498, 892, 304, 2015, 369, 757, 311, 3351, 369, 86, 85009, 449, 420, 2447, 3984, 56193, 720, 24249, 13, 720, 8607, 1274, 9087, 449, 279, 9886, 315, 279, 93720, 53763, 24271, 274, 384, 407, 11, 8405, 4860, 323, 11, 304, 1690, 13422, 11, 720, 29228, 14847, 13, 3092, 35996, 5900, 311, 68444, 98615, 11, 4448, 648, 23251, 1994, 436, 11, 323, 7762, 1254, 1017, 88, 369, 872, 1520, 449, 16039, 279, 720, 56032, 82, 13, 720, 44, 1138, 4275, 44711, 11, 701, 9045, 311, 1520, 757, 12192, 420, 5353, 1051, 320, 438, 3136, 220, 311, 387, 8, 91132, 408, 788, 11, 9901, 499, 13, 720, 1271, 856, 80115, 11, 1443, 88, 6985, 28237, 3297, 74, 11, 9901, 499, 369, 682, 701, 17479, 25835, 11, 924, 281, 403, 11, 323, 701, 26762, 1520, 449, 856, 3997, 13, 720, 3112, 311, 14851, 9491, 24772, 25041, 3297, 74, 11, 1077, 13219, 11, 9901, 499, 369, 10494, 757, 17108, 577, 750, 10978, 323, 10695, 757, 10519, 856, 13356, 720, 20322, 279, 43685, 315, 4731, 13, 720, 1271, 480, 607, 17200, 11, 856, 586, 380, 11, 9901, 499, 369, 279, 1317, 22178, 315, 11311, 6285, 323, 379, 1057, 77975, 1988, 389, 1268, 311, 88682, 420, 720, 2239, 323, 856, 2626, 779, 430, 814, 1053, 38680, 1139, 4395, 358, 7020, 814, 4020, 27221, 387, 13, 720, 791, 4207, 1120, 8774, 58675, 555, 1418, 358, 6575, 389, 578, 220, 1490, 14, 605, 14, 605, 220, 27304, 13, 358, 3629, 5675, 3839, 315, 892, 11, 323, 7170, 1101, 5675, 720, 13432, 315, 42356, 11, 37256, 11, 21644, 11, 856, 4443, 3966, 369, 7106, 264, 20864, 1968, 11, 323, 1524, 6212, 13, 720, 73055, 11, 358, 1097, 9193, 33944, 11, 304, 430, 358, 617, 264, 4443, 34426, 602, 308, 856, 2324, 889, 3727, 433, 1077, 2539, 7394, 2683, 311, 1427, 1306, 757, 13, 358, 720, 82199, 311, 9901, 856, 6366, 7555, 12093, 8510, 11, 369, 1077, 659, 1752, 323, 26762, 93381, 308, 28491, 1418, 358, 6575, 389, 420, 2363, 13, 17586, 1077, 6926, 1520, 720, 438, 1862, 11, 358, 1053, 2646, 617, 1027, 3025, 311, 617, 1903, 892, 369, 420, 2363, 13, 7570, 422, 358, 305, 1008, 1027, 9770, 311, 1456, 11, 358, 656, 539, 1781, 358, 1053, 720, 19553, 7946, 477, 2890, 3725, 1027, 3025, 311, 4686, 433, 2085, 568, 436, 13, 720, 13359, 499, 11, 12093, 8510, 11, 369, 12798, 6666, 311, 779, 1690, 315, 2324, 753, 2697, 323, 2466, 220, 3649, 13, 358, 1053, 617, 1095, 1124, 21818, 304, 33436, 315, 25270, 720, 576, 3465, 13, 358, 649, 1193, 3987, 430, 499, 2733, 439, 44937, 555, 757, 439, 358, 656, 555, 499, 11, 323, 439, 1862, 1608, 13, 720, 40, 1097, 16058, 93998, 311, 856, 21955, 6699, 11, 56254, 323, 61814, 11, 889, 617, 2744, 259, 264, 3948, 757, 1268, 311, 387, 264, 6992, 6822, 555, 872, 720, 939, 5859, 3187, 13, 3092, 6562, 374, 430, 304, 19054, 856, 1866, 1716, 11, 90405, 8696, 936, 1174, 358, 1097, 3025, 311, 3539, 279, 1890, 49058, 7512, 430, 814, 617, 720, 70463, 757, 11, 449, 520, 3325, 264, 1491, 86231, 315, 872, 58266, 323, 21507, 13, 720, 20989, 11361, 720, 40, 1053, 5423, 1093, 311, 13334, 49424, 35996, 311, 856, 6576, 11, 80623, 220, 34722, 315, 52459, 27893, 720, 7, 2185, 65110, 34139, 6010, 2726, 8, 323, 311, 3341, 2259, 19730, 64, 11, 6832, 2361, 374, 439, 767, 648, 294, 439, 682, 279, 9256, 584, 617, 23926, 13, 578, 892, 1521, 720, 86, 14518, 1285, 3278, 617, 29329, 311, 45243, 11, 16039, 11, 323, 35821, 62428, 274, 2363, 15055, 311, 1667, 13, 11205, 39955, 11, 4477, 7512, 11, 720, 438, 84633, 617, 4529, 420, 2363, 311, 264, 502, 2237, 13, 720, 43, 4202, 648, 11, 9901, 499, 369, 10494, 757, 10978, 1555, 701, 8056, 3495, 274, 29910, 323, 369, 1612, 9585, 856, 4477, 1523, 311, 1148, 358, 574, 720, 74128, 4560, 311, 2019, 662, 816, 1057, 12223, 94350, 369, 1054, 4744, 354, 9585, 863, 264, 834, 73, 297, 396, 291, 47913, 323, 13353, 433, 1139, 264, 56887, 2363, 706, 3131, 720, 33871, 17033, 56193, 13, 358, 1097, 16058, 26259, 369, 701, 85387, 1081, 433, 479, 311, 757, 323, 311, 420, 2447, 323, 369, 701, 5899, 4107, 304, 720, 33494, 1202, 1167, 15068, 3649, 389, 3839, 13, 9930, 499, 304, 4040, 369, 701, 1732, 453, 19564, 311, 420, 2363, 320, 1962, 2915, 15957, 220, 23, 323, 720, 24819, 953, 423, 570, 358, 1097, 22954, 499, 527, 279, 1888, 6576, 420, 3185, 315, 279, 15861, 662, 720, 9028, 2259, 11, 7999, 499, 311, 1057, 2128, 574, 832, 315, 279, 1888, 2574, 358, 617, 3596, 2884, 13, 666, 64, 80591, 499, 369, 701, 28387, 1752, 9045, 311, 4686, 720, 3852, 323, 1475, 3245, 430, 574, 4691, 315, 499, 449, 15400, 4732, 323, 10151, 13, 5996, 38255, 33006, 92786, 617, 1027, 3309, 369, 810, 1109, 36498, 1667, 430, 584, 527, 12459, 220, 2288, 1790, 8834, 11, 3686, 1057, 15652, 315, 420, 50123, 706, 720, 1864, 2692, 16168, 35957, 2391, 430, 892, 13, 220, 16, 1226, 617, 1903, 912, 2010, 3195, 304, 12459, 2753, 8834, 11, 8994, 11191, 6873, 64, 326, 720, 74053, 11, 279, 67732, 59786, 46141, 3059, 11, 16025, 261, 63875, 11, 3428, 64354, 24722, 12, 10409, 28091, 1147, 323, 16283, 11, 323, 3428, 64354, 72513, 11, 34479, 3956, 11, 720, 438, 11751, 14014, 13, 2355, 720, 1687, 8886, 435, 1683, 320, 438, 328, 5327, 8, 34776, 18374, 720, 26054, 11, 439, 264, 7140, 11, 584, 617, 3719, 279, 87309, 478, 1274, 389, 9420, 323, 527, 220, 2103, 3794, 282, 1683, 13, 9220, 45726, 315, 682, 9053, 720, 548, 50254, 11, 4376, 315, 1124, 50320, 13, 9393, 33048, 374, 779, 4279, 11, 2478, 315, 220, 603, 13383, 430, 1057, 1510, 1684, 315, 1054, 8416, 863, 2547, 8834, 720, 43664, 706, 1027, 87572, 311, 2187, 369, 3892, 21030, 5066, 16701, 13, 57243, 1174, 4411, 14435, 33048, 374, 19019, 7366, 709, 304, 279, 21467, 315, 1054, 936, 4881, 720, 1073, 5471, 481, 4648, 863, 13443, 304, 1057, 7140, 13, 21829, 279, 1833, 72, 7933, 25, 2355, 720, 64445, 3861, 12, 38075, 315, 279, 84037, 304, 279, 549, 815, 13, 27304, 720, 29951, 505, 67652, 12369, 220, 17, 198, 1729, 21077, 25482, 11, 7972, 32467, 765, 220, 1721, 5651, 220, 1049, 19, 720, 52, 13, 356, 13, 33108, 5513, 33006, 38, 18599, 1065, 8527, 11, 14561, 315, 62057, 2508, 323, 586, 2890, 26677, 520, 279, 49966, 5553, 488, 315, 7188, 11, 33108, 11, 4756, 264, 4007, 720, 258, 279, 5651, 220, 1049, 19, 4360, 315, 279, 10139, 315, 12369, 68206, 323, 18825, 13, 2355, 791, 4007, 21667, 430, 2380, 3691, 5315, 2345, 82, 26488, 323, 72513, 11, 8579, 1377, 258, 42382, 323, 56461, 47497, 2345, 884, 9868, 4661, 220, 914, 720, 25426, 315, 682, 25247, 27073, 555, 9053, 13, 8375, 1919, 43402, 323, 14098, 482, 1517, 76486, 21662, 1304, 709, 2500, 4330, 3346, 11, 12967, 279, 720, 5143, 4907, 20162, 555, 50123, 2320, 10922, 15657, 311, 520, 3325, 220, 966, 3346, 315, 279, 2458, 453, 52703, 23730, 13, 720, 44130, 374, 2216, 57376, 374, 279, 3682, 19035, 315, 3451, 3274, 86312, 220, 552, 529, 304, 279, 3778, 10173, 2476, 1071, 8527, 13, 1054, 54, 384, 1440, 1274, 527, 720, 91955, 264, 2763, 315, 30774, 3691, 11, 719, 311, 617, 4661, 832, 30277, 315, 9053, 529, 1652, 477, 552, 5108, 505, 1884, 11306, 374, 264, 10988, 261, 13, 1102, 753, 912, 720, 86, 14518, 1070, 753, 459, 33048, 42620, 304, 420, 3224, 662, 863, 49526, 791, 5410, 3778, 10173, 320, 50, 1846, 8, 374, 264, 12703, 61300, 311, 279, 63677, 1343, 32910, 950, 323, 10723, 31815, 315, 279, 1455, 71407, 720, 77, 811, 389, 9420, 13, 1666, 1057, 15652, 315, 30774, 15657, 11, 10065, 3956, 11, 11742, 264, 294, 18225, 1924, 11, 21503, 61257, 11, 323, 52033, 11041, 720, 76991, 617, 7319, 11, 1057, 2890, 706, 71278, 291, 13, 578, 5219, 527, 274, 4877, 1414, 287, 25, 33006, 4213, 28222, 25, 763, 220, 1049, 15, 11, 8009, 10173, 2737, 33048, 323, 7106, 304, 7323, 9057, 810, 1109, 220, 9588, 11, 931, 549, 662, 50, 13, 16779, 323, 49926, 720, 77405, 279, 1948, 5471, 481, 11384, 315, 8624, 13, 220, 18, 95171, 374, 279, 6522, 5353, 315, 682, 2380, 315, 1057, 1948, 61135, 25, 4851, 6759, 64, 513, 11, 9572, 11, 323, 720, 29341, 13, 220, 19, 27907, 46484, 8624, 25, 10541, 279, 1176, 12715, 4851, 3440, 374, 1071, 311, 617, 9922, 304, 5567, 374, 71, 6593, 17649, 1120, 927, 264, 720, 71, 7259, 1667, 4227, 320, 9674, 23, 705, 810, 1109, 832, 304, 4330, 9053, 1457, 47521, 505, 220, 1063, 1376, 315, 41713, 8624, 11, 323, 810, 1109, 720, 17, 11, 2636, 9053, 2815, 505, 433, 1855, 1938, 13, 220, 20, 763, 220, 1049, 16, 11, 1120, 1234, 220, 7007, 11, 931, 9053, 8636, 315, 4851, 8624 ]
0xBreath/holistic-books
were designed to secrete smallamounts of mucus for lubrication. The lungs eliminate used air and the tissues are lubricated with mucus-like secretions too. These secretions are types of eliminations, but are not intended for the elimination of toxins. When toxins aredischarged in mucus through tissues not designed to handle them, the tissuesthemselves become irritated, inflamed, weakened and thus much more subject tobacterial or viral infection. Despite this danger, not eliminating surplus toxinscarries with it the greater penalty of serious disability or death. So the body, in itswisdom, initially chooses secondary elimination routes as far from vital tissues andorgans as possible. Almost inevitably the skin or skin-like mucus membranes suchas the sinuses, or lung tissues become the first line of defense. Thus the average person’s disease history begins with colds, flu, sinusitis, bronchitis, chronic cough, asthma, rashes, acne, eczema, psoriasis. If thesesecondary eliminations are suppressed with drugs (either from the medical doctoror with over the counter remedies), if the eating or lifestyle habits that created thetoxemia are not changed, or if the toxic load increases beyond the limits of thistechnique, the body then begins to store toxins in fat or muscle tissues or the jointcavities, overburdens the kidneys, creates cysts, fibroids, and benign tumors tostore those toxins. If toxic overload continues over a longer time the body willeventually have to permit damages to vital tissues, and life-threatening conditionsdevelop. Hygienic doctors always stress that disease is remedial effort. Illness comes from the body’s best attempt to lighten its toxic load without immediatelythreatening its survival. The body always does the very best it can to remedytoxemia given its circumstances, and it should be commended for these effortsregardless of how uncomfortable they might be to the person inhabiting the body.Symptoms of secondary elimination are actually a positive thing because they arethe body’s efforts to lessen a dangerously toxic condition. Secondary eliminationsshouldn’t be treated immediately with a drug to suppress the process. If yousquelch the bodies best and least-life-threatening method to eliminate toxins, thebody will ultimately have to resort to another more dangerous though probablyless immediately uncomfortable channel. The conventional medical model does not view disease this way and sees the symptoms of secondary elimination as the disease itself. So the conventionaldoctor takes steps to halt the body’s remedial efforts, thus stopping theundesirable symptom and then, the symptom gone, proclaims the patient cured.Actually, the disease is the cure. A common pattern of symptom suppression under the contemporary medical model is this progression: treat colds with antihistamines until the body getsinfluenza; suppress a flu repeatedly with antibiotics and eventually you getpneumonia. Or, suppress eczema with cortisone ointment repeatedly, andeventually you develop kidney disease. Or, suppress asthma with bronkiodialatorsand eventually you need cortisone to suppress it. Continue treating asthma withsteroids and you destroy the adrenals; now the body has become allergic tovirtually everything. The presence of toxins in an organ of secondary elimination is frequently the cause of infection. Sinuses and lungs, inflamed by secondary eliminations, areattacked by viruses or bacteria; infectious diseases of the skin result from pushingtoxins out of the skin. More generalized infections also result from toxemia; in thiscase the immune system has become compromised and the body is overwhelmedby an organism that it normally should be able to resist easily. The wise cure ofinfections is not to use antibiotics to suppress the bacteria while simultaneouslywhipping the immune system; most people, including most medical doctors, donot realize that antibiotics also goose the immune system into super efforts. Butwhen one chooses to whip a tired horse, eventually the exhausted animalcollapses and cannot rise again no matter how vigorously it is beaten. The wisecure is to detoxify the body, a step that simultaneously eliminates secondaryeliminations and rebuilds the immune system. The wise way to deal with the body’s eliminative efforts is to accept that disease is an opportunity to pay the piper for past indiscretions. You should go tobed, rest, and drink nothing but water or dilute juice until the condition has passed. This allows the body to conserve its vital energy, direct this energy toward healing the disordered body part, and catch up on its waste disposal. Inthis way you can help your body, be in harmony with its efforts instead of workingagainst it which is what most people do. Please forgive another semi-political polemic here, but in my practice I have often been amazed to hear my clients complain that they have not the time nor theability to be patient with their body, to rest it through an illness because they havea job they can’t afford to miss or responsibilities they can’t put down. This is asad commentary on the supposed wealth and prosperity of the United States. Inour country most people are enslaved by their debts, incurred because they hadbeen enthralled by the illusion of happiness secured by the possession of materialthings. Debt slaves believe they cannot miss a week of work. People who feelthey can’t afford to be sick think they can afford to live on pills. So people pushthrough their symptoms by sheer grit for years on end, and keep that up until theirexhausted horse of a body breaks down totally and they find themselves in thehospital running up bills to the tune of several thousand dollars a day. But thesevery same people do not think they can afford the loss of a few hundred dollars ofcurrent income undertaking some virtually harmless preventative maintenance ontheir bodies. Given half a chance the body will throw off toxic overburdens and cleanse itself. And once the body has been cleansed of toxemia, disagreeable symptomsusually cease. This means that to make relatively mild but unwanted symptomslessen and ultimately stop it is merely necessary to temporarily cut back foodintake, eating only what does not cause toxemia. These foods I classify ascleansing, such as raw fruits and vegetables and their juices. If the symptoms areextreme, are perceived as overwhelming or are actually life-threatening,detoxification can be speeded up by dropping back to only dilute raw juices orvegetable broth made only from greens, without eating the solids. In the most extreme cases hygienists use their most powerful medicine: a long fast on herb teas, or just water. I will have a lot to say about fasting, later. When acutely ill, the most important thing to do is to just get out of the body’s way, and let it heal itself. In our ignorance we are usually our own worst enemy inthis regard. We have been very successfully conditioned to think that allsymptoms are bad. But I know from experience that people can and do learn anew way of viewing the body, an understanding that puts them at cause over theirown body. It allows you to be empowered in one more area of life instead ofbeing dependent and at the mercy of other peoples decisions about your body. Finally, and this is why natural medicine is doubly unpopular, to prevent the recurrence of toxemia and acute disease states, person must discover what theyare doing wrong and change their life. Often as not this means elimination of theperson’s favorite (indigestible) foods and/or (stress-producing) bad habits.Naturally, I will have a lot more to say about this later, too. Chapter Three Fasting From The Hygienic Dictionary Cure. [1] There is no “cure” for disease; fasting is not a cure. Fasting facilitates natural healing processes. Foods do not cure. Until we have discarded our faith in cures, there can be no intelligentapproach to the problems presented by suffering and no proper use of foods by those who are ill.Herbert Shelton, The Hygienic System, v. 3, Fasting and Sunbathing. [2] All cure starts from within out and from the head down and in reverse order as the symptoms have appeared. Hering”s Law ofCure. [3] Life is made up of crises. The individual establishes a standard of health peculiarly his own,which must vary from all other standards as greatly as his personality varies from others. Theindividual standard may be such as to favor the development of indigestion, catarrh, gout, rheumaticand glandular inflammations, tubercular developments, congestions, sluggish secretions and excretions,or inhibitions of various functions, both mental and physical, wherever the environmental or habitstrain is greater than usual. The standard of resistance may be opposed so strenuously by habits andunusual physical agencies—that the body breaks down under the strain. This is a crisis. Appetitefails, discomfort or pain forces rest, and, as a result of physiological rest (fasting) and physical rest(rest from daily work and habits), a readjustment takes place, and the patient is “cured.” This is whatthe profession and the people call a cure, and it is for the time being—until an unusual enervation isbrought on from accident or dissipation; then another crisis. These crises are the ordinary sickness ofall communities—all catalogued diseases. When the cold is gone or the hay-fever fully relieved, it doesnot mean the patient is cured. Indeed, he is as much diseased as before he suffered the attack—thecrisis—and he never will be cured until the habits of life that keep up toxin poisoning are corrected. Torecover from a crisis is not a cure; the tendency is back to the individual standard; hence all crises areself-limited, unless nature
[ 1051, 6319, 311, 513, 9537, 2678, 6173, 82, 315, 296, 38601, 369, 54494, 367, 13, 578, 45274, 22472, 1511, 3805, 323, 279, 39881, 527, 198, 104098, 2265, 660, 449, 296, 38601, 12970, 6367, 919, 2288, 13, 4314, 6367, 919, 527, 4595, 315, 198, 40895, 12922, 11, 719, 527, 539, 10825, 369, 279, 44032, 315, 62186, 13, 3277, 62186, 527, 4338, 38061, 304, 296, 38601, 1555, 39881, 539, 6319, 311, 3790, 1124, 11, 279, 259, 1056, 3121, 71, 12116, 4372, 3719, 84971, 11, 4704, 3690, 11, 58764, 323, 8617, 1790, 810, 3917, 25410, 71034, 477, 29962, 19405, 13, 18185, 420, 8137, 11, 539, 40599, 41548, 62186, 7063, 4108, 449, 433, 279, 7191, 16750, 315, 6129, 28353, 477, 4648, 13, 2100, 279, 2547, 11, 304, 1202, 49143, 5717, 11, 15453, 41011, 14580, 44032, 11543, 439, 3117, 505, 16595, 39881, 323, 1813, 598, 439, 3284, 13, 35403, 40605, 279, 6930, 477, 6930, 12970, 296, 38601, 79348, 1778, 300, 279, 7589, 4881, 11, 477, 21271, 39881, 3719, 279, 1176, 1584, 315, 9232, 627, 14636, 279, 5578, 1732, 753, 8624, 3925, 12302, 449, 9439, 82, 11, 20236, 11, 76914, 20000, 345, 68557, 331, 20000, 11, 21249, 40700, 11, 51643, 11, 436, 14380, 11, 46905, 11, 12208, 89, 9355, 11, 4831, 93003, 13, 1442, 279, 82, 2423, 1321, 661, 9961, 12922, 527, 56089, 449, 11217, 320, 50998, 505, 279, 6593, 10896, 269, 449, 927, 279, 5663, 51236, 705, 422, 279, 12459, 477, 19433, 26870, 430, 3549, 279, 998, 87, 22689, 527, 539, 5614, 11, 477, 422, 279, 21503, 2865, 12992, 7953, 279, 13693, 315, 270, 17194, 2174, 2428, 11, 279, 2547, 1243, 12302, 311, 3637, 62186, 304, 8834, 477, 16124, 39881, 477, 279, 10496, 66, 402, 1385, 11, 927, 11490, 53321, 279, 81960, 11, 11705, 63581, 82, 11, 16178, 41194, 11, 323, 65309, 56071, 311, 4412, 1884, 62186, 13, 1442, 21503, 43284, 9731, 927, 264, 5129, 892, 279, 2547, 289, 4618, 688, 1870, 617, 311, 11810, 26186, 311, 16595, 39881, 11, 323, 2324, 62999, 4787, 16219, 627, 31916, 88364, 292, 16410, 2744, 8631, 430, 8624, 374, 34630, 532, 5149, 13, 12799, 2136, 4131, 198, 1527, 279, 2547, 753, 1888, 4879, 311, 83608, 1202, 21503, 2865, 2085, 7214, 97229, 6147, 1202, 20237, 13, 578, 2547, 2744, 1587, 279, 1633, 1888, 433, 649, 311, 40239, 998, 87, 22689, 2728, 1202, 13463, 11, 323, 433, 1288, 387, 1081, 2954, 369, 1521, 9045, 1610, 30920, 315, 1268, 29213, 814, 2643, 387, 311, 279, 1732, 26318, 5977, 279, 2547, 815, 1631, 52273, 315, 14580, 44032, 527, 3604, 264, 6928, 3245, 1606, 814, 527, 1820, 2547, 753, 9045, 311, 76970, 264, 59594, 21503, 3044, 13, 44634, 44032, 26618, 619, 77, 1431, 387, 12020, 7214, 449, 264, 5623, 311, 28321, 279, 1920, 13, 1442, 499, 82, 43014, 331, 279, 13162, 1888, 323, 3325, 26928, 62999, 1749, 311, 22472, 62186, 11, 279, 2664, 690, 13967, 617, 311, 22541, 311, 2500, 810, 11660, 3582, 4762, 1752, 7214, 29213, 5613, 627, 791, 21349, 6593, 1646, 1587, 539, 1684, 8624, 420, 1648, 323, 16008, 279, 198, 24738, 52273, 315, 14580, 44032, 439, 279, 8624, 5196, 13, 2100, 279, 21349, 38083, 5097, 7504, 311, 27365, 279, 2547, 753, 34630, 532, 9045, 11, 8617, 23351, 279, 1263, 288, 26014, 49648, 323, 1243, 11, 279, 49648, 8208, 11, 463, 49661, 279, 8893, 64688, 14472, 1870, 11, 279, 8624, 374, 279, 27208, 627, 32, 4279, 5497, 315, 49648, 46735, 1234, 279, 19225, 6593, 198, 2590, 374, 420, 33824, 25, 4322, 9439, 82, 449, 3276, 7141, 380, 97081, 3156, 279, 2547, 5334, 258, 1517, 10529, 4458, 26, 28321, 264, 20236, 19352, 449, 46850, 323, 9778, 499, 636, 79, 126261, 21947, 13, 2582, 11, 28321, 12208, 89, 9355, 449, 23100, 285, 606, 297, 396, 479, 19352, 11, 323, 3163, 1870, 499, 2274, 39042, 8624, 13, 2582, 11, 28321, 51643, 449, 31071, 74, 3205, 532, 3046, 438, 9778, 499, 1205, 23100, 285, 606, 311, 28321, 433, 13, 15353, 27723, 51643, 449, 3751, 17390, 323, 499, 7066, 279, 1008, 1466, 1147, 26, 1457, 279, 2547, 706, 3719, 57596, 311, 48481, 1870, 4395, 627, 791, 9546, 315, 62186, 304, 459, 2942, 315, 14580, 44032, 374, 14134, 279, 198, 1593, 315, 19405, 13, 18098, 4881, 323, 45274, 11, 4704, 3690, 555, 14580, 9961, 12922, 11, 527, 1617, 11440, 555, 42068, 477, 24032, 26, 50600, 19338, 315, 279, 6930, 1121, 505, 17919, 998, 87, 1354, 704, 315, 279, 6930, 13, 4497, 67217, 30020, 1101, 1121, 505, 41569, 22689, 26, 304, 420, 5756, 279, 22852, 1887, 706, 3719, 44500, 323, 279, 2547, 374, 43206, 1729, 459, 47120, 430, 433, 14614, 1288, 387, 3025, 311, 22884, 6847, 13, 578, 24219, 27208, 315, 258, 25384, 374, 539, 311, 1005, 46850, 311, 28321, 279, 24032, 1418, 25291, 1336, 5772, 279, 22852, 1887, 26, 1455, 1274, 11, 2737, 1455, 6593, 16410, 11, 1541, 354, 13383, 430, 46850, 1101, 63237, 279, 22852, 1887, 1139, 2307, 9045, 13, 2030, 9493, 832, 41011, 311, 51176, 264, 19781, 15580, 11, 9778, 279, 39019, 10065, 17666, 79390, 323, 4250, 10205, 1578, 912, 5030, 1268, 77849, 433, 374, 31394, 13, 578, 19112, 77208, 374, 311, 61987, 1463, 279, 2547, 11, 264, 3094, 430, 25291, 60944, 14580, 40895, 12922, 323, 32593, 82, 279, 22852, 1887, 627, 791, 24219, 1648, 311, 3568, 449, 279, 2547, 753, 38416, 1413, 9045, 374, 311, 4287, 430, 198, 67, 56407, 374, 459, 6776, 311, 2343, 279, 281, 13154, 369, 3347, 83975, 4523, 919, 13, 1472, 1288, 733, 311, 2788, 11, 2800, 11, 323, 7172, 4400, 719, 3090, 477, 19371, 1088, 23661, 3156, 279, 3044, 706, 198, 36522, 13, 1115, 6276, 279, 2547, 311, 78548, 1202, 16595, 4907, 11, 2167, 420, 4907, 198, 83, 83071, 21730, 279, 834, 10767, 2547, 961, 11, 323, 2339, 709, 389, 1202, 12571, 34545, 13, 763, 576, 1648, 499, 649, 1520, 701, 2547, 11, 387, 304, 26348, 449, 1202, 9045, 4619, 315, 3318, 69849, 433, 902, 374, 1148, 1455, 1274, 656, 627, 5618, 44491, 2500, 18768, 55096, 32360, 26078, 21914, 1618, 11, 719, 304, 856, 6725, 358, 617, 198, 61917, 1027, 46304, 311, 6865, 856, 8403, 29011, 430, 814, 617, 539, 279, 892, 6463, 279, 2968, 311, 387, 8893, 449, 872, 2547, 11, 311, 2800, 433, 1555, 459, 17563, 1606, 814, 617, 64, 2683, 814, 649, 1431, 10150, 311, 3194, 477, 28423, 814, 649, 1431, 2231, 1523, 13, 1115, 374, 439, 329, 31710, 389, 279, 10171, 12205, 323, 44202, 315, 279, 3723, 4273, 13, 763, 414, 3224, 1455, 1274, 527, 95389, 555, 872, 45305, 11, 52872, 1606, 814, 1047, 82850, 65308, 3545, 839, 555, 279, 41919, 315, 23871, 27528, 555, 279, 19243, 315, 3769, 58174, 13, 58654, 32760, 4510, 814, 4250, 3194, 264, 2046, 315, 990, 13, 9029, 889, 2733, 20670, 649, 1431, 10150, 311, 387, 14363, 1781, 814, 649, 10150, 311, 3974, 389, 26153, 13, 2100, 1274, 4585, 20322, 872, 13803, 555, 33638, 42018, 369, 1667, 389, 842, 11, 323, 2567, 430, 709, 3156, 279, 556, 87, 15424, 291, 15580, 315, 264, 2547, 18808, 1523, 12756, 323, 814, 1505, 5694, 304, 279, 71127, 4401, 709, 19123, 311, 279, 26306, 315, 3892, 16579, 11441, 264, 1938, 13, 2030, 1521, 1225, 1890, 1274, 656, 539, 1781, 814, 649, 10150, 279, 4814, 315, 264, 2478, 7895, 11441, 315, 3311, 8070, 49326, 1063, 21907, 53997, 97420, 13709, 389, 50828, 13162, 627, 22818, 4376, 264, 6140, 279, 2547, 690, 2571, 1022, 21503, 927, 11490, 53321, 323, 81155, 198, 275, 726, 13, 1628, 3131, 279, 2547, 706, 1027, 35294, 291, 315, 41569, 22689, 11, 29395, 481, 13803, 44066, 32616, 13, 1115, 3445, 430, 311, 1304, 12309, 23900, 719, 36021, 13803, 1752, 268, 323, 13967, 3009, 433, 374, 16632, 5995, 311, 28191, 4018, 1203, 3691, 396, 731, 11, 12459, 1193, 1148, 1587, 539, 5353, 41569, 22689, 13, 4314, 15657, 358, 49229, 439, 9326, 598, 287, 11, 1778, 439, 7257, 26390, 323, 24822, 323, 872, 65959, 13, 1442, 279, 13803, 527, 428, 9831, 11, 527, 26617, 439, 22798, 477, 527, 3604, 2324, 62999, 12260, 295, 5241, 2461, 649, 387, 4732, 291, 709, 555, 26156, 1203, 311, 1193, 19371, 1088, 7257, 65959, 477, 83571, 481, 45993, 1903, 1193, 505, 52011, 11, 2085, 12459, 279, 82486, 13, 763, 279, 1455, 198, 428, 9831, 5157, 6409, 88364, 1705, 1005, 872, 1455, 8147, 16088, 25, 264, 1317, 5043, 389, 39999, 198, 668, 300, 11, 477, 1120, 3090, 13, 358, 690, 617, 264, 2763, 311, 2019, 922, 54560, 11, 3010, 627, 4599, 1645, 98466, 5986, 11, 279, 1455, 3062, 3245, 311, 656, 374, 311, 1120, 636, 704, 315, 279, 2547, 753, 198, 3195, 11, 323, 1095, 433, 27661, 5196, 13, 763, 1057, 41660, 584, 527, 6118, 1057, 1866, 12047, 9354, 304, 576, 5363, 13, 1226, 617, 1027, 1633, 7946, 66731, 311, 1781, 430, 682, 24738, 52273, 527, 3958, 13, 2030, 358, 1440, 505, 3217, 430, 1274, 649, 323, 656, 4048, 93392, 1648, 315, 20705, 279, 2547, 11, 459, 8830, 430, 9711, 1124, 520, 5353, 927, 279, 72, 4935, 2547, 13, 1102, 6276, 499, 311, 387, 62935, 304, 832, 810, 3158, 315, 2324, 4619, 315, 35214, 18222, 323, 520, 279, 39324, 315, 1023, 32538, 11429, 922, 701, 2547, 627, 24901, 11, 323, 420, 374, 3249, 5933, 16088, 374, 94989, 66858, 11, 311, 5471, 279, 198, 2827, 21201, 315, 41569, 22689, 323, 30883, 8624, 5415, 11, 1732, 2011, 7142, 1148, 814, 548, 3815, 5076, 323, 2349, 872, 2324, 13, 36016, 439, 539, 420, 3445, 44032, 315, 279, 9164, 753, 7075, 320, 485, 15505, 1260, 8, 15657, 323, 5255, 320, 95290, 90375, 8, 3958, 26870, 2112, 72247, 11, 358, 690, 617, 264, 2763, 810, 311, 2019, 922, 420, 3010, 11, 2288, 627, 26072, 14853, 198, 37, 15067, 198, 3915, 578, 10320, 88364, 292, 10685, 198, 34, 554, 13, 220, 510, 16, 60, 2684, 374, 912, 1054, 66, 554, 863, 369, 8624, 26, 54560, 374, 539, 264, 27208, 13, 435, 15067, 73633, 5933, 21730, 198, 4734, 288, 13, 40160, 656, 539, 27208, 13, 30070, 584, 617, 44310, 1057, 10082, 304, 272, 1439, 11, 1070, 649, 387, 912, 25530, 16082, 613, 311, 279, 5435, 10666, 555, 16066, 323, 912, 6300, 1005, 315, 15657, 555, 1884, 889, 527, 5986, 3924, 261, 9339, 37940, 783, 11, 578, 10320, 88364, 292, 744, 11, 348, 13, 220, 18, 11, 435, 15067, 323, 8219, 65, 44661, 13, 220, 510, 17, 60, 2052, 27208, 8638, 505, 2949, 198, 412, 323, 505, 279, 2010, 1523, 323, 304, 10134, 2015, 439, 279, 13803, 617, 9922, 13, 473, 4776, 863, 82, 7658, 315, 34, 554, 13, 510, 18, 60, 9601, 374, 1903, 709, 315, 58187, 13, 578, 3927, 64664, 264, 5410, 315, 2890, 44797, 398, 813, 1866, 11, 8370, 2011, 13592, 505, 682, 1023, 10886, 439, 19407, 439, 813, 17743, 35327, 505, 3885, 13, 578, 55977, 5410, 1253, 387, 1778, 439, 311, 4799, 279, 4500, 315, 1280, 15505, 290, 11, 8415, 1138, 71, 11, 342, 412, 11, 68132, 33030, 438, 67169, 1299, 26288, 811, 11, 15286, 3035, 1299, 26006, 11, 44385, 919, 11, 88046, 6367, 919, 323, 506, 4523, 919, 11, 269, 20747, 6055, 315, 5370, 5865, 11, 2225, 10723, 323, 7106, 11, 28578, 279, 12434, 477, 14464, 78726, 374, 7191, 1109, 13783, 13, 578, 5410, 315, 13957, 1253, 387, 16475, 779, 93319, 66735, 555, 26870, 323, 359, 81324, 7106, 13607, 41128, 279, 2547, 18808, 1523, 1234, 279, 26800, 13, 1115, 374, 264, 11501, 13, 93379, 635, 60731, 11, 44776, 477, 6784, 8603, 2800, 11, 323, 11, 439, 264, 1121, 315, 53194, 2800, 320, 9533, 287, 8, 323, 7106, 2800, 63136, 505, 7446, 990, 323, 26870, 705, 264, 1373, 4345, 479, 5097, 2035, 11, 323, 279, 8893, 374, 1054, 66, 3149, 2029, 1115, 374, 1148, 1820, 4913, 323, 279, 1274, 1650, 264, 27208, 11, 323, 433, 374, 369, 279, 892, 1694, 2345, 39830, 459, 19018, 665, 8943, 374, 65, 6478, 389, 505, 11677, 477, 14091, 49686, 26, 1243, 2500, 11501, 13, 4314, 58187, 527, 279, 19664, 54950, 315, 543, 10977, 87247, 16808, 3340, 19338, 13, 3277, 279, 9439, 374, 8208, 477, 279, 18137, 34303, 424, 7373, 51512, 11, 433, 1587, 1962, 3152, 279, 8893, 374, 64688, 13, 23150, 11, 568, 374, 439, 1790, 6759, 1503, 439, 1603, 568, 16654, 279, 3440, 2345, 339, 762, 6091, 285, 17223, 568, 2646, 690, 387, 64688, 3156, 279, 26870, 315, 2324, 430, 2567, 709, 98534, 52236, 527, 37065, 13, 350, 461, 3773, 505, 264, 11501, 374, 539, 264, 27208, 26, 279, 31954, 374, 1203, 311, 279, 3927, 5410, 26, 16472, 682, 58187, 264, 417, 491, 2922, 32611, 11, 7389, 7138 ]
0xBreath/holistic-books
w hen I c ame up w it h m y V it alit y C apsules. T his w as not t he end of m y jour ne y. It w as a ne w beg inning. I ha v e been c oac hing c lient s on ho w t o suc c essf ul l y heal natur al l y sinc e 1985.<|eot_id|><|begin_of_text|>B y t his time, I had g ained enoug h c r edi bi lit y and k no w ledg e in m y f ield t o w r it e an a w ar d - w inning book tit led D o Y ou H a v e T he G ut s T o B e B eautif ul?<|eot_id|><|begin_of_text|>I also aut hor ed a ser ies of CD s on natur al healing. S ome of m y v ie w s ha v e r uffled a lot of f eat her s, but t he y r emain inf or mati v e, and lif e-c hang ing f or man y of m y list ener s. O n t op of t hat, I ha v e w r itt en se v er al lif e-c hang ing r eport s t hat inc lude r esear c h on c r itic al t opics suc h as phar mac eutic al lif e c y c les.A b o u t t h e A u t h or Dr. J e nnif e r D ani e ls0 3 T hank Y ou F or D o w nloading O ur F REE C andid a C leaner R eport, W e ar e so happ y t o help guide y ou along t he f ir st st ep of y our natur al healing jour ne y.<|eot_id|><|begin_of_text|>T his is t he end of y our hopelessness. Y ou ar e no long er a pr isoner t o C andid a.<|eot_id|><|begin_of_text|>R ead t his, and c elebr at e. If y ou ar e t he t y pic al r eader, y ou ha v e tr ied man y appr oac hes and spent t housands of dol l ar s w it h modest r esult s, if an y.<|eot_id|><|begin_of_text|>T his is al l going t o c hange.In tr odu cti o n0 4 C andid a pl agues man y A mer ic ans f or y ear s on end, and t her e ha v e been man y supplement s pr oposed t o tr eat it, as w el l as man y diet s. T his P DF t el ls t he st or y of ho w I disc o v er ed somet hing t hat helped m y patient s c onquer C andid a quic k l y. C andid a w as not al w a y s as pr e v alent as it is in moder n times.C andid a c an be an y w her e in t he bod y, but onc e t her e ar e s y mpt oms, it is al w a y s in t he int estines. C ommand C entr al, or t he point f r om w hic h t he d amag e is done, is t he smal l int estines. Y our bod y c omplet es t he dig estion pr oc ess in t he smal l int estines, and t his is w her e nutr ient s ar e absor bed. T he C andid a spr eads it self ac r oss t he sur f ac e of t he smal l int estines and int er c ept s t he nutr ient s f or it s o w n use.M an y nutr ient s t hat ar e not absor bed b y t he C andid a r emain una v ai l able t o y our bod y due t o t he bar r ier t hat t he l a y er of C andid a c r eat es. T his c auses f atigue, as y our bod y e x pends al l t he ener g y of dig estion and g et s none of t he benef it. S impl y g oing on a r estr ic ti v e diet mak es t his bar r ier t hinner, but it is sti l l a bar r ier. F urt her mor e, C andid a c an also c onf igur e it self int o a bal l. T he C andid a at t he c or e of t his bal l c an be dor mant and per sist, despit e y our eff ort s at diet ar y r estr ic tions. C andid a c an also assume t he f or m of spor es t hat c an g o long per iods w it hout nutr ition, onl y t o c r eat e miser y just w hen y ou t houg ht y ou g ot r id of t hem.C andid a is able t o pr oduc e c hemic als t hat mimic c r a v ing s and de v ast at e y our eff ort s t o heal. F or t hese r easons, C andid a is li k e a c ur se. O nc e it is est ablished, it t ak es o v er. M ost int er v entions do not addr ess t he C andid a's def ense mec hanisms. T he Mir ac le C andid a C leaner tr ic k s C andid a int o letting do w n it s def enses so y our eff ort s c an pr o v ide t he r esult s y ou desir e. T his C andid a solution ma y v er y w el l be t he most po w er f ul and v er sati le natur al healing subst anc e in t he hist or y of our c ountr y. T his is a subst anc e t hat w as used w idel y in t he l at e 1800s, and no w, in t he 21st c entur y, t her e is pr ac tic al l y no w r itt en inf or mation on it. T he pur pose of t his doc ument is t o pr o v ide inf or mation and shar e m y e x per ienc e w it h y ou. T his doc ument blo w s t he lid off t he C andid a epidemic0 1 0 2 0 3 0 4 W h y Mo st T e r ap i e s F ail 0 5 I w i l l shar e some of t heir st or ies w it h y ou. O nc e I est ablished m y medic al pr ac tic e, I beg an t o help people g et bett er using diet, v it amins, enemas, or g anic f ood, disti l led w at er, and a long list of w hat is no w k no w n as lif est y le c hang es.<|eot_id|><|begin_of_text|>M y patient s w er e g etting bett er, but I notic ed t hat w hene v er t he y had a litt le misst ep in t heir lif est y le c hang es, t he y w ould ha v e a se v er e fl ar e-up of t heir s y mpt oms. I f elt t her e had t o be somet hing I c ould do t o pr e v ent fl ar e-ups and ha v e healing r esult s t hat w er e mor e dur able.<|eot_id|><|begin_of_text|>A t t he same time, I w as homesc hooling m y c hi ldr en and so I w as r eading v ar ious hist or ic ac c ount s, just b y w a y of helping t hem under st and t heir studies. I c ame ac r oss somet hing int er esting w hi le w e w er e stud y ing t he 1800’ s, w hen it w as mentioned t hat f ar mer s in t he U nit ed S t at es g a v e somet hing t o t heir f ami lies t w ic e a y ear. T his m y st er y subst anc e c ur ed e v er y t hing and k ept t heir f ami lies healt h y.<|eot_id|><|begin_of_text|>It immedi at el y oc c ur r ed t o me t hat t his m y st er y subst anc e c ould
[ 289, 48916, 358, 272, 1097, 68, 709, 289, 433, 305, 296, 379, 650, 433, 453, 275, 379, 356, 1469, 82, 2482, 16853, 51, 813, 289, 439, 720, 1962, 259, 568, 842, 315, 296, 379, 9880, 841, 379, 662, 1102, 289, 439, 264, 841, 289, 2197, 46386, 13, 358, 6520, 348, 384, 1027, 272, 297, 582, 305, 287, 198, 66, 908, 306, 274, 389, 720, 6292, 289, 259, 297, 11405, 272, 4043, 69, 8725, 326, 379, 27661, 14818, 453, 326, 379, 27336, 384, 220, 3753, 20, 662, 128009, 128000, 33, 379, 259, 813, 892, 11, 358, 1047, 342, 264, 1619, 665, 49404, 305, 272, 436, 76192, 6160, 13318, 379, 323, 597, 912, 289, 6197, 70, 384, 304, 296, 379, 282, 602, 789, 259, 297, 289, 436, 433, 384, 459, 198, 64, 289, 802, 294, 482, 289, 46386, 2363, 8305, 6197, 423, 297, 816, 6033, 473, 264, 348, 384, 350, 568, 480, 8791, 274, 350, 297, 426, 384, 426, 384, 2784, 333, 8725, 30, 128009, 128000, 40, 1101, 3154, 4917, 1608, 264, 1446, 220, 552, 315, 11325, 274, 389, 14818, 453, 21730, 13, 328, 297, 2727, 315, 296, 379, 348, 30958, 289, 274, 6520, 348, 384, 436, 577, 544, 839, 264, 720, 9363, 198, 1073, 282, 8343, 1077, 274, 1174, 719, 259, 568, 379, 436, 991, 467, 4225, 477, 5634, 72, 348, 384, 11, 323, 10345, 384, 1824, 15020, 6892, 282, 477, 893, 379, 315, 296, 379, 720, 1638, 38556, 274, 16853, 46, 308, 259, 1200, 315, 259, 9072, 11, 358, 6520, 348, 384, 289, 436, 433, 83, 665, 513, 348, 2781, 453, 10345, 384, 1824, 15020, 6892, 436, 384, 403, 274, 259, 9072, 3709, 326, 799, 720, 81, 1560, 686, 272, 305, 389, 198, 66, 436, 433, 292, 453, 259, 1200, 1233, 11405, 305, 439, 1343, 277, 9155, 384, 332, 292, 453, 10345, 384, 272, 379, 272, 3625, 662, 32, 293, 297, 577, 259, 259, 305, 384, 362, 577, 259, 305, 477, 198, 9023, 662, 622, 384, 11120, 333, 384, 436, 220, 423, 53088, 384, 20170, 15, 220, 18, 198, 51, 305, 1201, 816, 6033, 435, 477, 423, 297, 289, 308, 10853, 507, 4433, 435, 3680, 36, 356, 323, 307, 264, 356, 16025, 261, 198, 49, 384, 403, 345, 54, 384, 802, 384, 779, 2306, 379, 259, 297, 1520, 8641, 379, 6033, 3235, 259, 568, 282, 6348, 357, 198, 267, 4248, 315, 379, 1057, 14818, 453, 21730, 720, 30362, 841, 379, 662, 128009, 128000, 51, 813, 374, 259, 568, 842, 315, 379, 1057, 3987, 33028, 16853, 56, 6033, 802, 384, 912, 1317, 2781, 264, 550, 374, 27674, 259, 297, 356, 323, 307, 264, 662, 128009, 128000, 49, 384, 329, 259, 813, 1174, 323, 272, 10732, 1347, 520, 384, 13, 1442, 379, 6033, 802, 384, 259, 568, 259, 379, 10532, 453, 436, 384, 1013, 13801, 88, 6033, 6520, 348, 384, 490, 602, 291, 893, 379, 720, 391, 652, 297, 582, 20365, 323, 7543, 259, 7851, 2914, 198, 1073, 21968, 326, 802, 274, 289, 433, 305, 27946, 436, 1560, 495, 274, 1174, 422, 459, 379, 662, 128009, 128000, 51, 813, 374, 453, 326, 2133, 259, 297, 272, 305, 853, 5450, 490, 297, 1072, 272, 10462, 297, 308, 15, 220, 19, 198, 34, 323, 307, 264, 628, 945, 1157, 720, 1543, 379, 362, 4809, 18385, 8261, 282, 477, 720, 88, 2487, 274, 389, 842, 11, 323, 720, 83, 1077, 384, 6520, 348, 384, 1027, 720, 1543, 379, 198, 13066, 2833, 274, 720, 652, 297, 3950, 259, 297, 490, 8343, 433, 11, 720, 300, 289, 658, 326, 439, 893, 379, 720, 94942, 274, 662, 350, 813, 393, 44476, 259, 658, 20170, 720, 83, 568, 357, 477, 379, 315, 11640, 289, 358, 198, 17242, 297, 348, 2781, 1608, 720, 82, 4512, 305, 287, 259, 9072, 720, 8823, 291, 296, 379, 8893, 274, 720, 66, 389, 16339, 356, 323, 307, 264, 720, 447, 292, 597, 326, 379, 16853, 34, 323, 307, 264, 289, 439, 720, 1962, 453, 289, 264, 379, 274, 439, 720, 652, 384, 348, 453, 306, 439, 433, 374, 304, 720, 2658, 261, 308, 3115, 662, 34, 323, 307, 264, 272, 459, 387, 720, 276, 379, 289, 1077, 384, 304, 259, 568, 720, 65, 347, 379, 1174, 719, 78970, 384, 259, 1077, 384, 720, 277, 384, 274, 379, 296, 418, 297, 1026, 1174, 433, 374, 720, 278, 289, 264, 379, 274, 304, 259, 568, 198, 396, 1826, 1572, 662, 720, 34, 8019, 1969, 356, 11751, 453, 11, 720, 269, 259, 568, 1486, 282, 436, 8019, 720, 86, 79007, 305, 259, 568, 294, 1097, 351, 384, 374, 720, 10655, 11, 374, 259, 568, 1554, 278, 326, 198, 396, 1826, 1572, 662, 816, 1057, 30111, 379, 720, 66, 8019, 11053, 1560, 259, 568, 720, 45961, 1826, 290, 550, 18274, 4043, 304, 720, 83, 568, 1554, 278, 326, 528, 1826, 1572, 1174, 720, 438, 259, 813, 198, 285, 289, 1077, 384, 720, 24217, 81, 602, 306, 274, 802, 384, 720, 3518, 269, 4950, 13, 350, 568, 720, 34, 323, 307, 264, 8314, 384, 7819, 720, 275, 659, 1645, 436, 31159, 259, 568, 720, 20370, 282, 1645, 384, 315, 259, 568, 198, 3647, 278, 326, 720, 396, 1826, 1572, 323, 720, 396, 2781, 272, 384, 418, 274, 259, 568, 720, 24217, 81, 602, 306, 274, 282, 477, 433, 274, 297, 289, 308, 720, 817, 1345, 459, 379, 10184, 81, 602, 306, 274, 259, 9072, 720, 277, 384, 539, 15938, 4950, 293, 379, 720, 83, 568, 356, 323, 307, 264, 436, 991, 467, 720, 8733, 348, 16796, 326, 3025, 259, 297, 379, 1057, 720, 65, 347, 379, 198, 24567, 259, 297, 259, 568, 720, 2308, 436, 602, 261, 259, 9072, 259, 568, 326, 264, 379, 2781, 720, 1073, 356, 323, 307, 264, 272, 436, 8343, 1560, 662, 720, 51, 813, 272, 264, 4881, 282, 520, 22711, 11, 720, 300, 379, 1057, 30111, 379, 198, 68, 865, 281, 1438, 453, 326, 259, 568, 720, 804, 342, 379, 315, 4170, 1826, 290, 720, 438, 342, 1880, 274, 7000, 315, 259, 568, 720, 68244, 433, 13, 328, 11866, 379, 720, 70, 297, 287, 389, 264, 198, 81, 30607, 18385, 9165, 348, 384, 720, 94942, 52016, 1560, 259, 813, 720, 2308, 436, 602, 261, 259, 305, 4481, 1174, 719, 720, 275, 374, 357, 72, 326, 326, 264, 3703, 436, 602, 261, 662, 720, 37, 4433, 83, 1077, 4411, 384, 11, 720, 34, 323, 307, 264, 198, 66, 459, 1101, 720, 66, 389, 69, 19935, 324, 384, 433, 659, 528, 297, 720, 64, 9839, 326, 13, 350, 568, 356, 323, 307, 264, 520, 720, 83, 568, 272, 477, 384, 315, 259, 813, 9839, 326, 720, 66, 459, 387, 53403, 26976, 198, 438, 720, 716, 21566, 11, 951, 33686, 384, 379, 1057, 720, 6581, 64609, 274, 520, 10173, 802, 379, 720, 81, 30607, 18385, 259, 919, 662, 356, 323, 307, 264, 720, 66, 459, 1101, 9855, 259, 568, 198, 69, 477, 296, 315, 62016, 1560, 259, 9072, 720, 66, 459, 342, 297, 1317, 824, 602, 30797, 720, 86, 433, 305, 412, 10184, 81, 433, 290, 1174, 720, 263, 75, 379, 259, 297, 272, 436, 8343, 384, 98310, 379, 720, 4345, 198, 86, 48916, 379, 6033, 720, 83, 305, 49404, 35423, 379, 6033, 342, 14479, 436, 887, 720, 1073, 259, 17728, 662, 34, 323, 307, 264, 374, 3025, 259, 297, 720, 652, 297, 7697, 384, 272, 305, 8274, 10942, 720, 83, 9072, 56459, 272, 436, 264, 348, 6892, 274, 720, 438, 409, 348, 12025, 520, 384, 379, 1057, 720, 6581, 64609, 274, 259, 297, 198, 383, 278, 13, 435, 477, 720, 83, 305, 2423, 436, 384, 99949, 1174, 720, 34, 323, 307, 264, 374, 908, 597, 384, 264, 272, 4433, 513, 13, 720, 46, 26183, 384, 433, 374, 1826, 671, 1706, 291, 11, 720, 275, 259, 17774, 1560, 297, 348, 2781, 662, 386, 37996, 198, 396, 2781, 348, 1218, 919, 656, 539, 720, 6346, 4043, 259, 568, 356, 323, 307, 264, 364, 274, 720, 755, 68061, 75878, 19538, 13978, 16853, 51, 568, 14603, 1645, 514, 356, 323, 307, 264, 720, 34, 16025, 261, 490, 18385, 597, 274, 356, 323, 307, 264, 720, 396, 297, 20806, 656, 289, 308, 433, 274, 720, 755, 4675, 288, 779, 379, 1057, 198, 6581, 64609, 274, 272, 459, 550, 297, 348, 2679, 259, 568, 720, 81, 1560, 495, 274, 379, 6033, 951, 404, 384, 13, 350, 813, 720, 34, 323, 307, 264, 6425, 7643, 379, 720, 85, 2781, 379, 289, 658, 326, 387, 259, 568, 198, 3646, 720, 5481, 289, 2781, 282, 8725, 323, 348, 2781, 7731, 72, 514, 720, 77, 2693, 453, 21730, 720, 53902, 46845, 384, 304, 259, 568, 720, 21843, 477, 379, 315, 1057, 272, 220, 1656, 376, 379, 662, 720, 51, 813, 198, 285, 264, 38415, 46845, 384, 720, 83, 9072, 289, 439, 1511, 289, 887, 301, 379, 720, 258, 259, 568, 326, 520, 384, 220, 5245, 15, 82, 1174, 323, 720, 2201, 289, 1174, 304, 259, 568, 220, 1691, 267, 720, 66, 1218, 324, 379, 1174, 259, 1077, 384, 198, 285, 720, 652, 1645, 62547, 453, 326, 379, 912, 289, 436, 433, 83, 665, 720, 13885, 477, 296, 367, 389, 433, 627, 51, 568, 720, 26047, 17477, 315, 259, 813, 720, 5349, 220, 1143, 374, 259, 297, 720, 652, 297, 348, 2679, 4225, 477, 296, 367, 720, 438, 26708, 384, 296, 379, 720, 68, 865, 824, 602, 967, 384, 289, 433, 305, 198, 88, 6033, 13, 720, 51, 813, 4733, 220, 1143, 14545, 289, 274, 720, 83, 568, 27431, 1022, 259, 568, 356, 323, 307, 264, 720, 752, 307, 8274, 15, 220, 16, 220, 15, 220, 17, 220, 15, 220, 18, 220, 15, 220, 19, 198, 54, 305, 379, 220, 6178, 357, 350, 384, 436, 1469, 602, 384, 274, 435, 60243, 198, 15, 220, 20, 198, 40, 289, 602, 326, 326, 26708, 384, 1063, 315, 259, 51543, 357, 477, 220, 552, 289, 433, 305, 379, 6033, 13, 507, 26183, 384, 358, 198, 478, 671, 1706, 291, 296, 379, 8249, 453, 550, 1645, 62547, 384, 11, 358, 2197, 459, 259, 297, 720, 8823, 1274, 342, 1880, 1297, 83, 2781, 1701, 10173, 11, 348, 433, 264, 47796, 13801, 268, 35262, 1174, 477, 342, 459, 292, 282, 297, 347, 11, 1612, 72, 326, 6197, 289, 520, 2781, 1174, 323, 264, 1317, 720, 1638, 315, 289, 9072, 374, 912, 289, 597, 912, 289, 308, 439, 10345, 1826, 379, 514, 198, 66, 15020, 1560, 662, 128009, 128000, 44, 379, 8893, 274, 289, 2781, 384, 342, 1880, 1303, 1297, 83, 2781, 1174, 719, 358, 539, 292, 1608, 259, 9072, 289, 305, 1994, 348, 2781, 259, 568, 379, 1047, 264, 60642, 514, 5906, 267, 4248, 304, 259, 51543, 720, 113276, 1826, 379, 514, 272, 15020, 1560, 1174, 259, 568, 379, 289, 220, 619, 6520, 348, 384, 264, 513, 348, 2781, 384, 1344, 802, 384, 5352, 315, 259, 51543, 274, 379, 296, 418, 297, 1026, 662, 358, 282, 55239, 259, 1077, 384, 1047, 259, 297, 387, 720, 82, 4512, 305, 287, 358, 272, 220, 619, 656, 259, 297, 550, 384, 348, 1218, 1344, 802, 384, 27859, 323, 6520, 348, 384, 21730, 436, 1560, 495, 274, 259, 9072, 289, 2781, 384, 4411, 384, 10878, 3025, 13, 128009, 128000, 32, 259, 259, 568, 1890, 892, 11, 358, 289, 439, 5105, 3380, 305, 1786, 287, 296, 379, 272, 15960, 326, 3696, 665, 323, 779, 358, 289, 439, 436, 384, 2277, 348, 802, 602, 788, 13034, 477, 18385, 720, 582, 272, 220, 632, 274, 1174, 1120, 293, 379, 289, 264, 379, 315, 10695, 259, 17728, 1234, 357, 323, 259, 51543, 7978, 662, 358, 272, 1097, 68, 1645, 436, 31159, 1794, 295, 305, 287, 720, 396, 2781, 1826, 287, 289, 15960, 514, 289, 384, 289, 2781, 384, 1707, 379, 6892, 259, 568, 220, 5245, 15, 529, 274, 1174, 289, 48916, 433, 289, 439, 9932, 259, 9072, 282, 802, 4809, 274, 304, 259, 568, 720, 52, 25719, 1608, 328, 259, 520, 1560, 342, 264, 348, 384, 1794, 295, 305, 287, 259, 297, 259, 51543, 282, 52827, 15812, 259, 289, 18385, 384, 264, 379, 2487, 662, 350, 813, 296, 379, 357, 2781, 379, 38415, 46845, 384, 272, 4433, 1608, 720, 68, 348, 2781, 379, 259, 305, 287, 323, 597, 384, 418, 259, 51543, 282, 52827, 15812, 568, 3223, 305, 379, 662, 128009, 128000, 2181, 5668, 520, 658, 379, 18274, 272, 4433, 436, 1608, 259, 297, 757, 259, 9072, 259, 813, 296, 379, 357, 2781, 379, 38415, 46845, 384, 272, 220, 619 ]
0xBreath/holistic-books
and that is the experience you take into your own love relationships. It is also the experience you bring to Me. From this experience you draw your conclusions about Me. Within this framework you speak your truth. “God is a loving God,” you say, “but if you break His commandments, He will punish you with eternal banishment and everlasting damnation.” For have you not experienced the banishment of your own parents? Do you not know the pa in of their damnation? How, then, could you imagine it to be any different with Me? You have forgotten what it was like to be loved without condition. You do not remember the experience of the love of God. And so you try to imagine what God’s love must be like, based on what you see of love in the world. You have projected the role of “parent” onto God, and have thus come up with a God Who judges and rewards or punishes, based on how good He feels about what you’ve been up to. But this is a simplistic view of God, based on your mythology. It has nothing to do with Who I Am. Having thus created an entire thought system about God based on human experience rather than spiritual truths, you then create an entire reality around love. It is a fear -based reality, r ooted in the idea of a fearful, vengeful God. Its Sponsoring Thought is wrong, but to deny that thought would be to disrupt your whole theology. And though the new theology which would replace it would truly be your salvation, you cannot accept it, because the idea of a God Who is not to be feared, Who will not judge, and Who has no cause to punish is simply too magnificent to he embraced within even your grandest notion of Who and What God is. This fear -based love reality dominates your experience of love; indeed, actually creates it. For not only do you see yourself receiving love which is conditional, you also watch yourself giving it in the same way. And even while you withhold and retreat and set your conditions, a part of you knows t his is not what love really is. Still, you seem powerless to change the way you dispense it You’ve learned the hard way, you tell yourself, and you’ll be damned if you’re going to leave yourself vulnerable again. Yet the truth is, you’ll be damned if you don’t. [By your own (mistaken) thoughts about love do you damn yourself never to experience it purely. So, too, do you damn yourself never to know Me as I really am. Until you do. For you shall not be able to deny Me forever, and the moment will come for our Reconciliation.] Every action taken by human beings is based in love or fear, not simply those dealing with relationships. Decisions affecting business, industry, politics, religion, the education of your young, the social agenda of your nations, th e economic goals of your society, choices involving war, peace, attack, defense, aggression, submission; determinations to covet or give away, to save or to share, to unite or to divide —every single free choice you ever undertake arises out of one of the only two possible thoughts there are: a thought of love or a thought of fear. Fear is the energy which contracts, closes down, draws in, runs, hides, hoards, harms. Love is the energy which expands, opens up, sends out, stays, reveals, shares, heals. Fear w raps our bodies in clothing, love allows us to stand naked. Fear clings to and clutches all that we have, love gives all that we have away. Fear holds close, love holds dear. Fear grasps, love lets go. Fear rankles, love soothes. Fear attacks, love amends. Every human thought, word, or deed is based in one emotion or the other. You have no choice about this, because there is nothing else from which to choose. But you have free choice about which of these to select. You make it sound so easy, and yet in the moment of decision fear wins more often than not. Why is that? You have been taught to live in fear. You have been told about the survival of the fittest and the victory of the strongest and the success of the cleverest. Precious little is said about the g lory of the most loving. And so you strive to be the fittest, the strongest, the cleverest —in one way or another —and if you see yourself as something less than this in any situation, you fear loss, for you have been told that to be less is to lose. And so of course you choose the action fear sponsors, for that is what you have been taught. Yet I teach you this: when you choose the action love sponsors, then will you do more than survive, then will you do more than win, then will you do more than succeed. Th en will you experience the full glory of Who You Really Are, and who you can be. To do this you must turn aside the teachings of your well -meaning, but misinformed, worldly tutors, and hear the teachings of those whose wisdom comes from another source. There are many such teachers among you, as always there have been, for I will not leave you without those who would show you, teach you, guide you, and remind you of these truths. Yet the greatest reminder is not anyone outside you, but the voice within you. This is the first tool that I use, because it is the most accessible. The voice within is the loudest voice with which I speak, because it is the closest to you. It is the voice which tells you whether everything else is true or false, right or wrong, good or bad as you have defined it. It is the radar that sets the course, steers the ship, guides the journey if you but let it. It is the voice which tells you right now whether the very words you are reading are words of love or words of fear. By this measure can you determine whether they are words to heed or words to ignore. You said that when I always choose the action that love sponsors, then I will experience the full glory of who I am and who I can be. Will you expand on this please? There is only one purpose for all of life, and that is for you and all that lives to experience fullest glory. Everything else you say, think, or do is attendant to that function. There is nothing else for your soul to do, and nothing else your soul wants to do. The won der of this purpose is that it is never -ending. An ending is a limitation, and God’s purpose is without such a boundary. Should there come a moment in which you experience yourself in your fullest glory, you will in that instant imagine an ever-greater glory to fulfill. The more you are, the more you can become, and the more you can become, the more you can yet be. The deepest secret is that life is not a process of discovery, but a process of creation. You are not discovering yourself but creating yourself anew. Seek, therefore, not to find out Who You Are, seek to determine Who You Want to Be. There are those who say that life is a school, that we are here to learn specific lessons, that once we “graduate” we can go on to larger pursuits, no longer shackled by the body. Is this correct? It is another part of your mythology, based on human experience. Life is not a school? No. We are not here to learn lessons? No. Then why are we here? To remember, and recreate, Who You Are. I have told you, over and over again. You do not believe Me. Yet that is well as it should be. For truly, if you do not create yourself as Who You Are, that you cannot be. Okay, You’ve lost me. Let’s go back to this school bit. I’ve heard teacher after teacher tell us that life is a school. I’m frankly shocked to hear You deny that. School is a place you go if there is something you do not know that you want to know. It is not a place you go if you already know a thing and simply want to experience your knowingness. Life (as you call it) is an opportunity for you to know experientially what you already know conceptually. You need learn nothing to do this. You need merely remember what you already know, and act on it. I’m not sure I understand. Let’s start here. The soul —your soul — knows all there is to know all the time. There’s nothing hidden
[ 438, 430, 374, 279, 720, 50659, 499, 1935, 1139, 701, 1866, 3021, 2355, 86924, 13, 2355, 2181, 374, 1101, 279, 3217, 499, 4546, 311, 2206, 13, 2355, 3915, 420, 3217, 499, 4128, 701, 720, 444, 24436, 922, 2206, 13, 25218, 420, 720, 3879, 220, 499, 6604, 701, 8206, 13, 1054, 28622, 374, 264, 720, 385, 4504, 4359, 2476, 499, 2019, 11, 1054, 8248, 422, 499, 1464, 5414, 2355, 5749, 1392, 11, 1283, 690, 32151, 499, 449, 720, 295, 3051, 9120, 16409, 323, 96049, 2355, 89719, 367, 2029, 2355, 2520, 617, 499, 539, 10534, 279, 720, 6993, 16409, 315, 701, 1866, 6699, 30, 3234, 499, 720, 1962, 1440, 279, 7251, 304, 315, 872, 27860, 367, 30, 2650, 11, 720, 3473, 11, 1436, 499, 13085, 433, 311, 387, 904, 2355, 64750, 449, 2206, 30, 220, 1472, 617, 25565, 1148, 433, 574, 1093, 311, 387, 720, 385, 2111, 2085, 3044, 13, 1472, 656, 539, 2355, 30380, 279, 3217, 315, 279, 3021, 315, 720, 28622, 13, 1628, 779, 499, 1456, 311, 13085, 1148, 4359, 753, 2355, 31153, 2011, 387, 1093, 11, 3196, 389, 1148, 499, 1518, 720, 1073, 3021, 304, 279, 1917, 13, 2355, 2675, 617, 28448, 279, 3560, 315, 1054, 3850, 863, 8800, 720, 28622, 11, 323, 617, 8617, 2586, 709, 449, 264, 220, 4359, 720, 15546, 24958, 323, 21845, 477, 8474, 21168, 11, 720, 31039, 389, 1268, 1695, 1283, 11321, 922, 1148, 2355, 9514, 4070, 1027, 709, 311, 13, 2030, 420, 374, 264, 78630, 720, 1068, 315, 4359, 11, 3196, 389, 701, 59492, 13, 1102, 2355, 4752, 4400, 311, 656, 449, 10699, 358, 3383, 13, 2355, 29132, 8617, 3549, 459, 4553, 3463, 720, 9125, 922, 4359, 3196, 389, 3823, 2355, 50659, 4856, 1109, 18330, 53219, 11, 499, 720, 3473, 1893, 459, 4553, 8903, 2212, 3021, 13, 220, 1102, 720, 285, 264, 8850, 482, 31039, 8903, 11, 436, 297, 9437, 304, 279, 4623, 315, 720, 64, 63757, 11, 348, 6443, 1285, 4359, 13, 11699, 328, 2805, 5620, 220, 36287, 374, 5076, 11, 719, 311, 23973, 430, 3463, 720, 41450, 387, 311, 24927, 701, 4459, 54641, 13, 2355, 3112, 3582, 279, 502, 54641, 902, 1053, 720, 8319, 433, 1053, 9615, 387, 701, 46035, 11, 220, 499, 720, 34360, 4287, 433, 11, 1606, 220, 279, 4623, 315, 264, 4359, 720, 15546, 374, 539, 311, 387, 38569, 11, 10699, 690, 220, 539, 11913, 11, 720, 438, 10699, 706, 912, 5353, 311, 32151, 374, 5042, 720, 37227, 41792, 311, 568, 220, 43603, 2949, 1524, 720, 22479, 6800, 478, 23035, 315, 10699, 323, 3639, 4359, 720, 285, 13, 720, 2028, 8850, 482, 31039, 3021, 8903, 83978, 701, 720, 50659, 315, 3021, 26, 13118, 11, 3604, 220, 11705, 720, 275, 13, 1789, 539, 1193, 656, 499, 1518, 6261, 720, 265, 47444, 3021, 902, 374, 35787, 11, 499, 220, 1101, 720, 14658, 6261, 7231, 433, 304, 279, 1890, 1648, 13, 720, 3112, 1524, 1418, 499, 87900, 323, 220, 31114, 720, 438, 743, 701, 4787, 11, 264, 961, 315, 499, 720, 33134, 82, 259, 813, 374, 539, 1148, 3021, 2216, 374, 13, 220, 16782, 11, 720, 9514, 2873, 85452, 311, 2349, 279, 1648, 499, 13262, 1137, 433, 1472, 4070, 9687, 279, 220, 2653, 720, 3195, 11, 499, 3371, 6261, 11, 323, 499, 4805, 387, 68465, 720, 333, 499, 3207, 2133, 311, 5387, 6261, 220, 20134, 720, 33871, 13, 14968, 279, 8206, 374, 11, 499, 4805, 387, 68465, 422, 720, 9514, 1541, 1431, 13, 2355, 58, 1383, 701, 1866, 320, 80024, 3448, 8, 11555, 922, 720, 31153, 656, 499, 27860, 6261, 2646, 311, 2355, 50659, 433, 32227, 13, 2100, 11, 2288, 11, 656, 499, 27860, 720, 22479, 726, 2646, 311, 1440, 2206, 439, 358, 2216, 1097, 13, 2355, 25503, 499, 656, 13, 1789, 499, 4985, 539, 387, 3025, 311, 720, 91063, 2206, 16058, 11, 323, 279, 4545, 690, 220, 2586, 720, 2000, 1057, 1050, 99340, 25750, 2355, 11769, 1957, 4529, 555, 3823, 23837, 374, 720, 31039, 304, 3021, 477, 8850, 11, 539, 5042, 1884, 2355, 451, 6260, 449, 12135, 13, 3799, 6948, 720, 64, 1740, 287, 2626, 11, 5064, 11, 11759, 11, 720, 3833, 32718, 11, 220, 279, 6873, 315, 701, 3995, 11, 279, 720, 23191, 18909, 315, 701, 17089, 11, 270, 384, 720, 49944, 9021, 220, 315, 701, 8396, 11, 11709, 16239, 4208, 11, 9096, 11, 3440, 11, 9232, 11, 720, 351, 30840, 11, 220, 21142, 26, 6449, 811, 311, 720, 57512, 295, 477, 3041, 3201, 11, 311, 3665, 477, 311, 4430, 11, 311, 720, 359, 635, 477, 311, 220, 22497, 2001, 30115, 3254, 1949, 5873, 720, 9514, 3596, 49643, 48282, 704, 315, 832, 315, 279, 720, 3323, 1403, 220, 3284, 11555, 1070, 527, 25, 264, 720, 61665, 315, 3021, 477, 264, 3463, 315, 8850, 13, 2355, 91471, 374, 279, 4907, 902, 17517, 11, 34350, 720, 2996, 11, 27741, 304, 11, 8640, 11, 58704, 11, 11640, 2402, 11, 2355, 13279, 1026, 13, 2355, 29351, 374, 279, 4907, 902, 52956, 11, 16264, 720, 455, 11, 22014, 704, 11, 27656, 11, 21667, 11, 13551, 11, 2355, 383, 1147, 13, 2355, 91471, 289, 436, 2690, 1057, 13162, 304, 17895, 11, 3021, 720, 56967, 603, 311, 2559, 19557, 13, 43067, 1206, 826, 311, 720, 438, 1206, 88449, 682, 430, 584, 617, 11, 3021, 6835, 682, 720, 9210, 584, 617, 3201, 13, 43067, 10187, 3345, 11, 3021, 2355, 54219, 25237, 13, 43067, 50087, 1725, 11, 3021, 15714, 733, 13, 43067, 7222, 645, 11, 3021, 44276, 6509, 13, 43067, 8951, 11, 3021, 2355, 309, 1438, 13, 2355, 11769, 3823, 3463, 11, 3492, 11, 477, 56408, 374, 720, 31039, 304, 832, 20356, 477, 279, 1023, 13, 1472, 720, 19553, 220, 912, 5873, 922, 420, 11, 1606, 1070, 374, 720, 42312, 775, 505, 902, 311, 5268, 13, 2030, 499, 2355, 19553, 1949, 5873, 922, 902, 315, 1521, 311, 720, 1779, 13, 2355, 2675, 1304, 433, 5222, 779, 4228, 11, 323, 3686, 304, 279, 720, 29699, 315, 5597, 8850, 15160, 810, 3629, 720, 54895, 539, 13, 220, 8595, 374, 430, 30, 2355, 2675, 617, 1027, 15972, 311, 3974, 304, 8850, 13, 1472, 720, 19553, 1027, 3309, 922, 279, 20237, 315, 279, 2355, 69, 14602, 323, 279, 12845, 315, 279, 31005, 323, 720, 1820, 2450, 315, 279, 28799, 478, 13, 42770, 1245, 220, 2697, 720, 285, 1071, 922, 279, 342, 326, 683, 315, 279, 1455, 21955, 13, 720, 3112, 779, 499, 37106, 311, 387, 279, 282, 14602, 11, 279, 2355, 4620, 478, 11, 279, 28799, 478, 2001, 258, 832, 1648, 477, 2500, 2001, 438, 422, 499, 1518, 6261, 439, 2355, 34431, 2753, 1109, 420, 304, 904, 6671, 11, 720, 9514, 8850, 4814, 11, 369, 499, 617, 1027, 3309, 430, 220, 311, 720, 1395, 2753, 374, 311, 9229, 13, 2355, 3112, 779, 315, 3388, 499, 5268, 279, 1957, 720, 69, 686, 39701, 11, 369, 430, 374, 1148, 499, 617, 2355, 82850, 15972, 13, 14968, 358, 4639, 499, 420, 25, 994, 499, 720, 28150, 279, 1957, 3021, 39701, 11, 1243, 220, 690, 720, 9514, 656, 810, 1109, 18167, 11, 1243, 690, 499, 656, 720, 6518, 1109, 3243, 11, 1243, 690, 499, 656, 810, 220, 1109, 720, 82, 30364, 13, 666, 665, 690, 499, 3217, 279, 2539, 720, 6200, 683, 315, 10699, 1472, 29308, 8886, 11, 323, 220, 889, 499, 720, 4919, 387, 13, 2355, 1271, 656, 420, 499, 2011, 2543, 16038, 279, 720, 668, 613, 826, 315, 701, 1664, 482, 57865, 11, 719, 720, 34965, 258, 10365, 11, 220, 97706, 84032, 11, 323, 6865, 279, 720, 668, 613, 826, 315, 1884, 6832, 24278, 4131, 720, 1527, 2500, 220, 2592, 13, 220, 2684, 527, 1690, 1778, 13639, 4315, 499, 11, 720, 300, 2744, 1070, 617, 1027, 11, 369, 358, 690, 539, 2355, 22233, 499, 2085, 1884, 889, 1053, 1501, 720, 9514, 11, 4639, 499, 11, 8641, 499, 11, 323, 24928, 499, 2355, 1073, 1521, 53219, 13, 14968, 279, 12474, 27626, 374, 720, 1962, 5606, 4994, 499, 11, 719, 279, 7899, 2355, 56950, 499, 13, 1115, 374, 279, 1176, 5507, 430, 358, 1005, 11, 720, 28753, 433, 374, 279, 1455, 15987, 13, 2355, 791, 7899, 2949, 374, 279, 29740, 5086, 7899, 449, 720, 8370, 358, 6604, 11, 1606, 433, 374, 279, 18585, 311, 2355, 9514, 13, 1102, 374, 279, 7899, 902, 10975, 499, 3508, 720, 73826, 775, 374, 837, 477, 905, 11, 1314, 477, 2355, 35970, 11, 220, 1695, 477, 3958, 439, 499, 617, 4613, 433, 13, 720, 2181, 374, 279, 28608, 430, 7437, 279, 3388, 11, 4179, 388, 2355, 1820, 8448, 11, 28292, 279, 11879, 422, 499, 719, 1095, 433, 13, 2355, 2181, 374, 279, 7899, 902, 10975, 499, 1314, 1457, 720, 49864, 279, 1633, 4339, 499, 527, 5403, 527, 2355, 5880, 315, 3021, 477, 4339, 315, 8850, 13, 3296, 420, 6767, 649, 499, 8417, 3508, 814, 720, 548, 4339, 311, 75499, 477, 4339, 311, 10240, 13, 2355, 2675, 1071, 430, 994, 358, 2744, 5268, 279, 720, 1335, 430, 3021, 39701, 11, 1243, 358, 690, 720, 50659, 279, 220, 2539, 27025, 315, 889, 358, 1097, 323, 720, 14965, 358, 649, 387, 13, 4946, 499, 9407, 389, 420, 720, 31121, 30, 2355, 3947, 374, 1193, 832, 7580, 369, 682, 315, 2324, 11, 323, 720, 9210, 374, 369, 499, 323, 682, 430, 6439, 311, 2355, 50659, 77796, 27025, 13, 2355, 36064, 775, 499, 2019, 11, 1781, 11, 477, 656, 374, 720, 1617, 20995, 311, 430, 734, 13, 2684, 374, 4400, 2355, 1531, 369, 701, 13836, 311, 656, 11, 323, 4400, 775, 720, 22479, 13836, 6944, 311, 656, 13, 578, 2834, 2761, 315, 420, 2355, 77763, 374, 430, 433, 374, 2646, 482, 2518, 13, 1556, 720, 2518, 374, 264, 20893, 11, 323, 4359, 753, 7580, 374, 2355, 30096, 1778, 264, 19254, 13, 12540, 1070, 720, 2063, 264, 4545, 304, 902, 499, 3217, 220, 6261, 304, 701, 77796, 27025, 11, 499, 690, 304, 430, 720, 86258, 13085, 459, 3596, 2427, 29462, 220, 27025, 311, 2355, 1285, 7712, 13, 578, 810, 499, 527, 11, 279, 810, 499, 649, 720, 17106, 638, 11, 323, 279, 810, 499, 649, 3719, 11, 2355, 1820, 810, 499, 649, 3686, 387, 13, 2355, 791, 51621, 6367, 374, 430, 2324, 374, 539, 264, 720, 4734, 315, 18841, 11, 719, 264, 1920, 315, 2355, 38475, 13, 2355, 2675, 527, 539, 42687, 6261, 719, 2355, 46002, 6261, 220, 93392, 13, 30839, 11, 9093, 11, 720, 1962, 311, 220, 1505, 704, 10699, 1472, 8886, 11, 6056, 311, 720, 67, 25296, 10699, 1472, 24133, 311, 2893, 13, 2355, 3947, 527, 1884, 889, 2019, 430, 2324, 374, 264, 720, 22606, 11, 430, 584, 527, 1618, 311, 4048, 3230, 720, 73412, 11, 430, 220, 3131, 584, 1054, 28770, 863, 584, 649, 733, 720, 263, 311, 8294, 90887, 11, 912, 5129, 77390, 839, 555, 720, 1820, 2547, 13, 2209, 420, 220, 4495, 30, 220, 1102, 374, 2500, 961, 315, 701, 59492, 11, 3196, 720, 263, 3823, 3217, 13, 2355, 26833, 374, 539, 264, 2978, 30, 2355, 2822, 13, 720, 1687, 527, 539, 1618, 311, 4048, 18872, 30, 2355, 2822, 13, 720, 12487, 3249, 527, 584, 1618, 30, 2355, 1271, 6227, 11, 323, 53875, 11, 10699, 1472, 8886, 13, 2355, 40, 617, 3309, 499, 11, 927, 323, 927, 1578, 13, 1472, 720, 3055, 539, 4510, 2206, 13, 14968, 430, 374, 1664, 439, 433, 2355, 5562, 387, 13, 1789, 9615, 11, 422, 499, 656, 539, 1893, 720, 22479, 726, 439, 10699, 1472, 8886, 11, 430, 499, 4250, 2355, 1395, 13, 720, 33413, 11, 1472, 4070, 5675, 757, 13, 6914, 753, 733, 1203, 311, 420, 720, 22606, 2766, 13, 358, 4070, 6755, 11326, 1306, 11326, 720, 73457, 603, 220, 430, 2324, 220, 374, 264, 2978, 13, 358, 4344, 42762, 720, 939, 68485, 311, 6865, 1472, 23973, 430, 13, 220, 6150, 374, 264, 2035, 499, 733, 422, 1070, 374, 720, 34431, 499, 656, 539, 1440, 430, 499, 1390, 720, 998, 1440, 13, 1102, 374, 539, 264, 2035, 499, 733, 422, 499, 720, 46584, 1440, 264, 3245, 323, 5042, 1390, 311, 2355, 50659, 701, 14392, 2136, 13, 2355, 26833, 320, 300, 499, 220, 1650, 433, 8, 374, 459, 6776, 369, 499, 720, 998, 1440, 2183, 1188, 34575, 1148, 499, 2736, 2355, 33134, 7434, 1870, 13, 1472, 1205, 4048, 4400, 720, 998, 656, 420, 13, 1472, 1205, 16632, 6227, 220, 1148, 720, 9514, 2736, 1440, 11, 323, 1180, 389, 433, 13, 2355, 40, 4344, 539, 2771, 358, 3619, 13, 2355, 10267, 753, 1212, 1618, 13, 578, 13836, 2001, 22479, 13836, 107216, 33134, 82, 682, 1070, 374, 311, 1440, 682, 279, 892, 13, 2355, 3947, 753, 4400, 8340 ]
0xBreath/holistic-books
la Torre, MD, PhD, began his work on dimethylsulfoxide (DMSO) in the early 1970s shortly after his appointment as assistant professor in neurosurgery at the University of Chicago. Dr. de la Torre’s research revealed DMSO’s ability to quickly reduce intracranial pressure, restore cerebral blood flow, and stabilize respiration in nonhuman primates sustaining lethal traumatic brain injuries. For the next eight years, he extended his brain trauma findings and showed that intrave - nous administration of DMSO was effective in treating primary and secondary damage following experimental ischemic stroke and spinal cord trauma. These neuroprotective properties of DMSO have been broadly confirmed by other investigators in the last three decades.xii Authors A host of other ailments amenable to DMSO therapy were reported at the inter - national conference “Biological Actions and Medical Applications of Dimethyl Sulfoxide” in 1983, chaired by Dr. de la Torre and sponsored by the New York Academy of Sciences. Besides his first faculty appointment at the University of Chicago, Dr. de la Torre has held professorial appointments in neurosurgery and neuroscience at Northwestern University in Chicago, the University of Ottawa, Canada, and Case Western University in Cleveland. He was visiting professor at the University of California, San Diego, University of Valencia, Spain, and the Laboratoire de Physiopathologie Cerebrovasculaire, Paris, France. Dr. de la Torre has published more than 180 peer-reviewed research articles and has written or edited a dozen medical texts on pathology, neurotransmitters, and Alzheimer’s disease. Dr. de la Torre’s training in neuroanatomy and neuropathology has led him to specialize in disorders of the brain, including stroke, cerebral trauma, and dementia. He continues his research as an adjunct professor of psychology at The University of Texas in Austin.xiii Introduction First isolated as a peculiar chemical compound by the Russian chemist Alexander Saytzeff in 1866, dimethylsulfoxide (DMSO) first proved to be a near-perfect solvent for decades until its other remarkable attributes became known to researchers and to millions of people around the planet. DMSO is one of the most remarkable agents ever to come out of the world of drug development. Its wide range of biological actions involving plants, animals, and humans has led to tens of thousands of articles written in the scientific literature from all parts of the planet since its medicinal discovery in 1964 by Jacob and Hershler. 1 These investigators first pointed out DMSO’s clinical applications and, in so doing, opened a Pandora’s box of medical and scientific research into the alleviation of dis - ease, pain, and trauma. The earliest and most impressive observation made by Jacob and Hershler1 was the ability of DMSO to penetrate the skin without damaging it. A few drops of DMSO spilled on the skin would quickly cause a distinctive garlic taste on the tongue, indicating its immediate transcutaneous penetration into the circulation. This fact alone placed DMSO in the exclusive club where small mol - ecules (under 500 Da) can cross the integument and be considered in the possible realm of topical dermatotherapy. In later years, DMSO was tested intravenously and was shown to exert rapid and safe activity as a neuroprotective agent against various types of trauma in animals and humans. With a team of collaborators, Jacob’s initial article and others that followed described the effects of DMSO on pain, anti-inflammation, vasodilation, reduction of scar tissue, and antimicrobial activity, including its killing action against tubercu - losis-resistant bacilli. These findings have led to a steady cascade of scientific papers on both in vitro and in vivo systems that continue to the present time. Also, several dozen interna - tional conferences have been held where investigators have reported the properties of DMSO on the biochemical, molecular, physiological, pharmacological, and medical systems linked to trauma and disease. This book examines the major clinical uses of DMSO in humans as supported by basic evidence derived from experiments in animals, including its effects as a powerful pain reliever, and in disorders such as osteoarthritis, interstitial cystitis, gastrointestinal inflammatory changes, scleroderma, respiratory distress, myasthe - nia gravis, cardiac disease, traumatic brain injury, stroke, Alzheimer’s disease, and spinal cord trauma. In the case of DMSO, how does one categorize an agent with such a wide range of biological and pharmacological activities? Can one small and simple molecule affect these medical conditions in a beneficial manner? And if so, what mechanisms are at play in these processes? In order to explore the pharmacotherapeutic actions of DMSO on diverse medical conditions, the book offers a critical analysis of the scientific research that examined DMSO’s action as a free radical scavenger; an anti-inflammatory, antipain, anticancer, xiv Introduction cell membrane stabilizer; and aneuroprotective agent in preventing and treating trauma and disease. The ability of DMSO to act as a chemical chaperone and to enhance the penetra - tion of an accompanying compound applied topically on the skin has opened the door to the field of drug delivery by percutaneous transport of selective molecules. The book explores how the chemical structure of DMSO is able to react and deac - tivate toxic molecules generated by DNA damage, free radical formation, inflam - mation, infection, and tissue injury. Many toxic and potentially lethal molecules suppressed by DMSO include chemokines, interleukins, tumor necrosis factor, thromboxane, tissue factor, thrombin, and glutamate excitotoxicity. Many of these toxic molecules appear as a secondary reaction to traumatic inju- ries and countless of disorders to overwhelm the clinical picture and disease out - come. For this reason, the biological actions and therapeutic usefulness of DMSO have been barely scratched on the surface despite thousands of articles indicating its clinical potential. We hope this book will serve as a guide to explain the many facets of how DMSO works and to open new doors in the search for better ways to help the ill and the suffering. This book will be of interest to health-care workers, clinicians, basic scientists, and health-conscious consumers who wish to know more about the biological diver - sity and medical applications of DMSO. REFERENCE 1. Jacob SW, Bischel M, Hershler RJ. Dimethyl sulfoxide (DMSO): A new concept in pharmacotherapy. Curr Ther Res Clin Exp. 1964; Feb;6:134–135.1 1Chemistry of DMSO CHEMICAL STRUCTURE AND PROPERTIES OF DMSO Dimethyl sulfoxide (DMSO) was first synthesized in 1866, and the finding was reported a year later by the Russian organic chemist Alexander Saytzeff.1 Other common names of DMSO are methyl sulfoxide and methylsulfinylmethane. A sulf - oxide is a chemical compound containing a sulfinyl functional group attached to two carbon atoms. The DMSO molecule has a pyramidal structure containing sulfur, oxygen, and carbon atoms. The sulfur atom is in the center, while the two methyl groups, the oxygen atom, and a nonbonding electron pair are located at the corners (Figure 1.1). The sulfur atom serves as the positive dipole and activates the hydrogen atoms of the methyl groups making them weakly acidic and very resistant to removal in free radical reactions and allowing removal only by strongly basic reagents such as sodium hydride. 2 DMSO is produced as a by-product of wood pulping. Lignin, in the kraft pulping liquor wastes, is a polymer of unknown structure and the principal source of DMSO. DMSO synthesis is derived from dimethyl sulfide, a by-product of the manufacture of paper. Wood contains about 25%–30% lignin and sulfite waste liquors up to 6%. 3 DMSO is commercially made available in the United States by Gaylord Chemical Corporation, which also makes the highly pure grade of DMSO for drug delivery and health-care applications. The principal impurity present in DMSO is water, and the purified solvent will readily absorb water vapor if exposed to the atmosphere. Solvents are classified as either polar or nonpolar, and the most common measure of solvent polarity is the dielectric constant. The sulfur–oxygen bond in DMSO is quite polar so that the liquid has a high dielectric constant. This polarity and geometry lead to considerable organization in the liquid state in which DMSO molecules are associated into chains by dipole attraction. 3 Electrophiles are atoms, molecules, and ions that behave as electron acceptors. Nucleophilic reagents such as DMSO behave as electron donors. The sul - fur center in DMSO is nucleophilic toward soft electrophiles, which are molecules that readily accept electrons during a primary reaction step, while the oxygen is nucleophilic toward hard electrophiles, that is, electrons with a positive charge not easily delocalized. 4 Liquids with a high dielectric constant such as DMSO and water have a higher solubility of substances when immersed in a medium. For that reason, the high dielectric constant of DMSO, which is higher than most organic liquids, makes it a uniquely universal solvent 2 (Table 1.1).2 Dimethyl Sulfoxide (DMSO) in Trauma and Disease The presence of a liquid structure
[ 1208, 8611, 265, 11, 14306, 11, 30661, 1174, 6137, 813, 990, 389, 720, 13223, 42972, 82, 360, 15361, 579, 320, 35, 4931, 46, 8, 304, 279, 4216, 220, 4468, 15, 82, 20193, 1306, 813, 18101, 439, 18328, 14561, 304, 18247, 82, 85392, 520, 279, 3907, 315, 10780, 13, 2999, 13, 409, 1208, 8611, 265, 753, 3495, 10675, 423, 4931, 46, 753, 5845, 311, 6288, 8108, 10805, 582, 6713, 532, 7410, 11, 15301, 60745, 6680, 6530, 11, 323, 70236, 594, 29579, 304, 2536, 26380, 9036, 988, 80184, 45089, 54286, 8271, 15319, 13, 1789, 279, 1828, 8223, 4194, 42820, 11, 568, 11838, 813, 8271, 30988, 14955, 323, 8710, 430, 10805, 525, 18722, 77, 788, 8735, 315, 423, 4931, 46, 574, 7524, 304, 720, 10367, 1113, 6156, 323, 14580, 5674, 2768, 22772, 98108, 292, 12943, 323, 50112, 23125, 30988, 13, 4314, 18247, 47079, 535, 6012, 315, 423, 4931, 46, 617, 1027, 44029, 11007, 555, 1023, 26453, 304, 279, 1566, 2380, 11026, 2036, 3893, 25095, 198, 32, 3552, 315, 1023, 82907, 1097, 12837, 311, 423, 4931, 46, 15419, 1051, 5068, 520, 279, 958, 18722, 42240, 10017, 1054, 37196, 5848, 27820, 323, 13235, 32625, 315, 8289, 42972, 720, 50, 360, 15361, 579, 863, 304, 220, 3753, 18, 11, 99206, 555, 2999, 13, 409, 1208, 8611, 265, 323, 30638, 555, 279, 1561, 4356, 16192, 315, 23199, 627, 52555, 813, 1176, 22291, 18101, 520, 279, 3907, 315, 10780, 11, 2999, 13, 409, 1208, 8611, 265, 720, 4752, 5762, 14561, 532, 37256, 304, 18247, 82, 85392, 323, 93048, 520, 67363, 3907, 304, 10780, 11, 279, 3907, 315, 33266, 11, 7008, 11, 323, 11799, 11104, 3907, 304, 24372, 13, 1283, 574, 17136, 14561, 520, 279, 3907, 315, 7188, 11, 5960, 18842, 11, 3907, 315, 61349, 11, 18157, 11, 323, 279, 15277, 67763, 409, 13101, 72, 36211, 38469, 356, 486, 15222, 4378, 3395, 12267, 11, 12366, 11, 9822, 13, 2999, 13, 409, 1208, 8611, 265, 706, 4756, 810, 1109, 220, 5245, 14734, 79804, 3495, 9908, 323, 706, 5439, 477, 19685, 264, 21030, 6593, 22755, 389, 77041, 11, 90351, 83189, 11, 323, 44531, 753, 8624, 13, 2999, 13, 409, 1208, 8611, 265, 753, 4967, 304, 18247, 276, 41895, 323, 98666, 589, 2508, 706, 6197, 1461, 311, 48444, 304, 24673, 315, 279, 8271, 11, 2737, 12943, 11, 60745, 30988, 11, 323, 52857, 13, 1283, 9731, 813, 3495, 439, 459, 90695, 14561, 315, 31018, 520, 578, 4194, 31272, 315, 8421, 304, 19816, 2036, 35694, 198, 38255, 198, 5451, 25181, 439, 264, 44797, 11742, 24549, 555, 279, 8690, 8590, 380, 20643, 720, 46864, 83, 3059, 544, 304, 220, 9714, 21, 11, 5213, 42972, 82, 360, 15361, 579, 320, 35, 4931, 46, 8, 1176, 19168, 311, 387, 264, 3221, 17453, 3836, 69996, 369, 11026, 3156, 1202, 1023, 23649, 8365, 6244, 3967, 311, 12074, 323, 311, 11990, 315, 1274, 2212, 279, 11841, 627, 35, 4931, 46, 374, 832, 315, 279, 1455, 23649, 13307, 3596, 311, 2586, 704, 315, 279, 1917, 315, 720, 73821, 4500, 13, 11699, 7029, 2134, 315, 24156, 6299, 16239, 11012, 11, 10099, 11, 323, 12966, 706, 6197, 311, 22781, 315, 9214, 315, 9908, 5439, 304, 279, 12624, 17649, 505, 682, 5596, 315, 279, 11841, 2533, 1202, 58041, 18841, 304, 220, 5162, 19, 555, 25537, 323, 473, 56090, 1565, 627, 16, 720, 9673, 26453, 1176, 14618, 704, 423, 4931, 46, 753, 14830, 8522, 323, 11, 304, 779, 3815, 11, 9107, 264, 73081, 753, 3830, 315, 6593, 323, 12624, 3495, 1139, 279, 46649, 7246, 315, 834, 18722, 47714, 11, 6784, 11, 323, 30988, 627, 578, 30758, 323, 1455, 16358, 22695, 1903, 555, 25537, 720, 438, 473, 56090, 1565, 16, 574, 279, 5845, 315, 423, 4931, 46, 311, 64855, 279, 6930, 2085, 34446, 433, 627, 32, 2478, 21701, 315, 423, 4931, 46, 74125, 389, 279, 6930, 1053, 6288, 5353, 264, 35947, 31735, 720, 83, 5642, 389, 279, 25466, 11, 19392, 1202, 14247, 1380, 10453, 18133, 44596, 1139, 279, 35855, 13, 1115, 2144, 7636, 9277, 423, 4931, 46, 304, 279, 14079, 6469, 1405, 2678, 22337, 18722, 762, 2482, 320, 8154, 220, 2636, 14569, 8, 649, 5425, 279, 5503, 1143, 323, 387, 6646, 304, 279, 3284, 22651, 315, 66376, 61485, 42811, 13, 763, 3010, 1667, 11, 423, 4931, 46, 574, 12793, 10805, 5389, 7162, 323, 574, 6982, 311, 43844, 11295, 323, 6220, 5820, 439, 264, 18247, 47079, 535, 8479, 2403, 5370, 4595, 315, 30988, 304, 10099, 323, 12966, 627, 2409, 264, 2128, 315, 79119, 11, 25537, 753, 2926, 4652, 323, 3885, 430, 8272, 720, 5919, 17890, 279, 6372, 315, 423, 4931, 46, 389, 6784, 11, 7294, 3502, 45864, 367, 11, 44496, 347, 13763, 11, 14278, 315, 23087, 20438, 11, 323, 79312, 83059, 5820, 11, 2737, 1202, 13419, 1957, 2403, 15286, 3035, 84, 18722, 2353, 285, 47056, 80980, 58268, 627, 9673, 14955, 617, 6197, 311, 264, 24981, 43118, 315, 12624, 16064, 389, 2225, 304, 55004, 2355, 438, 304, 41294, 220, 6067, 430, 3136, 311, 279, 3118, 892, 13, 7429, 11, 3892, 21030, 2655, 64, 18722, 83, 4001, 38614, 617, 1027, 5762, 1405, 26453, 617, 5068, 279, 6012, 315, 423, 4931, 46, 389, 279, 93532, 11, 31206, 11, 53194, 11, 36449, 5848, 11, 323, 6593, 6067, 10815, 311, 30988, 323, 8624, 627, 2028, 2363, 49095, 279, 3682, 14830, 5829, 315, 423, 4931, 46, 304, 12966, 439, 7396, 720, 1729, 6913, 6029, 14592, 505, 21896, 304, 10099, 11, 2737, 1202, 6372, 439, 264, 8147, 6784, 59644, 424, 11, 323, 304, 24673, 1778, 439, 52368, 78, 277, 40485, 11, 958, 49270, 63581, 20000, 11, 80311, 47288, 4442, 11, 57219, 261, 4414, 1764, 11, 42631, 35104, 11, 856, 561, 383, 18722, 21557, 1099, 23156, 11, 47345, 8624, 11, 54286, 8271, 11134, 11, 12943, 11, 44531, 753, 8624, 11, 323, 50112, 23125, 30988, 627, 644, 279, 1162, 315, 423, 4931, 46, 11, 1268, 1587, 832, 22824, 553, 459, 8479, 449, 1778, 264, 7029, 2134, 315, 720, 8385, 5848, 323, 36449, 5848, 7640, 30, 3053, 832, 2678, 323, 4382, 43030, 7958, 1521, 6593, 4787, 304, 264, 24629, 11827, 30, 1628, 422, 779, 11, 1148, 24717, 527, 520, 1514, 304, 1521, 11618, 5380, 644, 2015, 311, 13488, 279, 36449, 1605, 32486, 6299, 315, 423, 4931, 46, 389, 17226, 6593, 720, 16902, 11, 279, 2363, 6209, 264, 9200, 6492, 315, 279, 12624, 3495, 430, 25078, 423, 4931, 46, 753, 1957, 439, 264, 1949, 18336, 83750, 10214, 26, 459, 7294, 67595, 11, 3276, 575, 467, 11, 88143, 11967, 11, 865, 344, 29438, 198, 5997, 39654, 27276, 3213, 26, 323, 459, 68, 2868, 47079, 535, 8479, 304, 27252, 323, 27723, 720, 2221, 13722, 323, 8624, 627, 791, 5845, 315, 423, 4931, 46, 311, 1180, 439, 264, 11742, 523, 3271, 606, 323, 311, 18885, 279, 32756, 969, 18722, 28491, 315, 459, 24442, 24549, 9435, 1948, 2740, 389, 279, 6930, 706, 9107, 279, 6134, 311, 279, 2115, 315, 5623, 9889, 555, 824, 10453, 18133, 7710, 315, 44010, 35715, 627, 791, 2363, 41424, 1268, 279, 11742, 6070, 315, 423, 4931, 46, 374, 3025, 311, 14085, 323, 409, 582, 18722, 83, 736, 21503, 35715, 8066, 555, 15922, 5674, 11, 1949, 18336, 18488, 11, 4704, 309, 18722, 76, 367, 11, 19405, 11, 323, 20438, 11134, 13, 9176, 21503, 323, 13893, 45089, 35715, 56089, 555, 423, 4931, 46, 2997, 8590, 564, 1572, 11, 96068, 3178, 1354, 11, 36254, 19591, 63412, 8331, 11, 84664, 2054, 2194, 11, 20438, 8331, 11, 84664, 7006, 11, 323, 35169, 92166, 25435, 91676, 488, 627, 8607, 315, 1521, 21503, 35715, 5101, 439, 264, 14580, 13010, 311, 54286, 5934, 84, 7058, 4108, 323, 28701, 315, 24673, 311, 96848, 279, 14830, 6945, 323, 8624, 704, 18722, 2063, 13, 1789, 420, 2944, 11, 279, 24156, 6299, 323, 37471, 76964, 315, 423, 4931, 46, 617, 1027, 20025, 83933, 389, 279, 7479, 8994, 9214, 315, 9908, 19392, 1202, 14830, 4754, 627, 1687, 3987, 420, 2363, 690, 8854, 439, 264, 8641, 311, 10552, 279, 1690, 62814, 315, 1268, 423, 4931, 46, 720, 19033, 323, 311, 1825, 502, 14365, 304, 279, 2778, 369, 2731, 5627, 311, 1520, 279, 5986, 323, 279, 16066, 627, 2028, 2363, 690, 387, 315, 2802, 311, 2890, 41206, 7487, 11, 78545, 11, 6913, 14248, 11, 720, 438, 2890, 66666, 13723, 889, 6562, 311, 1440, 810, 922, 279, 24156, 37441, 18722, 82, 488, 323, 6593, 8522, 315, 423, 4931, 46, 627, 82176, 198, 220, 16, 13, 220, 25537, 13692, 11, 426, 16438, 301, 386, 11, 473, 56090, 1565, 77404, 13, 8289, 42972, 26858, 15361, 579, 320, 35, 4931, 46, 1680, 362, 502, 7434, 304, 720, 764, 72482, 42811, 13, 356, 8186, 23258, 1838, 18905, 7943, 13, 220, 220, 5162, 19, 26, 13806, 26, 21, 25, 9565, 4235, 8878, 13, 16, 198, 16, 64938, 5050, 315, 423, 4931, 46, 198, 44893, 44, 15942, 60678, 4622, 3651, 5421, 46787, 3083, 423, 4931, 46, 198, 10557, 42972, 26858, 15361, 579, 320, 35, 4931, 46, 8, 574, 1176, 92106, 304, 220, 9714, 21, 11, 323, 279, 9455, 574, 720, 76833, 264, 1060, 3010, 555, 279, 8690, 17808, 8590, 380, 20643, 25961, 83, 3059, 544, 13, 16, 7089, 720, 5581, 5144, 315, 423, 4931, 46, 527, 79574, 26858, 15361, 579, 323, 79574, 82, 360, 5589, 4010, 69991, 2194, 13, 362, 40769, 18722, 55189, 374, 264, 11742, 24549, 8649, 264, 26858, 5589, 4010, 16003, 1912, 220, 12673, 311, 1403, 720, 74441, 33299, 13, 578, 423, 4931, 46, 43030, 706, 264, 4611, 2453, 26966, 6070, 8649, 72591, 11, 24463, 11, 323, 12782, 33299, 13, 578, 72591, 19670, 374, 304, 279, 4219, 11, 1418, 279, 1403, 79574, 5315, 11, 279, 24463, 19670, 11, 323, 264, 2536, 65339, 287, 17130, 6857, 527, 7559, 520, 279, 24359, 320, 22804, 220, 16, 13, 16, 570, 578, 72591, 19670, 17482, 439, 279, 6928, 24522, 1286, 323, 75042, 279, 35784, 33299, 315, 279, 79574, 5315, 3339, 1124, 7621, 398, 84903, 323, 1633, 31785, 311, 17065, 304, 1949, 18336, 25481, 323, 10923, 17065, 1193, 555, 16917, 6913, 312, 55975, 1778, 439, 39695, 6409, 67, 1425, 627, 17, 198, 35, 4931, 46, 374, 9124, 439, 264, 555, 29745, 315, 7732, 7893, 10194, 13, 445, 625, 258, 11, 304, 279, 597, 3017, 7893, 10194, 720, 41093, 269, 82320, 11, 374, 264, 47393, 315, 9987, 6070, 323, 279, 12717, 2592, 315, 423, 4931, 46, 13, 423, 4931, 46, 39975, 374, 14592, 505, 5213, 42972, 40769, 579, 11, 264, 555, 29745, 315, 279, 30847, 315, 5684, 627, 49492, 5727, 922, 220, 914, 4, 4235, 966, 4, 72700, 258, 323, 40769, 635, 12571, 12046, 1105, 709, 311, 220, 21, 126437, 18, 720, 35, 4931, 46, 374, 54453, 1903, 2561, 304, 279, 3723, 4273, 555, 21334, 26680, 36424, 13332, 11, 902, 1101, 3727, 279, 7701, 10748, 12239, 315, 423, 4931, 46, 369, 5623, 9889, 323, 2890, 41206, 8522, 627, 791, 12717, 3242, 5631, 3118, 304, 423, 4931, 46, 374, 3090, 11, 323, 279, 92600, 69996, 690, 720, 888, 1570, 35406, 3090, 38752, 422, 15246, 311, 279, 16975, 627, 49912, 48764, 527, 21771, 439, 3060, 25685, 477, 2536, 79, 7569, 11, 323, 279, 1455, 4279, 6767, 720, 1073, 69996, 76790, 374, 279, 2815, 47262, 6926, 627, 791, 72591, 4235, 78, 19472, 11049, 304, 423, 4931, 46, 374, 5115, 25685, 779, 430, 279, 14812, 706, 264, 1579, 720, 27591, 47262, 6926, 13, 1115, 76790, 323, 17484, 3063, 311, 24779, 7471, 304, 279, 14812, 1614, 304, 902, 423, 4931, 46, 35715, 527, 5938, 1139, 27271, 555, 24522, 1286, 33464, 627, 18, 10085, 22761, 3742, 527, 33299, 11, 35715, 11, 323, 65125, 430, 36792, 439, 17130, 720, 10543, 1105, 13, 452, 22935, 98635, 292, 312, 55975, 1778, 439, 423, 4931, 46, 36792, 439, 17130, 33149, 13, 578, 26858, 18722, 84001, 4219, 304, 423, 4931, 46, 374, 31484, 98635, 292, 9017, 8579, 4135, 22761, 3742, 11, 902, 527, 35715, 430, 31368, 4287, 57678, 2391, 264, 6156, 13010, 3094, 11, 1418, 279, 24463, 374, 31484, 98635, 292, 9017, 2653, 4135, 22761, 3742, 11, 430, 374, 11, 57678, 449, 264, 6928, 6900, 539, 6847, 1624, 3768, 1534, 627, 19, 198, 43, 5118, 3447, 449, 264, 1579, 2815, 47262, 6926, 1778, 439, 423, 4931, 46, 323, 3090, 617, 264, 5190, 720, 39298, 392, 1429, 315, 33155, 994, 78308, 304, 264, 11298, 13, 1789, 430, 2944, 11, 279, 1579, 2815, 47262, 6926, 315, 423, 4931, 46, 11, 902, 374, 5190, 1109, 1455, 17808, 67849, 11, 3727, 433, 264, 42329, 20789, 69996, 198, 17, 320, 2620, 220, 16, 13, 16, 570, 17, 8289, 42972, 46962, 15361, 579, 320, 35, 4931, 46, 8, 304, 17747, 13722, 323, 31974, 198, 791, 9546, 315, 264, 14812, 6070 ]
0xBreath/holistic-books
ight shoes compress the feet and constrict the muscles that move the toes so that the muscles waste away. The toe motions become puny and weak. The toe seeks room anywhere it can in an ill-fitting shoe. It curls up and arches until the toenail is nearly vertical. The affected toe may rise, contract, and overlap other toes. Its tip may strike the ground with each step and become flat and squat. A hard corn can form and the nail can split and grow inward. Although any toe may be so affected, the second suffers most often. It is usually longer than the othertoes. The experimental DMSO treatment was the same as with acute bunions—first ultrasound and the drug applied and then a dressing with impervious plastic wrapped over the solvent. A return visit by the patient in three days saw the pain gone from the deformed toe, although the deformity remained. The pain might return a day or two later if nothing was done to permanently correct the malformation. ARTHRITIS OF THE FEET Arthritis can affect the joints anywhere in the body, including the feet. Arthritis in the feet results in most instances from mechanical strain, not from infection. It is sometimes associated with knock-knees, bowlegs, flat feet, and weak feet. The condition also contributes to such deformities of the feet as fallen arches, high- arched foot, hammertoes, bunions, and heel spurs. Although arthritis cannot be cured at this time, the aching distress and discomfort that accompany the disease can be partially relieved. Treatment of arthritis of the feet must be directed both at the general cause and to the relief of local symptoms. The general treatment of the problem is the responsibility of your family physician, for the entire body and its general breakdown may be involved. Treatment may involve building up your resistance with diet, exercise, relaxation techniques, weight control, and other things that might constitute your lifestyle. Local treatment may include foot rest, heat applications, splinting, traction, physical therapy, and the use of drugs. The specific causes will be looked at, such as mechanical strains, allergic factors, climatic conditions, congenital defects, tumors, infection, injury, toxins, disturbances of the circulation, poor nutrition, and others. Using DMSO as a local treatment, it’s likely you’ll be able to help yourself a great deal. The following regimen of care may give relief to a red, hot, swollen arthritic joint, whether in the heel, the ankle, or the big toe. Arthritic toes respond quite well to this procedure: 1 . Paint the acutely inflamed joint with a quantity of DMSO in about 70-percent strength or a little higher concentration. Don’t go beyond 90 percent because the method of wrapping that follows may bring about a severe skin reaction from the DMSO under the hot wrap.2 . Apply several layers of roller gauze over the entire foot that’s inflamed. 3 . Rather than painting the skin directly, you might wrap with the gauze first and then saturate it with DMSO. 4 . Cover the whole area with rubber sheeting or thin foam rubber. 5 . Apply a layer of flannel or felt that has been dipped in hot water and wrung out. 6 . Put hot water bottles around the inflamed area or cover it with an electric heating pad wrapped in towels. 7 . Hold in the heat by covering all the above with Turkish towels. 8 . Elevate the foot and leg in bed to a level with the heart. 9 . Continue this treatment for as long as you are comfortable with it, but not longer than sixty minutes for any single application. 10 . Reapply the DMSO every four or five hours, as needed. 11 . After you’ve used this treatment for twelve hours (a maximum of three times), remove pads, bottles, gauze, and wash the foot so as to take off any DMSO. Apply a soothing lotion or ointment of the cortisone family, or aloe vera to the treated foot. Caution: Note that you are using two forms of therapy in this procedure— DMSO with its anti-inflammatory properties, and moist heat with its own inflammation-reducing effect. The heat seems to catalyze the DMSO into even greater effectiveness. But I caution that you can get too much of a DMSO skin reaction—even too much of an anti-inflammation response. Too much of anything is no good. Therefore, I strongly suggest that you take precautions with this treatment, at least the first few times you use it. Keep checking the condition of your arthritic joint and the skin over it. Don’t allow skin irritation to set in. Take your body temperature; if you become at all feverish, discontinue the procedure. Remove the wrappings as described in step eleven and soothe the foot. This is a highly powerful way to rid the involved foot of an arthritic inflammation. In practice, in 1965, this method was used with success, but it was administered by a doctor of podiatric medicine who knew the sort of reactions to avoid. The pain, swelling, and other signs of inflammation disappeared from a patient’s feet in the foot care office while the patient occupied a small treatment room. He or she went home without discomfort, and the relief lasted several days. HARD AND SOFT CORNSAbout 40 percent of all persons who visit a podiatrist do so initially because of hard and soft corn problems, and women comprise 80 percent of these people. Hard corns are growths of horny skin, generally on the top of the toes. Soft corns grow between the toes. Both types can be easily distinguished from the normal tissue surrounding them. Within a hard or soft corn is a central radix, or eye, of hard gray skin, and around the center is a painful inflamed ring of skin and flesh. The ring is raised and yellow. Pain usually is the main symptom. The corns come from friction and pressure arising from an underlying prominence of bone. The sharp edge on the toe bone rubs the skin from inside and sometimes wrong-fitting shoes rub the skin from the outside. The skin eventually dies and builds up layer after layer to create the corn. Irritation and pain increase as the corn grows. People suffering from corns can be relieved of their problem either temporarily or permanently. Nobody has to feel the agony of hard corns. Temporary relief does nothing to prevent the corns from growing again at the same place. It is palliative. Painting DMSO on corns was just such a temporary measure. It was done after the corn was shaved to remove the horny skin causing discomfort. No padding with moleskin was necessary after palliative corn removal if DMSO application followed the procedure; however, the corn soon returned without permanent removal of the underlying bony prominence. CALLUSES Calluses are thickened masses of skin that form on the weight-bearing surfaces of the feet. They come from constant friction and pressure. The pathological callus such as one developed on the ball of the foot is not healthy. This kind of plantar callus is surrounded by an inflamed red rim and has fluid permeating the underlying tissue. It is often swollen, hot, and painful and frequently appears as a hard, dry, hornlike mass of yellowish or grayish skin. It may be thick in the center and gradually taper at the sides. Within its center could be a deep, hard, gray central area that seems like a pebble when removed. Because the thickened skin of calluses loses its elasticity, the skin no longer stretches to normal length across the ball of the foot when the feet are flexed. These calluses seem to “burn.” Sometimes corrective treatment means redistributing the weight on the foot with supportive orthotic devices worn in the shoes. Exercises may be prescribed.Footgear might be changed. Or surgical correction of the involved metatarsal bone and the associated contraction of the toes may be required. Most of the time the person with calluses goes to have them pared away. If DMSO is put on after such paring, no moleskin padding is required to rid the area of tenderness. However, DMSO does not penetrate the hornlike skin without such removal first. PLANTAR WARTS Plantar warts grow on the sole of the foot as raised lumps of flesh. They are benign tumor-like growths that are well supplied with blood vessels and nerves. You may mistake them for corns or calluses because they are covered with callus tissue and because they hurt. The plantar wart is pearly white, soft and spongy, and has tiny spots, black, brown, or red, in its center. These spots are the blood vessels. Walking flattens the wart so that it remains thickened and rough in texture. Varying in size from a pinhead to a silver quarter, it may grow either singularly or in clusters. It hurts severely when pinched. Injury to the plantar of the foot allows entrance of a virus into the skin that may cause the plantar wart to grow. In fact, there are wart seasons, those times in the summer when people walk barefoot and bruise the bottoms of their feet
[ 492, 15653, 25633, 279, 7693, 323, 390, 6765, 279, 24569, 430, 3351, 279, 45713, 779, 198, 9210, 279, 24569, 12571, 3201, 13, 578, 31316, 54245, 3719, 8474, 88, 323, 7621, 13, 578, 31316, 198, 325, 21854, 3130, 12660, 433, 649, 304, 459, 5986, 2269, 15154, 30077, 13, 1102, 90049, 720, 455, 323, 5438, 288, 3156, 279, 198, 998, 268, 607, 374, 7154, 12414, 13, 578, 11754, 31316, 1253, 10205, 11, 5226, 11, 323, 28347, 1023, 198, 998, 288, 13, 11699, 11813, 1253, 13471, 279, 5015, 449, 1855, 3094, 323, 3719, 10269, 323, 58570, 13, 362, 198, 19221, 14095, 649, 1376, 323, 279, 32095, 649, 6859, 323, 3139, 63018, 13, 10541, 904, 31316, 1253, 198, 1395, 779, 11754, 11, 279, 2132, 47521, 1455, 3629, 13, 1102, 374, 6118, 5129, 1109, 279, 297, 339, 531, 7217, 627, 791, 22772, 423, 4931, 46, 6514, 574, 279, 1890, 439, 449, 30883, 45921, 919, 2345, 3983, 198, 360, 54865, 323, 279, 5623, 9435, 323, 1243, 264, 32623, 449, 3242, 651, 1245, 12466, 198, 76804, 927, 279, 69996, 13, 362, 471, 4034, 555, 279, 8893, 304, 2380, 2919, 5602, 279, 6784, 198, 46696, 505, 279, 409, 10365, 31316, 11, 8051, 279, 79212, 488, 14958, 13, 578, 6784, 2643, 198, 693, 264, 1938, 477, 1403, 3010, 422, 4400, 574, 2884, 311, 31859, 4495, 279, 198, 14991, 1659, 627, 3065, 17526, 964, 1669, 3083, 3247, 29031, 1372, 198, 7098, 40485, 649, 7958, 279, 35358, 12660, 304, 279, 2547, 11, 2737, 279, 7693, 13, 1676, 40485, 304, 198, 1820, 7693, 3135, 304, 1455, 13422, 505, 22936, 26800, 11, 539, 505, 19405, 13, 1102, 374, 198, 57753, 5938, 449, 14459, 12934, 69819, 11, 15631, 73336, 11, 10269, 7693, 11, 323, 7621, 7693, 13, 578, 198, 9233, 1101, 44072, 311, 1778, 79212, 1385, 315, 279, 7693, 439, 21536, 5438, 288, 11, 1579, 7058, 1132, 291, 4579, 11, 83665, 531, 7217, 11, 45921, 919, 11, 323, 35428, 993, 1759, 627, 16179, 55652, 4250, 387, 64688, 520, 420, 892, 11, 279, 264, 28075, 35104, 323, 198, 4338, 19975, 430, 19780, 279, 8624, 649, 387, 26310, 51512, 13, 31969, 315, 198, 277, 40485, 315, 279, 7693, 2011, 387, 15910, 2225, 520, 279, 4689, 5353, 323, 311, 279, 16337, 315, 198, 2497, 13803, 627, 791, 4689, 6514, 315, 279, 3575, 374, 279, 12014, 315, 701, 3070, 198, 42305, 12734, 11, 369, 279, 4553, 2547, 323, 1202, 4689, 31085, 1253, 387, 6532, 627, 99654, 1253, 21736, 4857, 709, 701, 13957, 449, 10173, 11, 10368, 11, 43685, 198, 26522, 8467, 11, 4785, 2585, 11, 323, 1023, 2574, 430, 2643, 35256, 701, 19433, 627, 7469, 6514, 1253, 2997, 4579, 2800, 11, 8798, 8522, 11, 12786, 396, 287, 11, 47955, 345, 47692, 15419, 11, 323, 279, 1005, 315, 11217, 13, 578, 3230, 11384, 690, 387, 7111, 520, 11, 1778, 198, 300, 22936, 42400, 11, 57596, 9547, 11, 11323, 780, 4787, 11, 83066, 2223, 42655, 345, 83, 372, 1105, 11, 19405, 11, 11134, 11, 62186, 11, 85160, 315, 279, 35855, 11, 8009, 26677, 11, 323, 198, 59961, 627, 16834, 423, 4931, 46, 439, 264, 2254, 6514, 11, 433, 753, 4461, 499, 4805, 387, 3025, 311, 1520, 6261, 264, 198, 47991, 3568, 13, 578, 2768, 68128, 315, 2512, 1253, 3041, 16337, 311, 264, 2579, 11, 4106, 11, 76193, 198, 47601, 50308, 10496, 11, 3508, 304, 279, 35428, 11, 279, 39448, 11, 477, 279, 2466, 31316, 13, 109588, 50308, 45713, 6013, 198, 84270, 1664, 311, 420, 10537, 512, 16, 198, 13, 720, 18590, 279, 1645, 98466, 4704, 3690, 10496, 449, 264, 12472, 315, 423, 4931, 46, 304, 922, 220, 2031, 71724, 198, 75337, 477, 264, 2697, 5190, 20545, 13, 4418, 1431, 733, 7953, 220, 1954, 3346, 1606, 198, 1820, 1749, 315, 42295, 430, 11263, 1253, 4546, 922, 264, 15748, 6930, 13010, 198, 1527, 279, 423, 4931, 46, 1234, 279, 4106, 15411, 13, 17, 198, 13, 720, 29597, 3892, 13931, 315, 29551, 342, 2933, 3059, 927, 279, 4553, 4579, 430, 753, 4704, 3690, 627, 18, 198, 13, 720, 65002, 1109, 19354, 279, 6930, 6089, 11, 499, 2643, 15411, 449, 279, 342, 2933, 3059, 1176, 323, 198, 3473, 94577, 349, 433, 449, 423, 4931, 46, 627, 19, 198, 13, 720, 31996, 279, 4459, 3158, 449, 23506, 11071, 287, 477, 15792, 32183, 23506, 627, 20, 198, 13, 720, 29597, 264, 6324, 315, 1344, 2659, 477, 6612, 430, 706, 1027, 73307, 304, 4106, 3090, 323, 3189, 2234, 198, 412, 627, 21, 198, 13, 720, 19648, 4106, 3090, 27474, 2212, 279, 4704, 3690, 3158, 477, 3504, 433, 449, 459, 9249, 198, 383, 1113, 11262, 20037, 304, 53984, 627, 22, 198, 13, 720, 48527, 304, 279, 8798, 555, 18702, 682, 279, 3485, 449, 24666, 53984, 627, 23, 198, 13, 720, 36, 3532, 349, 279, 4579, 323, 2531, 304, 4950, 311, 264, 2237, 449, 279, 4851, 627, 24, 198, 13, 720, 24433, 420, 6514, 369, 439, 1317, 439, 499, 527, 10882, 449, 433, 11, 719, 539, 198, 4930, 261, 1109, 53474, 4520, 369, 904, 3254, 3851, 627, 605, 198, 13, 720, 697, 10492, 279, 423, 4931, 46, 1475, 3116, 477, 4330, 4207, 11, 439, 4460, 627, 806, 198, 13, 720, 6153, 499, 4070, 1511, 420, 6514, 369, 30335, 4207, 320, 64, 7340, 315, 2380, 3115, 1350, 5514, 37095, 11, 27474, 11, 342, 2933, 3059, 11, 323, 11623, 279, 4579, 779, 439, 311, 1935, 1022, 904, 423, 4931, 46, 627, 29597, 264, 65464, 87942, 477, 297, 396, 479, 315, 279, 23100, 285, 606, 3070, 11, 477, 264, 35598, 92344, 311, 279, 198, 83, 2920, 4579, 627, 23389, 1516, 512, 7181, 430, 499, 527, 1701, 1403, 7739, 315, 15419, 304, 420, 10537, 2345, 198, 35, 4931, 46, 449, 1202, 7294, 67595, 6012, 11, 323, 21147, 8798, 449, 1202, 1866, 198, 258, 45864, 367, 5621, 1072, 6253, 2515, 13, 578, 8798, 5084, 311, 34454, 88, 3059, 279, 423, 4931, 46, 1139, 1524, 198, 66335, 27375, 13, 2030, 358, 28930, 430, 499, 649, 636, 2288, 1790, 315, 264, 423, 4931, 46, 6930, 198, 60307, 80078, 2288, 1790, 315, 459, 7294, 3502, 45864, 367, 2077, 13, 25619, 1790, 315, 4205, 198, 285, 912, 1695, 13, 15636, 11, 358, 16917, 4284, 430, 499, 1935, 61003, 449, 420, 198, 83, 35320, 11, 520, 3325, 279, 1176, 2478, 3115, 499, 1005, 433, 13, 13969, 13598, 279, 3044, 315, 198, 22479, 802, 339, 50308, 10496, 323, 279, 6930, 927, 433, 13, 4418, 1431, 2187, 6930, 66510, 311, 743, 304, 13, 12040, 198, 22479, 2547, 9499, 26, 422, 499, 3719, 520, 682, 34653, 819, 11, 834, 9726, 279, 10537, 627, 13319, 279, 3189, 23903, 439, 7633, 304, 3094, 45314, 323, 44276, 1820, 279, 4579, 13, 1115, 374, 264, 198, 12156, 398, 8147, 1648, 311, 9463, 279, 6532, 4579, 315, 459, 802, 339, 50308, 37140, 627, 644, 6725, 11, 304, 220, 5162, 20, 11, 420, 1749, 574, 1511, 449, 2450, 11, 719, 433, 574, 198, 2953, 1601, 291, 555, 264, 10896, 315, 7661, 23336, 16088, 889, 7020, 279, 3460, 315, 25481, 311, 198, 48956, 13, 578, 6784, 11, 55307, 11, 323, 1023, 12195, 315, 37140, 29496, 505, 264, 198, 23557, 753, 7693, 304, 279, 4579, 2512, 5274, 1418, 279, 8893, 25366, 264, 2678, 6514, 198, 3039, 13, 1283, 477, 1364, 4024, 2162, 2085, 44776, 11, 323, 279, 16337, 36513, 3892, 2919, 627, 39, 7527, 3651, 5745, 4082, 27563, 2507, 10714, 220, 1272, 3346, 315, 682, 11434, 889, 4034, 264, 7661, 10574, 2889, 656, 779, 15453, 1606, 315, 198, 19221, 323, 8579, 14095, 5435, 11, 323, 3278, 54350, 220, 1490, 3346, 315, 1521, 1274, 627, 28005, 14095, 82, 527, 6650, 82, 315, 38307, 6930, 11, 8965, 389, 279, 1948, 315, 279, 45713, 13, 25046, 198, 39730, 82, 3139, 1990, 279, 45713, 13, 11995, 4595, 649, 387, 6847, 39575, 505, 279, 198, 8416, 20438, 14932, 1124, 13, 25218, 264, 2653, 477, 8579, 14095, 374, 264, 8792, 76758, 11, 477, 198, 19494, 11, 315, 2653, 18004, 6930, 11, 323, 2212, 279, 4219, 374, 264, 26175, 4704, 3690, 10264, 315, 6930, 323, 198, 69, 17927, 13, 578, 10264, 374, 9408, 323, 14071, 13, 35567, 6118, 374, 279, 1925, 49648, 627, 791, 14095, 82, 2586, 505, 39676, 323, 7410, 40986, 505, 459, 16940, 198, 25475, 258, 768, 315, 17685, 13, 578, 17676, 6964, 389, 279, 31316, 17685, 10485, 82, 279, 6930, 505, 4871, 323, 198, 57753, 5076, 2269, 15154, 15653, 10485, 279, 6930, 505, 279, 4994, 13, 578, 6930, 9778, 198, 67, 552, 323, 22890, 709, 6324, 1306, 6324, 311, 1893, 279, 14095, 13, 79141, 7709, 323, 6784, 5376, 198, 300, 279, 14095, 28815, 627, 16298, 16066, 505, 14095, 82, 649, 387, 51512, 315, 872, 3575, 3060, 28191, 198, 269, 31859, 13, 37558, 706, 311, 2733, 279, 79930, 315, 2653, 14095, 82, 13, 55548, 16337, 198, 28156, 4400, 311, 5471, 279, 14095, 82, 505, 7982, 1578, 520, 279, 1890, 2035, 13, 1102, 374, 198, 79, 543, 54679, 627, 18590, 287, 423, 4931, 46, 389, 14095, 82, 574, 1120, 1778, 264, 13643, 6767, 13, 1102, 574, 2884, 1306, 198, 1820, 14095, 574, 66299, 311, 4148, 279, 38307, 6930, 14718, 44776, 13, 2360, 5413, 198, 4291, 4647, 645, 8148, 574, 5995, 1306, 67597, 54679, 14095, 17065, 422, 423, 4931, 46, 3851, 198, 19070, 291, 279, 10537, 26, 4869, 11, 279, 14095, 5246, 6052, 2085, 15690, 198, 1864, 13825, 315, 279, 16940, 293, 3633, 71199, 627, 26502, 86020, 198, 7368, 4881, 527, 12314, 6901, 32738, 315, 6930, 430, 1376, 389, 279, 4785, 92253, 27529, 315, 198, 1820, 7693, 13, 2435, 2586, 505, 6926, 39676, 323, 7410, 13, 578, 89961, 1650, 355, 198, 21470, 439, 832, 8040, 389, 279, 5041, 315, 279, 4579, 374, 539, 9498, 627, 2028, 3169, 315, 6136, 277, 1650, 355, 374, 23712, 555, 459, 4704, 3690, 2579, 31230, 323, 706, 15962, 198, 716, 2727, 1113, 279, 16940, 20438, 13, 1102, 374, 3629, 76193, 11, 4106, 11, 323, 26175, 323, 198, 69, 70941, 8111, 439, 264, 2653, 11, 9235, 11, 21281, 4908, 3148, 315, 14071, 819, 477, 18004, 819, 6930, 13, 1102, 198, 18864, 387, 12314, 304, 279, 4219, 323, 27115, 55035, 520, 279, 11314, 13, 25218, 1202, 4219, 1436, 198, 1395, 264, 5655, 11, 2653, 11, 18004, 8792, 3158, 430, 5084, 1093, 264, 1069, 60980, 994, 7108, 627, 18433, 279, 12314, 6901, 6930, 315, 1650, 4881, 33291, 1202, 95916, 11, 279, 6930, 912, 720, 4930, 261, 198, 267, 2171, 8696, 311, 4725, 3160, 4028, 279, 5041, 315, 279, 4579, 994, 279, 7693, 527, 5882, 291, 627, 9673, 1650, 4881, 2873, 311, 1054, 22464, 49216, 32148, 91852, 6514, 3445, 8873, 10831, 279, 4785, 389, 279, 4579, 198, 4291, 33445, 30299, 14546, 7766, 24634, 304, 279, 15653, 13, 91554, 1253, 387, 32031, 1006, 1944, 55827, 2643, 387, 5614, 13, 2582, 34933, 27358, 315, 279, 6532, 2322, 44958, 278, 17685, 198, 438, 279, 5938, 71895, 315, 279, 45713, 1253, 387, 2631, 13, 7648, 315, 279, 892, 279, 198, 9164, 449, 1650, 4881, 5900, 311, 617, 1124, 98111, 3201, 13, 1442, 423, 4931, 46, 374, 2231, 389, 1306, 1778, 198, 45252, 11, 912, 4647, 645, 8148, 5413, 374, 2631, 311, 9463, 279, 3158, 315, 8541, 29668, 13, 4452, 345, 35, 4931, 46, 1587, 539, 64855, 279, 21281, 4908, 6930, 2085, 1778, 17065, 1176, 627, 2989, 2891, 946, 468, 3065, 50, 198, 55747, 277, 289, 7183, 3139, 389, 279, 13612, 315, 279, 4579, 439, 9408, 326, 12055, 315, 26000, 13, 2435, 527, 198, 8123, 625, 36254, 12970, 6650, 82, 430, 527, 1664, 17665, 449, 6680, 31080, 323, 50581, 627, 2675, 1253, 16930, 1124, 369, 14095, 82, 477, 1650, 4881, 1606, 814, 527, 9960, 449, 1650, 355, 198, 83, 11407, 323, 1606, 814, 13194, 627, 791, 6136, 277, 61045, 374, 281, 22928, 4251, 11, 8579, 323, 274, 621, 4680, 11, 323, 706, 13987, 19300, 11, 3776, 345, 65561, 11, 477, 2579, 11, 304, 1202, 4219, 13, 4314, 19300, 527, 279, 6680, 31080, 13, 40155, 52139, 729, 279, 198, 36708, 779, 430, 433, 8625, 12314, 6901, 323, 11413, 304, 10651, 13, 650, 661, 287, 304, 1404, 505, 264, 198, 13576, 2025, 311, 264, 15310, 8502, 11, 433, 1253, 3139, 3060, 35044, 398, 477, 304, 28066, 13, 1102, 44164, 198, 325, 424, 989, 994, 9160, 2454, 627, 644, 42861, 311, 279, 6136, 277, 315, 279, 4579, 6276, 20396, 315, 264, 17188, 1139, 279, 6930, 430, 1253, 198, 1593, 279, 6136, 277, 61045, 311, 3139, 13, 763, 2144, 11, 1070, 527, 61045, 15956, 11, 1884, 3115, 304, 279, 198, 63666, 994, 1274, 4321, 12743, 5447, 323, 43100, 1082, 279, 93650, 315, 872, 7693 ]
0xBreath/holistic-books
is low in calories, but it is fully consistent physiological needs of the organism. Hunza rarely eat meat and very little drink of milk. Proteins, they are mainly produced from bread that is baked from wheat and barley, always with an admixture bran. These grains and their husks apart proteins contain calcium and mineral salts. Hunza eat brown rice, the husk is contains vitamin. and in mineral salts, as well as potatoes directly with the skin - it is especially a lot of protein and mineral salts. a large number of Hunza consume beans and all sorts of herbs, including common grass. But the main thing in their diet - Fresh and dried fruits. Apples and apricots that they are eating together with bones, more important to them bread. Due to such rigid diet, these people are extremely hardy. For example, pass 100 - 200 km in a few days for them is the same as that for us the evening walk... Hunza is always in a good mood, never get angry and do not quarrel among themselves, quietly endure physical pain and any adversity. "In the Hunza nerves strong as ropes, and the heart gentle and compassionate, "- says the scientist. As a result, Mack did Kerison concluded that it was the food has a definite impact on both our 255 255physical health, and on the state of mind. No malnutrition and the lack of calories causes the disease... and quality - of what we eat. So, if the diet lacks certain nutrients that are found only in natural plant foods can be seriously damaged in the first place our psyche... Most people eat too much is not so much to satisfy hunger, but for the gastronomic pleasures. Hunza is work hard, but eat little and not get sick. Hence, what man eats less and is easier than its food, the more chances he has closer to the ideal of health and happiness. The experience of Mac Kerisona, which in science is known as Experiment Kennels "- the location of his laboratory. The researcher shared thousands of experimental rats into three groups according to three groups: "Whitechapel" (District London), "Hunza" and "Indians." All of them were kept in the same conditions, but a group of "Whitechapel" received food that Londoners consume (ie, one that Europeans eat) - white bread products made with white flour, jam, meat, salt, canned food, eggs, sweets, cooked vegetables, etc., Rat-"Hunza" received the same food, that the people of this tribe. Rat "Indians" food, typical Hindus and people of the East. Mack Kerison investigate the state health of a generation who received three different diets, and opened interesting pattern. Animals from "Whitechapel" ill with all diseases, that affect the residents of London, ranging from childhood diseases and ending chronic and senile illnesses. This group was rather nervous and belligerent, rat bite each other and even bite to death "compatriots" to death. Rat "Indians" for health and overall behavior were similar to people who embody in this experiment. A rat "Hunza" remained healthy and cheerful, spent time in games and relaxing holiday. What can be learned from these observations? 1. First of all: neither the climate nor religion, nor customs, nor the race is not appreciable effect on health - is important only food. 2. Food, and not something else can turn healthy people in patients: it is enough to remove from the diet of some substances considered, according to most people, unimportant, ie, enzymes, amino acids, vitamins, minerals, fatty acids, which are only in the plant world, and which benefit only when they are used in its natural form. 3. The amount of food and its high energy value, ie, calories, do not have any relation to health. Important composition of food. 4. Even the morale of the individual may suffer if in a diet lacking certain nutrients. 256 256Rats that lived in peace and friendship among themselves, became aggressive and devouring each other when they are denied full food needed for health. This indicates that any social unrest, revolution and war depend on the incorrect human nutrition. Does not correspond to the nature of human food, not its weakness as claimed by politicians, to blame for the bad state of society. Thus, the quality of food, its composition, quantity, method use and combination of influence on the preservation of health, safeguard from diseases, maintain youthfulness. Depend on the quality of nutrition and mental health, mental balance, lack of neuroses and mental disorders. To get a good quality therapeutic effect of dry fasting, for it should ideally be prepared. Good preconditioning is carried out for 2-3 months before starvation and is designed to release the body against endotoxin. It consists in carrying out various cleaning procedures and changes in diet. Good, quality food will allow the body to store up necessary during the fasting vitality, create conditions for full, high-quality purification. Edit nutrition, clean the intestines and liver. If you do not, that during a famine in the crude as a result of the large intestine enzymatic processes of decomposition of faeces produced mass poisonous gases (indole, skatole, hydrogen sulfide and others), which Imbibing in the blood, pass around the body, causing severe intoxication, and then as a bad breath and the smell of output through the lungs and skin. Spending so hungry person feels only pain and weakness. There is no feeling better in time Hunger is not observed. After preconditioning, the output endotoxins on hunger will not be so powerful and you can easily spend a few wet training starvation. And only then can be conducted dry starvation. How did need to eat to be healthy? Reply quite simple: when choosing foods should take an example with longevity. To determine the "longevity diet, researchers detail studied and described the food of different regions of our centenarians planet. However, to recommend on the basis of information obtained a universal diet has proved impossible. The fact that the power of longevity associated with the region of residence and national traditions. For example, in Bulgaria's dominant vegetable and dairy foods, and in Yakutia - animal products. Whom should I take the example and what foods to choose: vegetable or animals? The answer is simple enough: we must eat of the food that most available in vivo. in cold climate (north and winter in the mid-latitudes) is better to use 257 257warms the body fat vegetarian diet, in the heat (tropical and summer) - a cooling plant. So naturally, that the northern peoples for centuries eat venison, Eskimos - meat of whales and walruses by adding seal fat, and the residents Located near the equator of the village Vilkabamba animal fats constitute only two percent of total calories consumed food, while life expectancy in this village more than a hundred years! a famous Abkhaz centenarians observed required at mid-latitudes climatic seasons supply: in autumn and especially in the winter is dominated by meat products from Dairy - cheese and yoghurt, spring and summer - flour products, vegetables and dairy products. Based on the foregoing, we can formulate the first rule of natural power: the choice of food a person should take into account the climatic conditions (ambient temperature environment) in which it is located. Indigenous peoples have genetically adapted to the natural Natural Nutrition and resettlement in other climatic conditions need to be familiar to a food. Why? The researchers found that the muscles of any person consist of muscle fibers of two types - red and white (hence - the name opposing sides in a civil war? "), which differ significantly among themselves. In muscle indigenous tropical countries is dominated by white fibers are used as "fuel" glucose from the blood. The number of such fibers in the muscles of the individual reaches 90%. Since the body can not store glucose in significant numbers, then those people need regular (Not less than three times a day) consumption of plant foods, which rapidly digested and replenishes the blood necessary for the operation muscle glucose. If you stay for people with muscles in the mid-latitudes efficiency is markedly reduced in the winter, since they have warming them to eat animal products, significantly reducing the amount of natural plant foods for themselves. But regular users of fats used for muscle only in very small quantities, and eventually in humans there obesity, atherosclerosis, diabetes (obese), ulcers and other disease due to increased acidity of the body. In muscle korennh of people living in cold climates the number of red fibers, which are used for work not glucose and fats, reaches up to 96%! The main part of the daily diet power required (even in hot summer!) includes a sufficient amount of animal fats, such people useful to use evening as night fats in large numbers stored in the muscle fibers and then slowly used during the day. 258 258When eating in hot climates mainly plant food such people there is an obvious weight loss, fast fatigue and reluctance to move, as well as nervous exhaustion due to lack of fat, and (as a consequence) of excess alk
[ 374, 3428, 304, 25247, 11, 719, 433, 374, 7373, 13263, 198, 42305, 41314, 3966, 315, 279, 47120, 13, 14834, 4458, 19029, 8343, 13339, 198, 438, 1633, 2697, 7172, 315, 14403, 13, 15542, 1354, 11, 814, 527, 14918, 9124, 505, 198, 48616, 430, 374, 41778, 505, 34153, 323, 81817, 11, 2744, 449, 459, 14933, 13025, 198, 1347, 276, 13, 4314, 41936, 323, 872, 9222, 2857, 10980, 28896, 6782, 35719, 198, 438, 25107, 78235, 13, 14834, 4458, 8343, 14198, 20228, 11, 279, 9222, 74, 374, 198, 13676, 28170, 13, 323, 304, 25107, 78235, 11, 439, 1664, 439, 35267, 6089, 198, 4291, 279, 6930, 482, 433, 374, 5423, 264, 2763, 315, 13128, 323, 25107, 78235, 627, 64, 3544, 1396, 315, 14834, 4458, 25024, 27994, 323, 682, 21522, 315, 198, 1964, 1302, 11, 2737, 4279, 16763, 13, 2030, 279, 1925, 3245, 304, 872, 10173, 198, 12, 30260, 323, 32720, 26390, 13, 1883, 645, 323, 21726, 292, 2469, 430, 814, 527, 12459, 198, 998, 3522, 449, 25896, 11, 810, 3062, 311, 1124, 16385, 13, 24586, 311, 1778, 33956, 198, 94942, 11, 1521, 1274, 527, 9193, 2653, 88, 13, 1789, 3187, 11, 1522, 220, 1041, 18722, 1049, 13437, 304, 264, 2478, 2919, 369, 1124, 374, 279, 1890, 439, 430, 369, 603, 279, 11714, 198, 19599, 2564, 14834, 4458, 374, 2744, 304, 264, 1695, 20247, 11, 2646, 636, 19021, 198, 438, 656, 539, 37965, 3833, 4315, 5694, 11, 30666, 46753, 7106, 6784, 198, 438, 904, 90930, 13, 330, 644, 279, 14834, 4458, 50581, 3831, 439, 65046, 11, 323, 279, 4851, 198, 16149, 273, 323, 60961, 11, 6660, 2795, 279, 28568, 13, 1666, 264, 1121, 11, 33491, 1550, 36258, 3416, 198, 444, 10391, 430, 433, 574, 279, 3691, 706, 264, 44870, 5536, 389, 2225, 1057, 198, 3192, 198, 3192, 47692, 2890, 11, 323, 389, 279, 1614, 315, 4059, 13, 2360, 8811, 83664, 198, 438, 279, 6996, 315, 25247, 11384, 279, 8624, 2564, 323, 4367, 482, 315, 198, 12840, 584, 8343, 13, 2100, 11, 422, 279, 10173, 37856, 3738, 198, 24217, 32930, 430, 527, 1766, 1193, 304, 5933, 198, 21494, 15657, 649, 387, 14243, 20727, 304, 279, 1176, 2035, 198, 414, 88909, 2564, 7648, 1274, 8343, 2288, 1790, 374, 539, 779, 1790, 198, 998, 27651, 34906, 11, 719, 369, 279, 56780, 48228, 72974, 13, 14834, 4458, 374, 198, 1816, 2653, 11, 719, 8343, 2697, 323, 539, 636, 14363, 13, 32140, 11, 1148, 198, 1543, 50777, 2753, 323, 374, 8831, 1109, 1202, 3691, 11, 279, 810, 17393, 568, 706, 198, 33678, 805, 311, 279, 10728, 315, 2890, 323, 23871, 627, 791, 3217, 315, 7553, 36258, 3416, 64, 11, 902, 304, 8198, 374, 3967, 439, 198, 78880, 15739, 2053, 6660, 279, 3813, 315, 813, 27692, 627, 791, 32185, 6222, 9214, 315, 22772, 32510, 1139, 2380, 5315, 198, 74946, 311, 2380, 5315, 25, 330, 14404, 331, 82200, 1, 320, 48940, 198, 40672, 705, 330, 39, 359, 4458, 1, 323, 330, 1451, 5493, 1210, 2052, 315, 1124, 1051, 8774, 304, 279, 1890, 198, 16902, 11, 719, 264, 1912, 315, 330, 14404, 331, 82200, 1, 4036, 3691, 430, 198, 40672, 388, 25024, 320, 648, 11, 832, 430, 51607, 8343, 8, 482, 4251, 198, 48616, 3956, 1903, 449, 4251, 20415, 11, 20673, 11, 13339, 11, 12290, 11, 64114, 3691, 11, 19335, 345, 82, 26488, 11, 30205, 24822, 11, 5099, 2637, 41677, 28751, 39, 359, 4458, 1, 4036, 279, 1890, 3691, 345, 9210, 279, 1274, 315, 420, 34671, 13, 41677, 330, 1451, 5493, 1, 3691, 11, 14595, 198, 39, 485, 355, 323, 1274, 315, 279, 6460, 13, 33491, 36258, 3416, 19874, 279, 1614, 198, 12393, 315, 264, 9659, 889, 4036, 2380, 2204, 41943, 11, 323, 9107, 198, 88657, 5497, 627, 19933, 1147, 505, 330, 14404, 331, 82200, 1, 5986, 449, 682, 19338, 345, 9210, 7958, 279, 11062, 315, 7295, 11, 24950, 505, 20587, 19338, 198, 438, 13696, 21249, 323, 6252, 458, 49909, 13, 1115, 1912, 574, 198, 74303, 23418, 323, 293, 6842, 261, 306, 11, 11494, 23556, 1855, 1023, 323, 1524, 198, 91035, 311, 4648, 330, 5807, 2416, 2469, 1, 311, 4648, 627, 49, 266, 330, 1451, 5493, 1, 369, 2890, 323, 8244, 7865, 198, 52898, 4528, 311, 1274, 889, 81658, 198, 258, 420, 9526, 13, 362, 11494, 330, 39, 359, 4458, 1, 14958, 9498, 198, 438, 71414, 11, 7543, 892, 304, 3953, 323, 34948, 13560, 627, 3923, 649, 387, 9687, 505, 1521, 24654, 5380, 16, 13, 5629, 315, 682, 25, 14188, 279, 10182, 6463, 13901, 11, 6463, 35869, 11, 6463, 279, 7102, 374, 539, 198, 680, 2827, 2205, 2515, 389, 2890, 482, 374, 3062, 1193, 198, 14239, 627, 17, 13, 12369, 11, 323, 539, 2555, 775, 649, 2543, 9498, 1274, 198, 258, 6978, 25, 433, 374, 3403, 311, 4148, 505, 279, 10173, 315, 1063, 33155, 198, 25742, 291, 11, 4184, 311, 1455, 1274, 11, 653, 15693, 345, 648, 11, 56067, 11, 42500, 33969, 11, 46192, 11, 34072, 11, 40085, 198, 582, 3447, 11, 902, 527, 1193, 304, 279, 6136, 1917, 11, 323, 902, 198, 68244, 275, 1193, 994, 814, 527, 1511, 304, 1202, 5933, 1376, 627, 18, 13, 578, 3392, 315, 3691, 323, 1202, 1579, 4907, 907, 11, 30958, 345, 5531, 2490, 11, 656, 539, 617, 904, 12976, 311, 2890, 13, 44921, 198, 77907, 315, 3691, 627, 19, 13, 7570, 279, 63683, 315, 279, 3927, 1253, 7831, 422, 198, 258, 264, 10173, 32161, 3738, 37493, 627, 4146, 198, 4146, 49, 1900, 430, 12439, 304, 9096, 323, 27607, 4315, 5694, 11, 6244, 198, 351, 47819, 323, 88289, 287, 1855, 1023, 994, 814, 527, 15164, 2539, 198, 14239, 4460, 369, 2890, 13, 1115, 15151, 430, 904, 198, 23191, 59322, 11, 14110, 323, 4208, 6904, 389, 279, 15465, 198, 26380, 26677, 627, 22186, 539, 8024, 311, 279, 7138, 315, 3823, 3691, 11, 539, 1202, 23948, 198, 300, 11922, 555, 19287, 11, 311, 19065, 369, 279, 3958, 1614, 315, 8396, 627, 45600, 11, 279, 4367, 315, 3691, 11, 1202, 18528, 11, 12472, 11, 1749, 198, 817, 323, 10824, 315, 10383, 389, 279, 46643, 315, 2890, 11, 49071, 198, 1527, 19338, 11, 10519, 12822, 31514, 627, 7996, 408, 389, 279, 4367, 315, 26677, 323, 10723, 2890, 11, 10723, 198, 22298, 11, 6996, 315, 18247, 9459, 323, 10723, 24673, 627, 1271, 636, 264, 1695, 4367, 37471, 2515, 315, 198, 54310, 54560, 11, 369, 433, 1288, 50663, 387, 10235, 13, 7839, 198, 1762, 9233, 287, 374, 11953, 704, 369, 220, 17, 12, 18, 4038, 1603, 198, 12134, 61428, 323, 374, 6319, 311, 4984, 279, 2547, 2403, 842, 2117, 59866, 627, 2181, 17610, 304, 15691, 704, 5370, 16204, 16346, 198, 438, 4442, 304, 10173, 627, 15571, 11, 4367, 3691, 690, 2187, 279, 2547, 311, 3637, 709, 198, 95317, 2391, 279, 54560, 75716, 11, 1893, 198, 16902, 369, 2539, 11, 1579, 22867, 94536, 13, 8505, 198, 83664, 11, 4335, 279, 39408, 1572, 323, 26587, 13, 1442, 499, 656, 539, 345, 9210, 2391, 264, 79054, 304, 279, 35750, 439, 264, 1121, 315, 279, 3544, 92234, 198, 17007, 1631, 780, 11618, 315, 66266, 315, 2267, 762, 288, 9124, 3148, 198, 5481, 3416, 788, 45612, 320, 485, 1286, 11, 1940, 266, 1286, 11, 35784, 40769, 579, 323, 3885, 705, 902, 198, 1453, 58380, 287, 304, 279, 6680, 11, 1522, 2212, 279, 2547, 11, 14718, 15748, 198, 396, 5241, 20901, 11, 323, 1243, 439, 264, 3958, 11745, 323, 279, 22843, 315, 2612, 198, 20322, 279, 45274, 323, 6930, 13, 87753, 779, 30056, 1732, 11321, 1193, 198, 92724, 323, 23948, 13, 2684, 374, 912, 8430, 2731, 304, 892, 198, 39, 72722, 374, 539, 13468, 13, 4740, 80538, 287, 11, 279, 2612, 198, 408, 2117, 87, 1354, 389, 34906, 690, 539, 387, 779, 8147, 323, 499, 649, 6847, 198, 2203, 408, 264, 2478, 14739, 4967, 78245, 13, 1628, 1193, 1243, 198, 4919, 387, 13375, 9235, 78245, 627, 4438, 1550, 1205, 311, 8343, 311, 387, 9498, 30, 18321, 198, 84270, 4382, 25, 994, 19301, 15657, 1288, 1935, 459, 3187, 198, 4291, 58219, 627, 1271, 8417, 279, 330, 4930, 52779, 10173, 11, 12074, 7872, 198, 76443, 1142, 323, 7633, 279, 3691, 315, 2204, 13918, 315, 1057, 2960, 268, 30627, 198, 51174, 13, 4452, 11, 311, 7079, 389, 279, 8197, 315, 2038, 12457, 198, 64, 20789, 10173, 706, 19168, 12266, 627, 791, 2144, 430, 279, 2410, 315, 58219, 5938, 449, 279, 5654, 315, 22423, 198, 438, 5426, 32006, 13, 1789, 3187, 11, 304, 59819, 596, 25462, 198, 83571, 481, 323, 34479, 15657, 11, 323, 304, 71968, 332, 689, 482, 10065, 3956, 627, 1671, 316, 1288, 358, 1935, 279, 3187, 323, 1148, 15657, 311, 5268, 25, 36581, 477, 198, 77896, 30, 578, 4320, 374, 4382, 3403, 25, 584, 2011, 8343, 315, 279, 3691, 430, 198, 3646, 2561, 304, 41294, 13, 304, 9439, 198, 94874, 320, 62995, 323, 12688, 304, 279, 5209, 99514, 21237, 8, 374, 2731, 311, 1005, 198, 15574, 198, 15574, 11710, 1026, 279, 2547, 8834, 46482, 10173, 11, 304, 279, 8798, 320, 83, 51172, 198, 438, 7474, 8, 482, 264, 28015, 6136, 13, 2100, 18182, 345, 9210, 279, 18671, 32538, 369, 24552, 8343, 11457, 3416, 11, 59469, 25075, 18722, 2727, 266, 315, 57874, 323, 41926, 81, 4881, 555, 7999, 26418, 8834, 11, 323, 279, 11062, 198, 48852, 3221, 279, 3312, 859, 315, 279, 14458, 650, 34263, 370, 43008, 10065, 50127, 198, 1040, 275, 1088, 1193, 1403, 3346, 315, 2860, 25247, 27073, 198, 14239, 11, 1418, 2324, 66995, 304, 420, 14458, 198, 6518, 1109, 264, 7895, 1667, 0, 264, 11495, 3765, 31764, 1394, 2960, 268, 30627, 13468, 198, 6413, 520, 5209, 99514, 21237, 11323, 780, 15956, 8312, 512, 258, 42774, 323, 5423, 304, 279, 12688, 374, 30801, 555, 13339, 3956, 505, 198, 35, 22704, 482, 17604, 323, 42453, 71, 5757, 11, 10683, 323, 7474, 482, 20415, 3956, 345, 83571, 4893, 323, 34479, 3956, 627, 29815, 389, 279, 88931, 11, 584, 649, 89959, 279, 1176, 198, 13233, 315, 5933, 2410, 25, 279, 5873, 315, 3691, 264, 1732, 1288, 198, 23609, 1139, 2759, 279, 11323, 780, 4787, 320, 60714, 9499, 198, 24175, 8, 304, 902, 433, 374, 7559, 627, 1451, 26424, 32538, 617, 52033, 30464, 311, 279, 5933, 198, 55381, 39700, 323, 91488, 1001, 304, 1023, 11323, 780, 198, 16902, 1205, 311, 387, 11537, 311, 264, 3691, 13, 8595, 5380, 791, 12074, 1766, 430, 279, 24569, 315, 904, 1732, 6824, 315, 198, 38827, 9326, 49774, 315, 1403, 4595, 482, 2579, 323, 4251, 320, 71, 768, 482, 279, 836, 198, 454, 8478, 11314, 304, 264, 8431, 4208, 30, 60412, 902, 198, 67, 14657, 12207, 4315, 5694, 627, 644, 16124, 39678, 35148, 5961, 374, 30801, 555, 4251, 198, 76426, 388, 527, 1511, 439, 330, 64475, 1, 34323, 505, 279, 6680, 627, 791, 1396, 315, 1778, 49774, 304, 279, 24569, 315, 279, 3927, 25501, 198, 1954, 14697, 8876, 279, 2547, 649, 539, 3637, 34323, 198, 258, 5199, 5219, 11, 1243, 1884, 1274, 1205, 5912, 198, 7, 2688, 2753, 1109, 2380, 3115, 264, 1938, 8, 15652, 315, 6136, 15657, 11, 902, 198, 86812, 398, 4170, 10185, 323, 70543, 21168, 279, 6680, 5995, 369, 279, 5784, 198, 38827, 9326, 34323, 627, 2746, 499, 4822, 369, 1274, 449, 24569, 304, 279, 5209, 99514, 21237, 198, 6581, 10603, 374, 88101, 11293, 304, 279, 12688, 11, 2533, 814, 617, 198, 86, 34002, 1124, 311, 8343, 10065, 3956, 11, 12207, 198, 265, 1072, 6253, 279, 3392, 315, 5933, 6136, 15657, 369, 5694, 13, 2030, 198, 23108, 3932, 315, 50127, 1511, 369, 16124, 198, 3323, 304, 1633, 2678, 33776, 11, 323, 9778, 304, 12966, 198, 19041, 33048, 11, 264, 91882, 91711, 11, 20335, 320, 677, 2423, 705, 8725, 17254, 323, 1023, 198, 67, 56407, 4245, 311, 7319, 98026, 315, 279, 2547, 627, 644, 16124, 597, 461, 7521, 71, 315, 1274, 5496, 304, 9439, 92399, 198, 1820, 1396, 315, 2579, 49774, 11, 902, 527, 1511, 369, 990, 539, 198, 6200, 94697, 323, 50127, 11, 25501, 709, 311, 220, 4161, 90520, 578, 1925, 961, 315, 279, 7446, 10173, 198, 13477, 2631, 320, 17206, 304, 4106, 7474, 16715, 5764, 264, 14343, 198, 6173, 315, 10065, 50127, 11, 1778, 1274, 5505, 311, 1005, 198, 17206, 287, 439, 3814, 50127, 304, 3544, 5219, 198, 72349, 304, 279, 16124, 49774, 323, 1243, 14297, 1511, 198, 82977, 279, 1938, 627, 15966, 198, 15966, 4599, 12459, 304, 4106, 92399, 14918, 6136, 198, 14239, 1778, 1274, 1070, 374, 459, 8196, 4785, 4814, 11, 5043, 198, 45283, 22711, 323, 84050, 311, 3351, 11, 439, 1664, 439, 23418, 70663, 4245, 311, 198, 105516, 315, 8834, 11, 323, 320, 300, 264, 29774, 8, 315, 13937, 58998 ]
0xBreath/holistic-books
ine and morphine. Caution Marijuana is a controlled substance in North America. Research your local laws. Marijuana leaf Capparis spinosa (Capparaceae) Caper Description Shrub growing to 3 ft (1 m), with spiny trailing stems, fleshy oval leaves, green buds, large white flowers, and red berries in autumn. Habitat & Cultivation Native to the Mediterranean region, caper thrives in open areas, often growing on stony terrain. The buds are harvested before the flowers open and are pickled for culinary use. Parts Used Root bark, bark, flower buds. Constituents Contains phenolic compounds. History & Folklore Though much favored as a piquant food by the ancient Greeks, capers were said to disagree with the stomach. They remain a popular condiment to this day. Medicinal Actions & Uses The unopened flower buds are laxative and, if prepared correctly with vinegar, are thought to ease stomach pain. The bark is bitter and diuretic and can be taken immediately before meals to increase the appetite. US_180-201_Brassica_dictamnus.indd 182 26/02/16 12:47 pm183Cari Ca papayaother medicinal plants The root bark is purifying and stops internal bleeding. It is used to treat skin conditions, capillary weakness, and easy bruising, and is also used in cosmetic preparations. A decoction of the plant is used to treat yeast and vaginal infections such as candidiasis. Related Species A decoction of the North American C. cynophallophora is taken to encourage the onset of menstruation, and is used as a gargle for throat infections. Capsella bursa-pastoris syn. Thlaspi bursa-pastoris (Brassicaceae) Shepherd’s Purse Description Annual or biennial with an erect stem, rosette of basal leaves, 4-petaled white flowers, and heart-shaped seed pods. Habitat & Cultivation Thought to be native to Europe and Asia, shepherd’s purse is now found throughout most temperate regions, and grows profusely as a weed. It is harvested throughout the year. Parts Used Aerial parts. Constituents Contains flavonoids, polypeptides, choline, acetylcholine, histamine, and tyramine. History & Folklore This herb’s name derives from the appearance of the seed pods, which resemble heart-shaped purses. During the First World War, when the standard herbal medicines for staunching blood—goldenseal ( Hydrastis canadensis, p. 105) and ergot ( Claviceps purpurea )—were unobtainable in Britain, shepherd’s purse was used as an alternative. Medicinal Actions & Uses One of the best remedies for preventing or arresting hemorrhage, shepherd’s purse has long been a specific treatment for heavy uterine bleeding. While weaker-acting in this respect than ergot, shepherd’s purse has none of ergot’s toxicity and is better tolerated by the body. It may be used for bleeding of all kinds—from nosebleeds to blood in the urine. An astringent herb, it disinfects the urinary tract in cases of cystitis, and is taken for diarrhea. It is used in Chinese medicine to treat dysentery and eye problems. Research Reports suggest that the plant is anti-inflammatory and reduces fever. Caution Do not take during pregnancy. Self-help Use Heavy menstrual bleeding, p. 315. Cardiospermum spp. (Sapindaceae) Balloon Vine Description Deciduous perennial climbers growing to 10 ft (3 m), with compound leaves, small white flowers, and black seeds. Habitat & Cultivation Balloon vine is found growing in tropical regions around the world. Parts Used Root, leaves, seeds.Constituents Most Cardiospermum species contain cyanogenic glycosides. History & Folklore Native Amazonians string balloon vine seeds into armbands that are worn to ward off snakes. Medicinal Actions & Uses In Indian herbal medicine, balloon vine root is used to bring on delayed menstruation and to relieve backache and arthritis. The leaves stimulate local circulation and are applied to painful joints to help speed the clearing of toxins. The seeds are also thought to help in the treatment of arthritis. The plant as a whole has sedative properties. Caution Do not take during pregnancy. Carica papaya (Caricaceae) Papaya Description Herbaceous tree growing very rapidly to 26 ft (8 m). Has segmented leaves, yellow flowers, and large, black-seeded yellow to orange fruits weighing up to 11 lb (5 kg). Habitat & Cultivation Native to tropical America, papaya is now cultivated in tropical regions throughout the world. Parts Used Fruit, latex, leaves, flowers, seeds. Constituents The fruit contains proteolytic enzymes (papain and chymopapain), and traces of an alkaloid, carpaine. Papain, which is found in the milky white latex that flows from incisions in the unripe fruit, is a protein-dissolving enzyme that aids digestion. History & Folklore Papaya juice, shoots, and latex were used in Mayan herbal medicine. In tropical Latin America, the leaves are used as a meat tenderizer. Medicinal Actions & Uses Papaya’s main medicinal use is as a digestive agent. The leaves and the fruit can both be used (the unripe fruit is especially effective). The latex from the trunk of the tree is applied externally to speed the healing of wounds, ulcers, boils, warts, and cancerous tumors. The seeds are used as a gentle purgative for worms. The latex has a similar but more violent effect. The flowers may be taken in an infusion to induce menstruation, and a decoction of the ripe fruit is helpful for treating persistent diarrhea and dysentery in children. The ripe fruit is mildly laxative and the leaves are used to dress wounds.Caper’s buds pickled with vinegar have been used as a condiment since ancient times. Balloon vine leaves are applied to relieve aching joints. Fruit US_180-201_Brassica_dictamnus.indd 183 07/04/16 4:37 pm 184Carthamus tinC torius other medicinal plantsCarthamus tinctorius (Asteraceae) Safflower, Hong Hua (Chinese) Description Annual herb growing to 3 ft (90 cm). Has long spiny leaves with 6 oblong-oval leaflets, and groups of yellow flowers arising from the leaf axils. Habitat & Cultivation Thought to be native to Iran and northwestern India, this herb is also found in North America and the Far East. It grows in open areas and is gathered in summer. Parts Used Flowers, seeds, seed oil. Constituents Safflower contains lignans, polysaccharides and a volatile oil. The seeds contain a fixed oil, up to 80% linoleic acid. History & Folklore In 19th century North American herbal medicine, safflower was used to induce sweating, to promote the onset of a menstrual period and as a treatment for measles. Safflower flowers are falsely sold as saffron (Crocus sativus, p. 89). Medicinal Actions & Uses In Chinese herbal medicine, the flowers are given to stimulate menstruation and to relieve abdominal pain. The flowers are also used to cleanse and heal wounds and sores and to treat measles. In the Anglo-American herbal tradition, the flowers are given as a treatment for fever and skin rashes. The unpurified seed oil is purgative. Research Chinese research indicates that safflower flowers can reduce coronary artery disease, and lower cholesterol levels. Safflower contains a polysaccharide that has been shown to stimulate immune function in mice. Safflower oil also lowers cholesterol levels. Caution Do not take the flowers or seeds during pregnancy (seed oil is safe). Carum carvi (Apiaceae) Caraway Description Aromatic annual growing to 2 ft (60 cm). Has ridged stem, feathery leaves, and umbels of white flowers in midsummer. Exploding capsules each contain 2 small narrow seeds. Habitat & Cultivation Caraway grows wild in Europe, North Africa, and Asia. It prefers sunny sites up to 6,600 ft (2,000 m) above sea level. It is cultivated in Europe, Russia, North Africa, and the US, and the seeds are harvested ripe in late summer. Parts Used Seeds, essential oil. Constituents Caraway contains a volatile oil high in carvone (about 50%) and limonene. It also contains a fixed oil, flavonoids, polysaccharides, proteins, and furanocoumar
[ 483, 323, 27448, 483, 627, 23389, 1516, 220, 65939, 374, 264, 14400, 20278, 304, 720, 26287, 5270, 13, 8483, 701, 2254, 7016, 13, 65939, 16312, 198, 34, 680, 42960, 12903, 12252, 320, 34, 680, 277, 114785, 340, 34, 3271, 198, 5116, 220, 1443, 60530, 7982, 311, 220, 18, 10702, 320, 16, 296, 705, 449, 720, 2203, 6577, 28848, 44814, 11, 282, 645, 8671, 61137, 11141, 11, 6307, 68543, 11, 720, 17185, 4251, 19837, 11, 323, 2579, 63494, 304, 42774, 627, 39, 40027, 266, 612, 26676, 40227, 17118, 311, 279, 720, 44, 3671, 618, 33561, 5654, 11, 2107, 261, 8983, 1924, 304, 1825, 5789, 11, 3629, 7982, 389, 357, 3633, 25911, 13, 578, 68543, 527, 67572, 1603, 279, 19837, 1825, 323, 527, 3820, 839, 369, 58441, 1005, 627, 30021, 12477, 220, 19385, 54842, 11, 54842, 11, 23153, 68543, 627, 1128, 3781, 84, 812, 220, 31911, 14345, 7918, 32246, 627, 13730, 612, 65337, 20763, 220, 18056, 1790, 46603, 439, 264, 720, 2554, 31548, 3691, 555, 279, 14154, 61780, 11, 2107, 388, 1051, 1071, 311, 29395, 449, 279, 23152, 13, 2435, 7293, 264, 5526, 9955, 3904, 311, 420, 1938, 627, 13613, 292, 992, 27820, 612, 39923, 220, 578, 653, 57228, 720, 39853, 68543, 527, 74830, 1413, 323, 11, 422, 10235, 12722, 449, 47205, 11, 527, 3463, 311, 14553, 23152, 6784, 13, 578, 54842, 374, 26242, 323, 1891, 554, 29150, 323, 649, 387, 4529, 7214, 1603, 21644, 311, 5376, 279, 38575, 13, 720, 2078, 62, 5245, 12, 679, 1702, 81, 395, 3074, 5356, 309, 77, 355, 29573, 67, 256, 220, 10828, 220, 1627, 14, 2437, 14, 845, 256, 220, 717, 25, 2618, 9012, 10750, 34, 2850, 14751, 26365, 12874, 1605, 58041, 11012, 198, 791, 3789, 54842, 374, 4087, 7922, 323, 18417, 5419, 720, 901, 16490, 13, 1102, 374, 1511, 311, 4322, 6930, 4787, 11, 720, 11600, 35605, 23948, 11, 323, 4228, 43100, 3876, 11, 323, 374, 1101, 720, 2656, 304, 46552, 47979, 13, 362, 68652, 407, 315, 279, 720, 21494, 374, 1511, 311, 4322, 41580, 323, 58159, 30020, 720, 21470, 439, 5803, 3557, 285, 13, 720, 11948, 51567, 220, 362, 68652, 407, 315, 279, 4892, 720, 29518, 356, 13, 48364, 5237, 37037, 764, 6347, 220, 374, 4529, 311, 15253, 720, 1820, 42080, 315, 54630, 4090, 11, 323, 374, 1511, 439, 264, 97183, 273, 720, 2000, 28691, 30020, 13, 720, 61841, 6985, 293, 1759, 64, 2320, 561, 51380, 6925, 13, 666, 14833, 2554, 720, 65, 1759, 64, 2320, 561, 51380, 220, 320, 6971, 65444, 114785, 340, 8100, 43631, 753, 14874, 325, 198, 5116, 220, 25992, 477, 6160, 32331, 449, 459, 38732, 720, 65188, 11, 938, 751, 668, 315, 80710, 11141, 11, 220, 19, 2320, 1955, 839, 4251, 720, 89770, 11, 323, 4851, 35831, 10533, 55687, 627, 39, 40027, 266, 612, 26676, 40227, 220, 36287, 311, 387, 10068, 720, 998, 4606, 323, 13936, 11, 91478, 753, 53101, 374, 1457, 1766, 720, 20322, 412, 1455, 6940, 349, 13918, 11, 323, 28815, 720, 22579, 355, 989, 439, 264, 40475, 13, 1102, 374, 67572, 6957, 2355, 1820, 1060, 627, 30021, 12477, 220, 362, 2918, 5596, 627, 1128, 3781, 84, 812, 220, 31911, 18779, 263, 17390, 11, 1499, 500, 74489, 11, 720, 331, 22671, 11, 1645, 87348, 331, 22671, 11, 13034, 20588, 11, 323, 13892, 2453, 483, 627, 13730, 612, 65337, 20763, 220, 1115, 39999, 753, 836, 75549, 720, 1527, 279, 11341, 315, 279, 10533, 55687, 11, 902, 720, 265, 16167, 4851, 35831, 10037, 288, 13, 12220, 279, 5629, 720, 10343, 5111, 11, 994, 279, 5410, 51487, 39653, 369, 82721, 287, 6680, 2345, 35637, 1137, 278, 320, 10320, 3696, 561, 285, 720, 4919, 329, 87778, 1174, 281, 13, 220, 6550, 8, 323, 36376, 354, 320, 2493, 402, 75669, 720, 26047, 52833, 64, 883, 2345, 52898, 653, 677, 23771, 481, 304, 13527, 11, 720, 32158, 43631, 753, 53101, 574, 1511, 439, 459, 10778, 627, 13613, 292, 992, 27820, 612, 39923, 220, 3861, 315, 279, 1888, 720, 1864, 291, 552, 369, 27252, 477, 84866, 71417, 425, 11, 720, 32158, 43631, 753, 53101, 706, 1317, 1027, 264, 3230, 6514, 720, 2000, 8987, 8791, 261, 483, 35763, 13, 6104, 43383, 12, 36022, 304, 720, 576, 5201, 1109, 36376, 354, 11, 91478, 753, 53101, 706, 7000, 720, 1073, 36376, 354, 753, 58011, 323, 374, 2731, 66441, 555, 279, 2547, 13, 720, 2181, 1253, 387, 1511, 369, 35763, 315, 682, 13124, 88958, 720, 77, 974, 901, 6910, 311, 6680, 304, 279, 40335, 13, 1556, 264, 928, 306, 39999, 11, 720, 275, 64842, 3836, 82, 279, 72735, 42929, 304, 5157, 315, 63581, 20000, 11, 323, 720, 285, 4529, 369, 69393, 13, 1102, 374, 1511, 304, 8620, 16088, 720, 998, 4322, 22709, 306, 727, 323, 8071, 5435, 627, 28528, 220, 29140, 4284, 430, 279, 6136, 374, 2355, 15719, 67595, 323, 26338, 34653, 627, 23389, 1516, 220, 3234, 539, 1935, 2391, 20209, 627, 12363, 50570, 5560, 220, 29201, 78727, 35763, 1174, 281, 13, 220, 15189, 627, 5889, 3614, 20508, 372, 91799, 13, 320, 50, 391, 485, 114785, 340, 38989, 32435, 50795, 198, 5116, 220, 3799, 307, 9373, 74718, 94751, 720, 70, 25156, 311, 220, 605, 10702, 320, 18, 296, 705, 449, 24549, 11141, 11, 720, 9181, 4251, 19837, 11, 323, 3776, 19595, 627, 39, 40027, 266, 612, 26676, 40227, 220, 19984, 32435, 30050, 374, 1766, 720, 70, 25156, 304, 35148, 13918, 2212, 279, 1917, 627, 30021, 12477, 220, 19385, 11, 11141, 11, 19595, 4906, 3781, 84, 812, 220, 7648, 6938, 3614, 20508, 372, 220, 9606, 720, 53195, 58988, 29569, 37807, 9594, 3422, 627, 13730, 612, 65337, 20763, 220, 17118, 8339, 5493, 925, 720, 13616, 32435, 30050, 19595, 1139, 802, 3172, 2914, 430, 527, 24634, 311, 720, 1637, 1022, 57196, 627, 13613, 292, 992, 27820, 612, 39923, 220, 763, 7904, 51487, 720, 83543, 11, 47856, 30050, 3789, 374, 1511, 311, 4546, 389, 720, 23059, 291, 54630, 4090, 323, 311, 48839, 1203, 1815, 323, 720, 277, 40485, 13, 578, 11141, 51077, 2254, 35855, 2355, 438, 527, 9435, 311, 26175, 35358, 311, 1520, 4732, 2355, 1820, 33850, 315, 62186, 13, 578, 19595, 527, 1101, 3463, 720, 998, 1520, 304, 279, 6514, 315, 55652, 13, 578, 6136, 439, 2355, 64, 4459, 706, 11163, 1413, 6012, 627, 23389, 1516, 220, 3234, 539, 1935, 2391, 20209, 627, 9028, 3074, 26365, 12874, 220, 320, 9028, 292, 114785, 340, 47, 391, 12874, 198, 5116, 220, 74956, 77140, 5021, 7982, 1633, 720, 86812, 398, 311, 220, 1627, 10702, 320, 23, 296, 570, 11697, 86045, 11141, 11, 720, 28969, 19837, 11, 323, 3544, 11, 3776, 7962, 31035, 14071, 2355, 998, 19087, 26390, 47826, 709, 311, 220, 806, 19398, 320, 20, 21647, 4390, 39, 40027, 266, 612, 26676, 40227, 220, 17118, 311, 35148, 720, 32132, 11, 26365, 12874, 374, 1457, 67166, 304, 35148, 13918, 720, 20322, 412, 279, 1917, 627, 30021, 12477, 220, 44187, 11, 45636, 11, 11141, 11, 19837, 11, 19595, 627, 1128, 3781, 84, 812, 220, 578, 14098, 5727, 5541, 5849, 29150, 720, 17007, 79809, 320, 79, 391, 467, 323, 523, 1631, 454, 391, 467, 705, 323, 35483, 2355, 1073, 459, 66787, 590, 11, 39739, 8511, 13, 32743, 467, 11, 902, 374, 1766, 304, 720, 1820, 7625, 8050, 4251, 45636, 430, 28555, 505, 3709, 6948, 2355, 258, 279, 653, 52191, 14098, 11, 374, 264, 13128, 1773, 1056, 20222, 49242, 720, 9210, 52797, 74502, 627, 13730, 612, 65337, 20763, 220, 32743, 12874, 23661, 11, 44727, 11, 2355, 438, 45636, 1051, 1511, 304, 3297, 276, 51487, 16088, 13, 763, 720, 83, 51172, 20023, 5270, 11, 279, 11141, 527, 1511, 439, 264, 720, 2727, 266, 28682, 3213, 627, 13613, 292, 992, 27820, 612, 39923, 220, 32743, 12874, 753, 1925, 720, 2106, 292, 992, 1005, 374, 439, 264, 60071, 8479, 13, 578, 11141, 2355, 438, 279, 14098, 649, 2225, 387, 1511, 320, 1820, 653, 52191, 14098, 374, 720, 36046, 7524, 570, 578, 45636, 505, 279, 38411, 315, 2355, 1820, 5021, 374, 9435, 69442, 311, 4732, 279, 21730, 720, 1073, 34254, 11, 8725, 17254, 11, 90055, 11, 289, 7183, 11, 323, 9572, 788, 720, 83, 372, 1105, 13, 578, 19595, 527, 1511, 439, 264, 22443, 4087, 70, 1413, 720, 2000, 63000, 13, 578, 45636, 706, 264, 4528, 719, 810, 16806, 720, 27153, 13, 578, 19837, 1253, 387, 4529, 304, 459, 71308, 311, 720, 485, 10743, 54630, 4090, 11, 323, 264, 68652, 407, 315, 720, 1820, 57796, 14098, 374, 11190, 369, 720, 10367, 1113, 26048, 720, 8747, 1138, 41033, 323, 720, 67, 1065, 306, 727, 304, 720, 5988, 13, 578, 57796, 720, 36698, 374, 76949, 720, 75, 710, 1413, 323, 279, 720, 273, 4798, 527, 1511, 720, 998, 8679, 34254, 732, 3271, 753, 220, 68543, 3820, 839, 720, 4291, 47205, 617, 1027, 720, 2656, 439, 264, 9955, 3904, 720, 11536, 14154, 3115, 627, 38989, 32435, 30050, 220, 11141, 527, 2355, 391, 3523, 311, 48839, 264, 28075, 35358, 13, 44187, 198, 2078, 62, 5245, 12, 679, 1702, 81, 395, 3074, 5356, 309, 77, 355, 29573, 67, 256, 220, 10750, 220, 2589, 14, 2371, 14, 845, 256, 220, 19, 25, 1806, 9012, 198, 10336, 9028, 339, 56455, 25826, 34, 5801, 9334, 220, 1023, 58041, 11012, 9028, 339, 56455, 25826, 5009, 9334, 320, 32, 3751, 114785, 340, 50, 2715, 15115, 345, 86809, 473, 4381, 320, 46023, 8, 720, 5116, 220, 25992, 39999, 7982, 311, 220, 18, 10702, 320, 1954, 720, 6358, 570, 11697, 1317, 993, 6577, 11141, 449, 220, 21, 1536, 4930, 12, 13825, 720, 25126, 10145, 11, 323, 5315, 315, 14071, 19837, 40986, 505, 279, 16312, 3944, 8839, 627, 39, 40027, 266, 612, 26676, 40227, 220, 36287, 311, 387, 10068, 720, 998, 10471, 323, 10411, 31382, 6890, 11, 420, 39999, 374, 1101, 720, 15456, 304, 4892, 5270, 323, 279, 13759, 6460, 13, 1102, 28815, 304, 1825, 5789, 323, 374, 20802, 304, 7474, 627, 30021, 12477, 220, 52645, 11, 19595, 11, 10533, 5707, 627, 1128, 3781, 84, 812, 220, 328, 2715, 15115, 5727, 72700, 598, 11, 720, 10097, 1065, 582, 1799, 3422, 323, 264, 17509, 5707, 13, 578, 19595, 2355, 53195, 264, 8521, 5707, 11, 709, 311, 220, 1490, 4, 10006, 1286, 292, 13935, 627, 13730, 612, 65337, 20763, 220, 763, 220, 777, 339, 9478, 4892, 720, 29518, 51487, 16088, 11, 829, 544, 15115, 574, 1511, 2355, 998, 49853, 81366, 11, 311, 12192, 279, 42080, 315, 264, 78727, 4261, 323, 439, 264, 6514, 369, 80337, 13, 328, 2715, 15115, 19837, 527, 61456, 6216, 439, 829, 544, 2298, 2355, 3100, 28787, 355, 7731, 344, 355, 11, 281, 13, 220, 4578, 4390, 13613, 292, 992, 27820, 612, 39923, 220, 763, 8620, 2355, 1964, 13616, 16088, 11, 279, 19837, 527, 2728, 311, 51077, 54630, 4090, 323, 311, 48839, 57056, 6784, 13, 578, 19837, 527, 1101, 1511, 311, 81155, 323, 27661, 34254, 323, 779, 417, 323, 311, 4322, 80337, 13, 763, 279, 60259, 24145, 51487, 14135, 11, 279, 19837, 527, 2728, 220, 439, 264, 6514, 369, 34653, 323, 6930, 436, 14380, 13, 578, 22355, 324, 1908, 10533, 5707, 374, 4087, 70, 1413, 627, 28528, 220, 8620, 3495, 15151, 430, 720, 82, 2715, 15115, 19837, 649, 8108, 66298, 65415, 8624, 11, 323, 4827, 39086, 5990, 13, 328, 2715, 15115, 5727, 264, 99919, 582, 1799, 579, 430, 706, 1027, 6982, 311, 51077, 22852, 734, 304, 24548, 13, 328, 2715, 15115, 5707, 1101, 73115, 39086, 5990, 627, 23389, 1516, 220, 3234, 539, 1935, 279, 19837, 477, 19595, 2391, 720, 30585, 77, 6709, 320, 23425, 5707, 374, 6220, 4390, 9028, 372, 1841, 10176, 320, 6700, 114785, 340, 9028, 14075, 198, 5116, 220, 362, 99866, 9974, 7982, 311, 220, 17, 10702, 720, 7, 1399, 10166, 570, 11697, 9463, 3640, 19646, 11, 1172, 589, 727, 11141, 11, 323, 37781, 2053, 315, 4251, 19837, 304, 5209, 63666, 13, 18491, 3785, 65879, 1855, 6782, 220, 17, 2678, 15376, 19595, 627, 39, 40027, 266, 612, 26676, 40227, 220, 3341, 14075, 28815, 8545, 720, 258, 4606, 11, 4892, 10384, 11, 323, 13936, 13, 1102, 55064, 40798, 6732, 709, 311, 220, 21, 11, 5067, 10702, 320, 17, 11, 931, 296, 8, 3485, 9581, 2237, 13, 1102, 220, 374, 67166, 304, 4606, 11, 8524, 11, 4892, 10384, 11, 323, 279, 2326, 11, 323, 279, 19595, 527, 67572, 57796, 304, 2355, 5185, 7474, 627, 30021, 12477, 220, 74089, 11, 7718, 5707, 627, 1128, 3781, 84, 812, 220, 3341, 14075, 5727, 264, 17509, 5707, 720, 12156, 304, 1841, 85, 606, 320, 9274, 220, 1135, 11587, 323, 4671, 263, 1994, 13, 1102, 1101, 5727, 264, 8521, 5707, 11, 18779, 263, 17390, 11, 99919, 582, 1799, 3422, 11, 28896, 11, 323, 18742, 276, 511, 283, 5730 ]
0xBreath/holistic-books
actors:I)thehost,whichisthe personwhoisthepotentialtargetofthedisease;2)theagent,whichistheorganismordisease-causingfactorthatinitiatesortransmitsthedisease; YourHealingSystemandYourNaturalStateofHealth 11 and3)theenvironment,inwhichboththehostandagentresideorcomein contactMedicalscienceneedstoweighandmeasureallthreefactorsto helpdiscoverthetrueoriginsofillness,whileitworkstosolveandpreventfutureepidemicsfromoccurring.Whereaspreviousmedicalresearchattributedmoreimportancetothevirulenceofsuchagentsasbacteriaandvirusesthatcausedthediseases, newermedicalresearchplacesmuchgreateremphasisonhostresistancefactors,whicharefactorswithinusthatkeepushealthyandhelpusresistill ness.Wecanthinkofhostresistancefactorsasthebody’sinternalhealingresources.Theydetermineaperson’ssusceptibilitytoillnessanddiseaseand reflectone’snaturalresiliency.Studyinghostresistancefactorshelpsustounderstandwhysomepeoplegetsickandwhyothersdon’t,evenwhenthey areexposedtothesamedisease-causingagents;whycertainpeoplegetsick moreoftenthanothers;andwhycertaindiseasesseemtohaveanaffinityfor certainpeople.Studiesonhostresistancefactorsshowthat,forpeoplelivinginthemodern,developedworld,themostimportantfactorsindeterminingour stateofhealthandsusceptibilitytoillnessarebasedonhowwellwetake careofourselves,howwellwenurtureandhonorourbodies,andhowwell werespectournaturalstateofhealth.Thesefactorsaredependentonthepersonalchoiceswemakeinoureverydaylives.Studiesonhostresistancefactorshavealsoledtotherealizationthat, inadditiontotheimmunesystem,thereisanotherextremelyimportantsys teminthebodythatisresponsibleforitsnaturalresiliency,anditsabilityto healitselfandkeepitselfhealthy.Thissystemisthebody’shealingsystem, themostrecentlydiscoveredsystem,anditsmostimportantone.Thebodyknowshowtohealitselfandmaintainitsnaturalstateofhealthbecauseof itshealingsystem. YourHealingSystem TheGuardianofYourBody’sHealth Imagineyourselfoutsideonabeautiful,warmsummerday.You’reskippingdownthestreet,feelingcarefreeandlight-hearted.Allofasudden,youtriponanoversizedcrackinthesidewalk.Asyoufeelyourselfgoingdown,youinstinctivelyputoutyourarmtobrace 12 YourExtraordinaryHealingSystem yourfall.Asyouhitthegroundandslidealongthepavement,youimmediatelyfeelpaininyourarm.Asyouslowlyrisetoyourfeet, younoticeanareawhereapatchofskinhasbeenrippedoff.Itis red,raw,andbleeding.Althoughyou’rethankfulthatit’sonlya scrape,itstillhurtslikethedickens.Indoctor’slanguage,youhave justsustainedanabrasion! Overthecourseofthenextseveraldays,withoutmuchfuss,youwatchyourbodygothroughinterestingyetpredictablechangesatthe siteoftheabrasion.First,itbeginstosecreteaclear-lookingfluidthateventuallyturnsintoabrown,crustycoveringthatthickensandforms intoascab.Whenyourbodyshedsthescabafteraweekortwo,just asasnakeorlizardshedsitsskin,younoticeyouhaveabrand-new layerofskin.Severalmonthslater,there’snotevenascartomarkthe sightoftheinjury~Prettycommon,everydaystuff,andyet,atthe sametime,whenyouthinkaboutthefactthatyouhavenewskin,youhavetoaskyourself,“Howdidmybodyknowhowtodothat?” Yourbodyknowshowtohealitselfbecauseofitshealingsystem.Forthemostpart,withoutyourevenknowingit,yourheal ingsystemkeepsyourbodyresilientbyrepairingandhealingitfrom amyriadofproblemsencounteredeverysingledayofyourlife.Theseeventsincludenotonlytherapidmendingofsuperficialproblemssuchasabrasionsandcutsandbruisesontheskin,butalso thesupervising,monitoring,andcontinualadjustingofcriticalphysiologicalprocessesthatoccurdeepwithinyourbody’sinternalenvironment.Whenexternalforcesseektocreateimbalancewithin yourbody,whenorderbecomeslessorderlyandmayeventurntochaos,whendis-ease,orillnessmanifests,yourhealingsystemworks hardtorestoreorderandbalancetohelpyoureclaimyournatural stateofhealth.Herearejustafewwaysyourhealingsystemworks tosafeguardyourhealth: oYourhealingsystemcanexpandandcontractbloodvessels toincreasebloodflowtospecificareasofyourbodythatneedhealing. oYourhealingsystemcanspeedupyourheartrateandincrease thestrengthofitscontractionstorapidlydelivermoreblood,oxygen,andnutrientstospecificsitesthatneedhealing;this processincludescasesoflife-threateningemergencies. YourHealingSystemandYourNaturalStateofHealth 13 aYourhealingsystemstimulatesyourglandstoproducekeyhor monestoinitiategrowthandrepairprocesseswithinthecellsofdamagedtissues. aYourhealingsystemcanincreasebodytemperaturetocauseafeverandinducesweating,toremovetoxinswhenaninfection ispresent. aYourhealingsystemcanmodifythefunctionofyourkidneystoreduceurineoutputandhelpconservewaterifyou’redehydrated. aYourhealingsystemsupervisestheamazingprocessofboneremodeling,ofknittingyourbonestogetherasithealsfractures. aYourhealingsystemcanincreaseyourbreathingrateandlungcapacitytobringinmoreoxygenforyourcellsandtissueswhen anillnessorinjuryhasoccurred. Yourhealingsystemcandoallofthesethingsandmany,many more.Infact,foraslongasyouarealive,yourhealingsystemremainsviableandcommittedtoitsrole~astheguardianofyourbody’shealth. Eveniftherehavebeentimesinthepastwhenyouwerequite illandhadtostruggleagainstlife’smostseriousadversitiesandsetbacks,yourhealingsystemwasthereforyou,attemptingtopullyou outofyoursuffering.Evenifyouarebattlinganillnessrightnow,underneaththesymptomsofillness,youwillfindyourhealingsystemworkinghardtoreestablishbalanceandorderinyourbody.Thefactthatyouarealivetodayisindicativeofyourhealingsystem’sfunctioningtofulfillyourbody’sunderlyingdrivetoheal andbecomehealthyonceagain.Evenifyourhealthiscurrentlycompromisedandnotwhatyouwouldlikeittobe,youcanwork withyourhealingsystemtostrengthenandfortifyitandregainyournaturalstateofhealth. EliminatingObstaclestoYourHealingSystem Inmanycases,youunknowinglyplaceobstaclesinthewayofyourheal ingsystem,creatinganunfairburdenthathindersitsworkandjeopardizesitseffectiveness.Byunderstandingwhattheseobstaclesare andremovingthem,inmanyinstances,yourhealingsystem,now 14 YourExtraordinaryHealingSystem unshackledtocompleteitstaskofhealing,canquicklyrestorenormalfunctioningtoyourbody,enablingittoexpressitsnaturalstateofhealth. Forexample,considerthecaseofachroniclunginfectionina personwhocontinuestosmokecigarettes.Constantbreathingofcigarettesmokeisnotnatural.Ifcigarettesmokingwerenatural, we’dallhavebeenbornwithacigaretteinourmouth.Yourbody wasdesignedtobreathefreshandhealthy,clean,naturalair.Althoughitcansurviveandtoleratecigarettesmokeforacertainperiodoftime,afterawhile,thesmokeparticles,thecarbonmonox ide,thetars,andtheothertoxicsubstancesinthecigarettesmoke createaburdenonyourhealingsystemthatcausesanimbalanceand abreakdowninyourhealth.Inthiscase,removingtheharmfulobstacleofthecigarettesmokeisallthatisrequiredforyourbody toregainitsnaturalstateofhealth.Withtheburdenofthecigarettesmokeremoved,itisaneasy,routinetaskforyourhealingsystemto restoreyourbodytoitsnaturalstateofhealth.Anotherexampleisevidentwithheartdisease,thenumber-one killerintheWesternworld.Heartdiseaseiscausedbyexcesscholes terolaccumulation.Highcholesterollevelsresultingfromalackofexercise,toomanyrichandfattyfoods,andstresscanclogthearter iesoftheheartandcauseaheartattack.Rem
[ 21846, 58255, 8, 1820, 3875, 11, 8370, 380, 383, 198, 9164, 14965, 380, 383, 93036, 5775, 1073, 79371, 56407, 26, 17, 8, 1820, 8252, 11, 8370, 380, 383, 8629, 2191, 541, 56407, 51877, 985, 34210, 2419, 266, 2381, 43398, 371, 34489, 1800, 31177, 291, 56407, 280, 7927, 1548, 6260, 2374, 438, 7927, 55381, 1423, 1073, 14884, 220, 806, 198, 438, 18, 8, 1820, 24175, 54788, 8370, 21704, 1820, 3875, 438, 8252, 417, 579, 269, 2063, 258, 198, 6421, 53654, 54927, 967, 1994, 291, 267, 24665, 1108, 438, 48899, 543, 28956, 38691, 34152, 198, 8823, 98729, 339, 17820, 361, 8781, 708, 7712, 2136, 11, 3556, 275, 1816, 267, 437, 4035, 438, 93755, 21733, 752, 307, 38305, 1527, 511, 46839, 17504, 300, 20281, 69216, 61564, 45213, 2844, 6518, 475, 1149, 11269, 1820, 46957, 59566, 1073, 21470, 55975, 300, 65, 78852, 438, 46957, 817, 267, 9379, 936, 2656, 79371, 1082, 2315, 345, 943, 261, 69216, 61564, 27170, 59178, 66335, 336, 51480, 3416, 3875, 417, 4011, 69, 21846, 11, 8370, 548, 69, 21846, 56950, 592, 9379, 13397, 355, 38128, 438, 8823, 355, 417, 380, 484, 198, 2136, 1196, 762, 276, 27963, 1073, 3875, 417, 4011, 69, 21846, 561, 383, 2664, 753, 10701, 383, 6260, 13035, 76369, 67, 25296, 391, 1293, 753, 86521, 1512, 3225, 998, 484, 2136, 438, 67, 56407, 438, 198, 36013, 606, 753, 53980, 417, 4008, 2301, 7914, 664, 7169, 3875, 417, 4011, 38691, 939, 84719, 592, 94006, 2752, 1336, 1065, 638, 16455, 19209, 875, 438, 1336, 16417, 3058, 15357, 1431, 11, 17206, 1336, 306, 36661, 198, 548, 327, 3950, 998, 6509, 3690, 56407, 51877, 985, 55975, 26, 1336, 3418, 7770, 16455, 19209, 875, 198, 6518, 14450, 21341, 5770, 3058, 26, 438, 1336, 3418, 7770, 67, 1082, 2315, 325, 336, 998, 19553, 276, 2715, 13797, 2000, 198, 66, 7770, 16455, 7914, 58787, 263, 3875, 417, 4011, 38691, 784, 5269, 9210, 11, 2000, 16455, 64275, 48121, 336, 347, 944, 11, 16219, 291, 14957, 11, 49818, 537, 15693, 69, 21846, 485, 16890, 287, 414, 198, 2513, 1073, 12393, 2914, 355, 1512, 3225, 998, 484, 2136, 548, 31039, 263, 5269, 9336, 86, 295, 731, 198, 10727, 1073, 2530, 4372, 11, 5269, 9336, 17378, 324, 5081, 438, 71, 55137, 414, 65, 10233, 51526, 5269, 9336, 198, 6703, 288, 1002, 3514, 4688, 2513, 1073, 12393, 5221, 288, 830, 21846, 548, 38655, 6167, 752, 1293, 278, 25825, 86, 336, 731, 258, 80284, 1225, 1316, 75, 1924, 7914, 58787, 263, 3875, 417, 4011, 38691, 939, 525, 19171, 839, 998, 19041, 278, 2065, 9210, 345, 258, 723, 684, 998, 1820, 12828, 8699, 615, 11, 19041, 17570, 1605, 428, 54358, 475, 1821, 1065, 198, 880, 258, 1820, 2664, 339, 3689, 417, 43419, 2000, 1220, 53980, 417, 4008, 2301, 51526, 1220, 2968, 998, 198, 383, 278, 275, 726, 438, 13397, 275, 726, 38128, 5221, 1056, 615, 380, 383, 2664, 753, 383, 278, 826, 615, 345, 49818, 537, 47743, 398, 98729, 6910, 615, 51526, 1220, 3646, 15693, 606, 11829, 2664, 33134, 3528, 998, 383, 278, 275, 726, 438, 67913, 467, 1220, 53980, 2513, 1073, 12393, 28753, 1073, 198, 1220, 383, 278, 826, 615, 627, 7927, 1548, 6260, 2374, 198, 791, 21471, 1122, 1073, 7927, 5561, 753, 14884, 198, 52157, 22479, 726, 68090, 263, 8393, 35777, 11, 11710, 1026, 63373, 1316, 39537, 529, 417, 74, 5772, 2996, 61943, 3829, 11, 1897, 20659, 10727, 10816, 438, 4238, 70395, 9833, 385, 15192, 39095, 7509, 283, 34081, 263, 276, 9146, 1534, 5192, 474, 258, 6509, 307, 365, 1727, 20855, 9514, 1897, 989, 414, 726, 9738, 2996, 7509, 283, 6442, 7956, 3210, 631, 412, 22479, 2227, 83, 677, 42283, 198, 717, 4718, 11873, 21707, 1548, 6260, 2374, 198, 22479, 13772, 20855, 9514, 23306, 339, 797, 1067, 2914, 17068, 39393, 339, 752, 402, 1133, 7509, 283, 318, 44287, 1897, 1290, 467, 6577, 414, 2227, 20855, 88, 788, 10516, 398, 6091, 295, 2303, 414, 1897, 295, 345, 88, 1656, 354, 560, 276, 548, 675, 6881, 391, 759, 1073, 37282, 4752, 82850, 462, 7069, 1885, 28628, 285, 198, 1171, 11, 1059, 51526, 901, 16490, 9833, 4636, 9514, 3207, 58517, 1285, 9210, 275, 753, 3323, 64, 198, 2445, 20432, 80824, 44466, 104402, 2641, 7792, 774, 291, 875, 729, 13, 1451, 78, 5009, 753, 11789, 7509, 283, 19553, 198, 4345, 82, 592, 2692, 276, 54988, 290, 4999, 1959, 339, 762, 5366, 1073, 3473, 428, 325, 424, 4852, 954, 11, 30096, 59178, 69, 1892, 7509, 283, 14658, 22479, 2664, 3427, 20322, 88657, 47492, 35798, 481, 19926, 266, 1820, 198, 9703, 1073, 1820, 54988, 290, 16305, 80824, 7413, 267, 974, 9537, 582, 1576, 31348, 27256, 1123, 349, 688, 1870, 413, 82, 18614, 370, 4935, 11, 5192, 47425, 93013, 9210, 339, 875, 729, 438, 10008, 198, 18614, 5171, 370, 51861, 22479, 2664, 70561, 31177, 3380, 370, 10924, 85277, 1247, 371, 1146, 11, 4345, 198, 300, 66636, 731, 269, 75, 14038, 939, 6910, 275, 784, 8148, 7509, 1656, 354, 560, 9514, 19553, 370, 11588, 23065, 198, 10546, 1073, 37282, 815, 2099, 278, 10460, 3306, 977, 11, 19041, 753, 10179, 1055, 5171, 472, 316, 847, 1820, 198, 82, 492, 1073, 1820, 258, 42861, 93, 53040, 5581, 23379, 1225, 1316, 58404, 11, 13634, 295, 11, 266, 1820, 198, 47096, 4199, 11, 9493, 88, 2969, 771, 9274, 339, 830, 533, 9210, 9514, 72012, 365, 37282, 7509, 283, 71, 402, 11269, 1091, 22479, 726, 102305, 4438, 23770, 2465, 2664, 33134, 5269, 17825, 9210, 12671, 198, 7927, 2664, 33134, 3528, 998, 383, 278, 275, 726, 28753, 1073, 1220, 383, 278, 826, 615, 1006, 2419, 336, 537, 4581, 11, 30096, 9514, 265, 1055, 33134, 287, 275, 7509, 414, 383, 278, 198, 826, 615, 441, 7270, 22479, 2664, 417, 321, 1188, 1729, 77539, 287, 438, 383, 6260, 275, 1527, 198, 27322, 47639, 1073, 96440, 967, 632, 12616, 2099, 1065, 287, 839, 352, 1073, 22479, 14789, 5221, 288, 2176, 688, 16319, 1513, 268, 354, 3323, 700, 44221, 76, 2518, 1073, 9712, 69, 7235, 35686, 784, 1412, 300, 54988, 919, 438, 23312, 438, 33713, 5014, 6167, 288, 8148, 100004, 19171, 198, 6509, 455, 651, 3876, 11, 33325, 287, 51526, 22025, 940, 39819, 287, 1073, 42641, 42305, 41314, 782, 1634, 325, 267, 9379, 511, 2407, 33980, 4291, 6577, 414, 2664, 753, 10701, 24175, 51861, 21591, 49896, 325, 17588, 511, 979, 21495, 5085, 56950, 198, 22479, 2664, 11, 9493, 1382, 17106, 20969, 1752, 1382, 398, 438, 18864, 3163, 399, 998, 6583, 437, 11, 1336, 408, 285, 5773, 521, 11, 269, 484, 2136, 43415, 82, 7509, 414, 383, 278, 826, 615, 19033, 198, 60382, 461, 4412, 1382, 438, 13616, 1149, 295, 2319, 1290, 9514, 265, 8017, 88, 3514, 4688, 198, 2513, 1073, 12393, 91173, 548, 4345, 2642, 365, 2336, 22479, 383, 278, 826, 615, 19033, 198, 43681, 2642, 82971, 22479, 12393, 512, 78, 7927, 383, 278, 826, 615, 4919, 33417, 438, 20871, 51105, 85, 434, 2053, 198, 998, 79601, 51105, 5072, 43681, 15934, 33637, 1073, 22479, 2664, 9210, 17483, 383, 6260, 627, 78, 7927, 383, 278, 826, 615, 66, 598, 4609, 455, 22479, 87160, 376, 349, 51701, 20542, 198, 61943, 18323, 1073, 1220, 8386, 1335, 48465, 44221, 398, 75828, 6518, 51105, 50318, 19472, 51526, 24217, 13283, 267, 437, 15934, 47965, 478, 9379, 17483, 383, 6260, 26, 576, 198, 4734, 258, 1513, 3380, 2315, 1073, 14789, 62999, 336, 2431, 6072, 627, 7927, 1548, 6260, 2374, 438, 7927, 55381, 1423, 1073, 14884, 220, 1032, 198, 64, 7927, 383, 278, 826, 615, 54754, 24031, 22479, 70, 1974, 9684, 48945, 798, 20100, 198, 1677, 478, 2003, 12583, 1352, 19632, 438, 77539, 4734, 288, 4291, 48121, 762, 616, 708, 7047, 92920, 83, 18934, 627, 64, 7927, 383, 278, 826, 615, 4919, 79601, 2664, 35658, 55880, 3538, 5763, 424, 438, 485, 63371, 906, 1113, 14287, 13475, 869, 295, 5241, 1354, 9493, 276, 258, 13421, 198, 13391, 2762, 627, 64, 7927, 383, 278, 826, 615, 4919, 35153, 339, 830, 600, 1073, 22479, 64381, 818, 64473, 13677, 324, 483, 3081, 438, 8823, 6387, 651, 48544, 1463, 283, 3207, 451, 26233, 660, 627, 64, 7927, 383, 278, 826, 615, 13066, 651, 285, 478, 383, 309, 6795, 4734, 1073, 6098, 261, 96748, 287, 11, 1073, 19639, 15154, 22479, 6098, 52525, 3522, 300, 83856, 1147, 1658, 533, 1439, 627, 64, 7927, 383, 278, 826, 615, 4919, 79601, 22479, 21152, 44661, 7853, 438, 39049, 38487, 83, 677, 12928, 258, 6518, 78, 19472, 69, 683, 414, 37791, 438, 83, 18934, 9493, 198, 276, 484, 2136, 269, 258, 42861, 4752, 14310, 8293, 627, 7927, 383, 278, 826, 615, 66, 4988, 37037, 69, 6509, 774, 826, 438, 35676, 11, 35676, 198, 6518, 5450, 34210, 11, 2000, 300, 4930, 6539, 283, 548, 52061, 7509, 414, 383, 278, 826, 615, 1864, 1771, 85, 2205, 438, 98546, 998, 1220, 5898, 93, 561, 383, 27190, 1122, 1073, 22479, 2664, 753, 12393, 627, 13461, 333, 19041, 19553, 1395, 92455, 48121, 752, 561, 9493, 9514, 52898, 84270, 198, 484, 438, 32345, 998, 496, 50428, 69849, 14789, 753, 3646, 94427, 329, 3078, 1385, 438, 751, 25082, 7509, 414, 383, 278, 826, 615, 86, 561, 6881, 69, 683, 283, 11, 56605, 287, 3565, 22732, 283, 198, 412, 1073, 88, 2530, 2084, 287, 5253, 1055, 1463, 283, 548, 65, 1617, 2785, 276, 484, 2136, 1315, 3409, 11, 8154, 28917, 6509, 1631, 80797, 708, 7712, 2136, 7509, 283, 14724, 3990, 22479, 383, 278, 826, 615, 21837, 60382, 461, 34500, 22298, 438, 1382, 6577, 414, 2664, 11829, 34210, 9210, 9514, 548, 278, 99754, 6423, 285, 86184, 1413, 1073, 22479, 383, 278, 826, 615, 753, 1723, 287, 998, 1285, 12723, 398, 414, 2664, 753, 8154, 6852, 3696, 344, 11269, 383, 278, 198, 438, 17106, 638, 38128, 13486, 33871, 5253, 1055, 1463, 414, 383, 278, 576, 59302, 5807, 442, 4147, 438, 1962, 12840, 9514, 41450, 4908, 1468, 15784, 7509, 283, 4919, 1816, 198, 4291, 22479, 383, 278, 826, 615, 83, 537, 265, 18972, 438, 4057, 1463, 275, 438, 1610, 467, 88, 3514, 4688, 2513, 1073, 12393, 627, 42113, 16252, 4213, 44698, 34152, 7927, 1548, 6260, 2374, 198, 644, 1543, 3418, 2315, 7509, 283, 3200, 3409, 11559, 2050, 677, 75079, 258, 16142, 352, 1073, 22479, 383, 278, 198, 826, 615, 11, 46002, 276, 359, 42000, 11490, 67, 21341, 589, 32551, 1220, 1816, 438, 3841, 33029, 4861, 275, 325, 1740, 13071, 50006, 8154, 10276, 12840, 45010, 677, 75079, 548, 198, 438, 1864, 9308, 49818, 54788, 35676, 48925, 7509, 414, 383, 278, 826, 615, 11, 3409, 198, 975, 4718, 11873, 21707, 1548, 6260, 2374, 198, 359, 939, 474, 839, 83, 20707, 275, 267, 1091, 1073, 383, 6260, 11, 4919, 28863, 398, 31904, 8416, 1723, 287, 998, 22479, 2664, 88531, 19295, 87287, 14107, 1220, 53980, 2513, 1073, 12393, 627, 11339, 87, 1545, 11, 25742, 339, 762, 521, 1073, 613, 8535, 39049, 258, 13421, 2259, 198, 9164, 14965, 22025, 65282, 76, 4845, 66, 44375, 2392, 60040, 21152, 44661, 1073, 66, 44375, 2392, 76, 4845, 285, 1962, 53980, 2506, 8480, 44375, 2392, 76, 10979, 6703, 268, 4688, 345, 906, 7070, 543, 19553, 82850, 16381, 4291, 582, 44375, 39340, 414, 33780, 7659, 414, 2664, 198, 16514, 5919, 1571, 83, 677, 1244, 383, 72408, 438, 38128, 10317, 2742, 10337, 4688, 1334, 9833, 4636, 275, 66, 598, 97860, 535, 438, 21220, 59768, 66, 44375, 2392, 76, 4845, 2000, 582, 7770, 19862, 14450, 547, 11, 10924, 675, 71, 458, 11, 6509, 76, 4845, 69598, 11, 339, 762, 52745, 1677, 5241, 198, 579, 11, 339, 295, 1590, 51526, 1820, 8942, 531, 5241, 1233, 392, 9623, 48121, 762, 44375, 2392, 76, 4845, 198, 3261, 370, 324, 5294, 3633, 414, 383, 278, 826, 615, 9210, 936, 4881, 16348, 22298, 438, 198, 370, 1127, 2996, 6577, 414, 12393, 5450, 576, 5756, 11, 1864, 9308, 1820, 71, 2227, 1285, 677, 44698, 1073, 339, 762, 44375, 2392, 76, 4845, 285, 543, 339, 3689, 6413, 69, 683, 414, 2664, 198, 83, 461, 60246, 1220, 53980, 2513, 1073, 12393, 27216, 1820, 11490, 5294, 1073, 339, 762, 44375, 2392, 76, 10668, 336, 5047, 11, 20000, 2194, 6539, 16262, 412, 30976, 1091, 69, 683, 414, 383, 278, 826, 615, 998, 198, 31904, 22479, 2664, 998, 1220, 53980, 2513, 1073, 12393, 8794, 1605, 8858, 1082, 1325, 306, 4291, 18207, 67, 56407, 11, 3473, 900, 19101, 198, 73178, 258, 1820, 55924, 14957, 13, 46484, 67, 56407, 285, 936, 2656, 1729, 327, 1140, 971, 645, 198, 466, 337, 40031, 2987, 47778, 971, 273, 33282, 43664, 1407, 287, 1527, 278, 474, 1073, 64562, 77347, 316, 3852, 14172, 438, 69, 23758, 96420, 51526, 95290, 66, 1149, 848, 339, 686, 466, 198, 552, 1073, 1820, 18207, 438, 1593, 64, 18207, 21208, 11652 ]
0xBreath/holistic-books
by a healthy lifestyle, does remove the causes of disease and can dramatically accelerate the healing process. Many books have been written about “juice fasts,” “religious fasts,” “fasts for weight loss,” etc., but they usually do not address fasting from a complete physiological point of view. Fasting Can Save Your Life describes the true physiological fasting process. This involves the abstinence from all food or drink, except pure water, during a time when the person’s nutritional reserves are adequate to maintain a vital organ function and structure. Only such a fast can maximize the body’s healing potential. In his own inspiring language, drawing upon his unparalleled experience of supervising over 40,000 fasts, Herbert M. Shelton reviews the major issues related to fasting. He explains how fasting can often bring results that many would think impossible. He carefully addresses the common misconceptions that the uninitiated have towards fasting. More importantly, he describes fasting not as an isolated practice but as part of a comprehensive health care system he called Natural Hygiene. Dr. Shelton’s ideas about fasting and Natural Hygiene found their roots in the writings of a group of progressive, nineteenth century medical doctors, including Isaac Jennings, M.D., Harriot Austin, M.D., Susanna Way Dodds, M.D., Russell Thacker Trail, M.D., and John Tilden, M.D. These men and women were among the first to recognize that health results from healthful living. They understood that a healthy life depends upon a clean environment—fresh air, pure water and sunshine; a natural vegetarian diet—primarily fruits, vegetables, nuts, seeds and whole grains; productive activity—sufficient exercise and rest; and emotional poise and self esteem. These ideas came initially from common sense observations of “Nature’s Laws,” but they have been rediscovered and scientifically validated by an ever increasing number of modern health reformers in the fields of nutrition, ecology, physiology, and psychology. Fasting Can Save Your Life is not meant to be a how-to guide to self-conducted fasting. Readers should take important note that all fasts should be conducted under the supervision of a qualified doctor trained in the use of therapeutic fasting. In 1978, Dr. Shelton helped found the International Association of Professional Natural Hygienists (IAPNH), which sets standards of practice for conducting therapeutic fasts, promotes documentation, and encourages research into this beneficial process. IAPNH membership is open to licensed primary care physicians (medical doctors, osteopaths, chiropractors and naturopaths). IAPNH members can receive training and certification in the use of therapeutic fasting. Dr. Shelton also helped found the American Natural Hygiene Society, an organization dedicated to educating individuals about the principles of natural living. Since its inception in 1948, the Society has grown dramatically and now has members around the world. It is important for readers to remember that fasting is not a panacea for all that ails you. Fasting 11must be used as part of a healthy lifestyle, not instead of one; and in order to maintain the beneficial results, one must continue with a healthy lifestyle afterwards. Ronald G. Cridland, M.D. Vice-President, International Association of Professional Natural Hygienists 12Contents Preface to the Second Edition Preface to the First Edition 1 Fasting and You 2 Pounds that Slip Away 3 Living without Eating 4 Hunger versus Appetite 5 Four Reasons for Fasting 6 Gaining Strength 7 Can Fasting Kill? 8 Does Fasting Cure? 9 Fasting: Where and When? 10 What to Expect while Fasting 11 Nine Basic Steps 12 Breaking the Fast 13 Can Fasting Keep You Well? 14 Rejuvenation through Fasting 15 Fasting to Gain Weight 16 Should Children Fast? 17 Fasting in Acute Disease 18 Fasting in Chronic Disease 19 The Case of the Common Cold 20 Multiple Sclerosis 21 Asthma 22 Arthritis: Two Years or Twenty-eight? 23 Peptic Ulcer 24 Migraine 25 Hay Fever 26 High Blood Pressure 27 The Fast and the Heart 28 Colitis 29 Psoriasis and Eczema 30 Prostatic Enlargement 31 Gonorrhea 32 Paralysis Agitans 33 Nephritis 34 Gallstones 1335 Tumors of the Breast 36 Sterility in Women 37 Fasting in Pregnancy One Closing Word Index 14Preface to the Second Edition Much water, much of it dirty, has passed under the bridge since the first edition of Fasting Can Save Your Life came from the press. Many newspaper and magazine articles and several books on fasting have been published presenting such a wide variety of contradictory views and opinions that the reading public is hopelessly confused. The greater part of this mass of contradictory material has revolved about the propriety or impropriety of the use of the fast as a means of reducing weight. A large part of it has stressed the largely imaginary dangers of fasting. Much of it has emphasized the demand that any fast of more than three days’ duration should be done under medical supervision, preferably in a hsopital. Some of the books and articles have presented the reader with “just as good” or better substitutes for the fast. There is also much disagreement about the proper conduct of the fast. When the experts disagree so widely what is the poor reader to do? One “scientific” experimenter adds greatly to the confusion by his use, several times in the course of a short article, of the phrase starvation therapy. Several of the men of science use the terms fasting and starvation synonymously, whereas the simple truth is that if one is fasting, one is not starving and if one is starving, one is not fasting. The loose use of the terms fasting and starving as of identical meaning and the implied assumption that the two processes are identical, when this is not done with the deliberate intent of arousing prejudice, is a reliable index of the confusion in the mind of the writer. The phrases “untoward side effects” and “adverse reactions” appear so often in the writings of scientific experimenters that, when reading them, one easily gets the idea that one is reading about drugs. When a fast is entered and the faster abstains from tea, coffee, alcohol, soda fountain slops, condiments, spices, mustard, food additives and other irritating and stimulating substances which he is accustomed to taking both with his meals and between meals, and discontinues dosing himself at intervals with aspirin or other drugs, he experiences headache, dizziness, weakness, trembling, pains in the abdomen, back, and joints; he may faint; and he may be nauseous and even vomit. These “withdrawal symptoms” are not “side effects” of fasting, but are the extensions of the same symptoms, with which he was annoyed while eating and which he smothered with frequent cigarettes, cups of coffee, Turns or other popular drug-desserts. That these so-called “side effects” of fasting are not caused by fasting, but by the habitual poisoning indulged in as a regular part of his daily life, is shown by the fact that if the fast is continued the symptoms all clear up. Another cause of “untoward side-effects” is the practice of the scientific experimenters of encouraging fasters to supply their need for fluid (water) by drinking tea, coffee, soda fountain slop, beer, wine, ale, and strained soups or broth. There are the additional practices of giving drugs to suppress every discomfort that may arise and of permitting the continuance of smoking or other drug taking. There is a great difference between a poisoned fast and an unpoisoned one. Not until the scientific men test the unpoisoned fast will they be in a position to properly evaluate the results of fasting. To put a very fat woman on a fast and continue it for over three hundred days all the while supplying her fluid needs with tea and coffee, both of them containing the heart irritant caffeine, and blaming the impairment of the heart upon the fast and not upon the caffeine, does not make good sense. Likewise, dosing the faster with liberal quantities of synthetic vitamins and drug-store minerals ruinously affects the whole experiment. All together too much emphasis has been placed upon the dangers of protein deficiency, thus 15creating great fear of fasting. The evils of protein deficiencies conjured up out of the void have frightened great numbers of people. There is no danger of protein deficiency developing in a fast of ordinary duration. It is perhaps a possibility in a fast of two to three hundred days or more, but the greatest danger in these extremely long fasts lies in the poisons taken as drink and as medicine. It will be difficult to fully assess the physiological wreakage that results from the repeated examinations and testing that constitute an important feature of the hospital-supervision of the fast. The depressing effect of daily pulse-counting, blood-pressure taking, heart examination, blood and urine sampling, checking the temperature and similar psychologically disturbing activities is considerable. For best results, the faster needs calm, quiet, cheerful surroundings. The faster needs to relax and take life easy. Too much officious meddling is
[ 555, 264, 9498, 19433, 11, 720, 28156, 198, 4148, 279, 11384, 315, 8624, 323, 720, 4919, 198, 29057, 43880, 198, 1820, 21730, 1920, 627, 8607, 6603, 617, 1027, 5439, 922, 1054, 8783, 560, 5043, 82, 2476, 1054, 97250, 5043, 82, 2476, 1054, 9533, 82, 369, 4785, 4814, 2476, 198, 12380, 2637, 719, 814, 6118, 656, 539, 2686, 54560, 505, 264, 4686, 53194, 1486, 315, 1684, 13, 720, 37, 15067, 198, 6854, 10467, 4718, 9601, 198, 16964, 279, 837, 53194, 54560, 1920, 13, 1115, 18065, 279, 671, 95821, 198, 1527, 682, 3691, 477, 7172, 11, 3734, 10748, 3090, 11, 2391, 264, 892, 994, 279, 1732, 753, 43226, 30600, 527, 198, 1037, 19684, 311, 10519, 264, 16595, 2942, 734, 323, 6070, 13, 8442, 1778, 264, 5043, 649, 35608, 279, 2547, 753, 198, 383, 6260, 4754, 627, 644, 813, 1866, 34147, 4221, 11, 13633, 5304, 813, 71257, 3217, 315, 15945, 3876, 927, 198, 1272, 11, 931, 5043, 82, 11, 58463, 386, 13, 37940, 783, 8544, 279, 3682, 4819, 5552, 311, 54560, 13, 1283, 15100, 1268, 198, 9533, 287, 649, 3629, 4546, 3135, 430, 1690, 1053, 1781, 12266, 13, 1283, 15884, 14564, 279, 198, 5581, 30771, 36028, 430, 279, 653, 2381, 10234, 617, 7119, 54560, 13, 4497, 23659, 11, 568, 16964, 198, 9533, 287, 539, 439, 459, 25181, 6725, 719, 439, 961, 315, 264, 16195, 2890, 2512, 1887, 568, 2663, 198, 55381, 10320, 43312, 627, 9023, 13, 37940, 783, 753, 6848, 922, 54560, 323, 18955, 10320, 43312, 1766, 872, 20282, 304, 279, 43422, 315, 264, 198, 4166, 315, 23053, 11, 66089, 9478, 6593, 16410, 11, 2737, 42608, 71290, 11, 386, 920, 2637, 5340, 85150, 198, 83489, 11, 386, 920, 2637, 16687, 12930, 12424, 36968, 5469, 11, 386, 920, 2637, 25953, 666, 9881, 19177, 11, 386, 920, 2637, 323, 3842, 350, 52965, 11, 386, 920, 627, 9673, 3026, 323, 3278, 1051, 4315, 279, 1176, 311, 15641, 430, 720, 12393, 3135, 505, 2890, 1285, 5496, 627, 7009, 16365, 430, 264, 9498, 2324, 14117, 5304, 264, 4335, 4676, 2345, 72408, 3805, 11, 10748, 3090, 323, 198, 40619, 31338, 26, 264, 5933, 46482, 10173, 2345, 18375, 6751, 26390, 11, 24822, 11, 31049, 11, 19595, 323, 4459, 41936, 280, 34370, 5820, 2345, 82, 27781, 10368, 323, 2800, 26, 323, 14604, 3273, 1082, 323, 659, 85597, 13, 4314, 6848, 198, 6142, 15453, 505, 4279, 5647, 24654, 315, 1054, 79519, 753, 42089, 2476, 719, 814, 617, 1027, 198, 22496, 21468, 323, 74647, 33432, 555, 459, 3596, 7859, 1396, 315, 6617, 2890, 15180, 388, 198, 258, 279, 5151, 315, 26677, 11, 72546, 11, 78152, 11, 323, 31018, 627, 37, 15067, 3053, 10467, 4718, 9601, 198, 374, 720, 1962, 198, 8967, 311, 387, 264, 1268, 4791, 8641, 311, 659, 15204, 55015, 54560, 627, 4518, 388, 1288, 1935, 3062, 5296, 430, 682, 5043, 82, 1288, 387, 13375, 1234, 279, 38217, 315, 264, 198, 37435, 10896, 16572, 304, 279, 1005, 315, 37471, 54560, 627, 644, 220, 4468, 23, 11, 2999, 13, 37940, 783, 9087, 1766, 279, 7327, 10229, 315, 21931, 18955, 198, 31916, 88364, 1705, 320, 40, 2599, 52371, 705, 902, 7437, 10886, 315, 6725, 369, 31474, 37471, 5043, 82, 11, 39990, 198, 77403, 11, 323, 37167, 3495, 1139, 420, 24629, 1920, 13, 358, 2599, 52371, 16250, 374, 1825, 198, 998, 16383, 6156, 2512, 35944, 320, 69216, 16410, 11, 52368, 454, 27382, 11, 77301, 21846, 323, 18050, 84, 897, 27382, 4390, 40, 2599, 52371, 3697, 649, 5371, 4967, 323, 28706, 304, 279, 1005, 315, 37471, 54560, 627, 9023, 13, 37940, 783, 1101, 9087, 1766, 279, 3778, 18955, 10320, 43312, 13581, 11, 459, 7471, 12514, 198, 998, 67805, 7931, 922, 279, 16565, 315, 5933, 5496, 13, 8876, 1202, 54529, 304, 220, 6393, 23, 11, 279, 198, 50, 6180, 706, 15042, 29057, 323, 1457, 706, 3697, 2212, 279, 1917, 627, 2181, 374, 3062, 369, 13016, 311, 6227, 430, 54560, 374, 539, 264, 7363, 83682, 369, 682, 430, 264, 8839, 499, 13, 435, 15067, 198, 806, 25849, 387, 1511, 439, 720, 4581, 198, 315, 264, 9498, 19433, 11, 539, 720, 65937, 198, 315, 832, 26, 323, 304, 2015, 311, 10519, 279, 198, 68244, 7235, 3135, 11, 832, 2011, 3136, 449, 264, 9498, 19433, 27905, 627, 54925, 4852, 480, 13, 356, 1907, 1974, 11, 386, 920, 627, 53, 560, 86481, 11, 7327, 10229, 315, 21931, 18955, 10320, 88364, 1705, 198, 717, 15147, 198, 31078, 580, 311, 279, 10657, 14398, 198, 31078, 580, 311, 279, 5629, 14398, 198, 16, 198, 37, 15067, 323, 1472, 198, 17, 198, 47, 3171, 430, 59632, 42581, 198, 18, 198, 45605, 2085, 60638, 198, 19, 198, 39, 72722, 19579, 93379, 635, 198, 20, 198, 28070, 66131, 369, 435, 15067, 198, 21, 198, 38, 2101, 32937, 198, 22, 198, 6854, 435, 15067, 27933, 5380, 23, 198, 22186, 435, 15067, 70819, 5380, 24, 198, 37, 15067, 25, 11208, 323, 3277, 5380, 605, 198, 3923, 311, 33185, 1418, 435, 15067, 198, 806, 198, 84429, 14967, 40961, 198, 717, 198, 61279, 279, 17737, 198, 1032, 198, 6854, 435, 15067, 13969, 1472, 8489, 5380, 975, 198, 697, 63231, 367, 1555, 435, 15067, 198, 868, 198, 37, 15067, 311, 50809, 16923, 198, 845, 198, 15346, 15394, 17737, 5380, 1114, 198, 37, 15067, 304, 6515, 1088, 31974, 198, 972, 198, 37, 15067, 304, 73782, 31974, 198, 777, 198, 791, 11799, 315, 279, 7874, 24062, 198, 508, 198, 33189, 328, 91711, 198, 1691, 198, 32, 31177, 1764, 198, 1313, 198, 7098, 40485, 25, 9220, 23116, 477, 44956, 70815, 5380, 1419, 198, 10407, 27330, 16991, 3913, 198, 1187, 198, 44, 5346, 8511, 198, 914, 198, 57564, 85001, 198, 1627, 198, 12243, 20671, 40090, 198, 1544, 198, 791, 17737, 323, 279, 18449, 198, 1591, 198, 6255, 20000, 198, 1682, 198, 21051, 93003, 323, 469, 14088, 9355, 198, 966, 198, 1360, 2020, 2998, 27995, 1133, 198, 2148, 198, 38, 263, 17847, 41033, 198, 843, 198, 4368, 9270, 4701, 275, 598, 198, 1644, 198, 45, 24453, 38090, 198, 1958, 198, 38, 543, 33610, 198, 9423, 20, 198, 51, 372, 1105, 315, 279, 57598, 198, 1927, 198, 81450, 1429, 304, 11215, 198, 1806, 198, 37, 15067, 304, 83627, 198, 4054, 62213, 9506, 198, 1581, 198, 975, 31078, 580, 311, 279, 10657, 14398, 198, 43182, 3090, 11, 1790, 315, 433, 19108, 11, 706, 5946, 1234, 279, 14497, 2533, 279, 1176, 14002, 315, 720, 37, 15067, 3053, 198, 8960, 4718, 9601, 198, 3782, 505, 279, 3577, 13, 9176, 17222, 323, 14756, 9908, 323, 3892, 6603, 389, 198, 9533, 287, 617, 1027, 4756, 32644, 1778, 264, 7029, 8205, 315, 71240, 6325, 323, 18463, 198, 9210, 279, 5403, 586, 374, 3987, 16117, 22568, 13, 578, 7191, 961, 315, 420, 3148, 315, 71240, 198, 8407, 706, 5891, 8905, 922, 279, 21744, 2676, 477, 737, 71621, 2676, 315, 279, 1005, 315, 279, 5043, 439, 264, 3445, 315, 198, 265, 1072, 6253, 4785, 13, 362, 3544, 961, 315, 433, 706, 32647, 279, 14090, 51052, 37064, 315, 54560, 13, 24191, 315, 433, 198, 4752, 46728, 279, 7631, 430, 904, 5043, 315, 810, 1109, 2380, 2919, 529, 8250, 1288, 387, 2884, 1234, 198, 69216, 38217, 11, 52754, 304, 264, 33320, 454, 2223, 13, 4427, 315, 279, 6603, 323, 9908, 617, 10666, 279, 198, 11397, 449, 1054, 4345, 439, 1695, 863, 477, 2731, 91362, 369, 279, 5043, 13, 2684, 374, 1101, 1790, 62646, 922, 198, 1820, 6300, 6929, 315, 279, 5043, 13, 3277, 279, 11909, 29395, 779, 13882, 1148, 374, 279, 8009, 6742, 311, 656, 5380, 4054, 1054, 85930, 863, 2183, 318, 1992, 11621, 19407, 311, 279, 22047, 555, 813, 1005, 11, 3892, 3115, 304, 279, 198, 12120, 315, 264, 2875, 4652, 11, 315, 279, 17571, 720, 12134, 61428, 15419, 627, 26778, 315, 279, 3026, 315, 720, 40657, 198, 1005, 279, 198, 18853, 720, 9533, 287, 198, 323, 720, 12134, 61428, 198, 74450, 7162, 11, 20444, 279, 4382, 8206, 374, 430, 422, 832, 374, 54560, 11, 832, 374, 198, 1962, 78501, 323, 422, 832, 374, 78501, 11, 832, 374, 539, 54560, 13, 578, 20784, 1005, 315, 279, 3878, 54560, 323, 78501, 198, 300, 315, 20086, 7438, 323, 279, 6259, 25329, 430, 279, 1403, 11618, 527, 20086, 11, 994, 420, 198, 285, 539, 2884, 449, 279, 46072, 7537, 315, 75123, 287, 48786, 11, 374, 264, 15062, 1963, 315, 279, 22047, 304, 198, 1820, 4059, 315, 279, 7061, 627, 791, 32847, 1054, 3935, 83071, 3185, 6372, 863, 323, 1054, 329, 4550, 25481, 863, 5101, 779, 3629, 304, 279, 43422, 315, 198, 85930, 9526, 388, 430, 11, 994, 5403, 1124, 11, 832, 6847, 5334, 279, 4623, 430, 832, 374, 5403, 922, 198, 3696, 13602, 13, 3277, 264, 5043, 374, 10862, 323, 279, 10819, 63944, 1771, 505, 15600, 11, 11033, 11, 13200, 11, 39962, 57713, 18067, 1725, 345, 1321, 12843, 11, 49659, 11, 65407, 11, 3691, 85286, 323, 1023, 85077, 323, 65792, 33155, 902, 198, 383, 374, 53184, 311, 4737, 2225, 449, 813, 21644, 323, 1990, 21644, 11, 323, 45980, 1157, 8924, 287, 5678, 198, 266, 28090, 449, 25689, 258, 477, 1023, 11217, 11, 568, 11704, 47846, 11, 294, 97745, 11, 23948, 11, 93088, 345, 79, 1771, 304, 279, 64772, 11, 1203, 11, 323, 35358, 26, 568, 1253, 38678, 26, 323, 568, 1253, 387, 49394, 788, 323, 198, 1524, 22752, 275, 627, 9673, 1054, 63546, 278, 13803, 863, 527, 539, 1054, 3002, 6372, 863, 315, 54560, 11, 719, 527, 279, 20300, 315, 279, 1890, 198, 24738, 52273, 11, 449, 902, 568, 574, 57130, 1418, 12459, 323, 902, 568, 1554, 1605, 291, 449, 21420, 198, 66, 44375, 2392, 11, 26446, 315, 11033, 11, 58334, 477, 1023, 5526, 5623, 89429, 15916, 13, 3011, 1521, 779, 19434, 1054, 3002, 6372, 89874, 1073, 54560, 527, 539, 9057, 555, 54560, 11, 719, 555, 279, 84820, 52236, 37960, 3640, 304, 439, 264, 5912, 961, 315, 198, 26301, 7446, 2324, 11, 374, 6982, 555, 279, 2144, 430, 422, 279, 5043, 374, 8738, 279, 13803, 682, 2867, 709, 627, 14364, 5353, 315, 1054, 3935, 83071, 3185, 75888, 863, 374, 279, 6725, 315, 279, 12624, 9526, 388, 315, 198, 967, 414, 4210, 5043, 388, 311, 8312, 872, 1205, 369, 15962, 320, 13284, 8, 555, 16558, 15600, 11, 11033, 11, 39962, 57713, 198, 82, 23085, 11, 13179, 11, 13378, 11, 22180, 11, 323, 73779, 5945, 1725, 477, 45993, 13, 2684, 527, 279, 5217, 12659, 315, 7231, 198, 3696, 13602, 311, 28321, 1475, 44776, 430, 1253, 31889, 323, 315, 62174, 279, 16513, 685, 315, 20149, 477, 198, 1605, 5623, 4737, 627, 3947, 374, 264, 2294, 6811, 1990, 264, 71598, 5043, 323, 459, 653, 5481, 3416, 291, 832, 13, 2876, 3156, 279, 198, 85930, 3026, 1296, 279, 653, 5481, 3416, 291, 5043, 690, 814, 387, 304, 264, 2361, 311, 10489, 15806, 279, 3135, 315, 198, 9533, 287, 13, 2057, 2231, 264, 1633, 8834, 5333, 389, 264, 5043, 323, 3136, 433, 369, 927, 2380, 7895, 2919, 682, 279, 1418, 198, 95783, 287, 1077, 15962, 3966, 449, 15600, 323, 11033, 11, 2225, 315, 1124, 8649, 279, 4851, 30118, 519, 49750, 345, 438, 59771, 279, 53317, 315, 279, 4851, 5304, 279, 5043, 323, 539, 5304, 279, 49750, 11, 1587, 539, 1304, 198, 19045, 5647, 13, 50487, 11, 8924, 287, 279, 10819, 449, 18250, 33776, 315, 28367, 46192, 323, 5623, 34352, 198, 1083, 17822, 38339, 7162, 22223, 279, 4459, 9526, 627, 2460, 3871, 2288, 1790, 25679, 706, 1027, 9277, 5304, 279, 37064, 315, 13128, 48294, 11, 8617, 198, 868, 46002, 2294, 8850, 315, 54560, 13, 578, 86907, 315, 13128, 72946, 16898, 3149, 709, 704, 315, 279, 742, 617, 198, 69, 1315, 6901, 2294, 5219, 315, 1274, 13, 2684, 374, 912, 8137, 315, 13128, 48294, 11469, 304, 264, 5043, 198, 1073, 19664, 8250, 13, 1102, 374, 8530, 264, 13336, 304, 264, 5043, 315, 1403, 311, 2380, 7895, 2919, 477, 810, 11, 719, 198, 1820, 12474, 8137, 304, 1521, 9193, 1317, 5043, 82, 15812, 304, 279, 3273, 19941, 4529, 439, 7172, 323, 439, 16088, 627, 2181, 690, 387, 5107, 311, 7373, 8720, 279, 53194, 83675, 425, 430, 3135, 505, 279, 11763, 198, 327, 8778, 811, 323, 7649, 430, 35256, 459, 3062, 4668, 315, 279, 8952, 59615, 651, 1854, 315, 279, 5043, 627, 791, 71810, 2515, 315, 7446, 28334, 27678, 287, 11, 6680, 89561, 4737, 11, 4851, 24481, 11, 6680, 323, 198, 324, 483, 25936, 11, 13598, 279, 9499, 323, 4528, 96655, 34973, 7640, 374, 198, 25742, 481, 13, 1789, 1888, 3135, 11, 279, 10819, 3966, 19858, 11, 11594, 11, 71414, 40190, 13, 578, 10819, 3966, 198, 998, 12234, 323, 1935, 2324, 4228, 13, 25619, 1790, 2856, 1245, 81313, 374 ]
0xBreath/holistic-books
for delicious baked vegetables will work with any assort­ ment of vegetables except brussels sprouts, which tend to get bitter. Vegetables simply baked in butter and their own juices have a unique flavor that cannot be duplicated with other cooking methods. 202 • FIT FOR LIFE 1 cup carrots, cut into fine matchsticks 2 cups potatoes, peeled, quartered, and cut into '/4-inch slices or 1 small cauliflower, cut into '/2-inch florets 1 package frozen Fordhook lima beans 2 large zucchini, quartered and cut into 1-inch cubes 2 cups cabbage or bok choy greens, coarsely chopped '/» cup butter 3 tablespoons fresh parsley, minced (optional) '/» teaspoon Spike or salt-free seasoning Vi teaspoon sea salt (optional) Fresh ground black pepper Preheat oven to 325 degrees. Place all vegetables in heavy oven-proof casserole with lid. Dot with butter. Sprinkle with parsley, Spike, sea salt, and pepper. Cover and place in oven for 35-40 minutes or until vegeta­ bles are tender. Toss with additional butter, if desired, and serve with salad. Can also be added to salad to make the Spring Garden main-course salad. Serves 4. Freeze 2 cups cantaloupe wedges (V2 cantaloupe) in an airtight container for tomorrow's Cantaloupe Ice before going to bed. DAY TWENTY-ONE—SUNDAY BREAKFAST: Fresh juice and the fruit salad of your choice, or Blueberry-Cantaloupe Supreme * and Cantaloupe Ice * LUNCH: Fresh fruit or carrot juice (optional) Cuke-a-tillas (see page 170), or Tabouli,' and/or Energy Salad (see page 149) DINNER: Fresh Vegetable Juice Cocktail, if desired (see page 152) Savory Cabbage Strudel," or Broiled Fish Steaks (see page 184) Steamed Vegetables in Lemon Butter Sauce * Dilled Cucumbers (see page 185), or Grandma's Coleslaw (see page 197) A FOUR-WEEK EXAMPLE OF THE FITNESS LIFESTYLE • 203 BLUEBERRY-CANTALOUPE SUPREME 10 Mia. This is a delectable summer fruit salad. Mango can be substituted for the cantaloupe. A ripe mango will be soft to pressure but not mushy. It should be very red, yellow-orange, or yellow-green. True green on a mango indi­ cates that it is not yet ripe and will be sour. Peel the mango, and cut the fruit from the seed. Freeze summer fruits for winter enjoyment. To freeze fruits, cut them into pieces. Quarters are most convenient for peaches, nectarines, apricots, etc. Berries may be left whole. Melons should be cut into two-inch chunks. Bananas can be frozen whole, but should be peeled first. Papayas and mangos should be peeled and cut into pieces. Fruits should be placed in airtight containers and frozen. All frozen fruits can be turned into wonderful fruit freezes with a Champion or Oster juicer. Yz cantaloupe, cut into bite-size cubes or in balls, or 1 mango, cut in cubes 2 Babcock peaches, peeled and sliced 1 cup blueberries 1 small banana, cut into slices (optional) Mix all fruits together. On a hot summer day, you might want to top this salad with Cantaloupe Ice (see below) and serve it for brunch or lunch. It also makes a beautiful first course for dinner. CANTALOUPE ICE 3 Mia. Vi cantaloupe, cut into cubes and frozen Here's another incentive to purchase a juicer, which will not only enable you to make your own fresh juices, but will also open the door to a delicious ice cream alternative: FRESH FRUIT SOFT FREEZE! Soft freeze is most easily prepared in a juicer. Push frozen fruit through, and out comes a marvelous frozen dessert, with no chemicals, additives, dairy products, or sugar! Any frozen fruit can be used: cantaloupe, banana, strawberries, or whatever you like. They can be used in combination or by themselves. If you don't have a juicer, soft freeze can be made in your food processor or blender. 204 • FIT FOR LIFE : TABOULI 4SMin. 1 cup cracked wheat (bulgur) Wi-2 cups water Vi cup fresh parsley, chopped Vz tablespoon scallions, minced 2 tablespoons fresh mint, chopped (You may substitute 2 teaspoons dried mint if fresh is not available.) 2 tablespoons olive oil 2 teaspoons fresh lemon juice Vi teaspoon sea salt, seasoned salt, or salt-free seasoning Fresh ground black pepper (optional) 1 small tomato, chopped (optional) Combine cracked wheat and water, and soak until wheat is hvdrated and water is absorbed, from 30—60 minutes. Add parsley, scallions, mint, olive oil, lemon juice, salt, and pepper, if desired. Mix well. Add tomato and mix gently. Serve at room temperature, or chill until ready to serve. Serves 4. SAVORY CABBAGE STRUDEL 1 Hi. 15 Min. 1 tablespoon butter 4 cups cabbage, finely shredded 2 cups bok choy greens, shredded 1 tablespoon currants (optional) 1 small onion, sliced thin 2 scallions, chopped 2 tablespoons fresh dill, chopped, or 1 teaspoon dried dill 2 tablespoons fresh cilantro or parsley, chopped Vi teaspoon sea salt, seasoned salt, or salt-free seasoning Prepare the filling. Melt butter in large heavy saucepan. Add cabbage and bok choy greens, currants, onion, and scallions. Cook over medium-high heat, stirring fre­ quently, for 3-4 minutes or until greens begin to wilt. Add dill, cilantro, and sea salt, and cook for 1 minute over high heat, stirring well to thor­ oughly incorporate herbs into vegetables. Set aside. A FOUR-WEEK EXAMPLE OF THE FITNESS UFE-STYLE • 205 1 tablespoon butter Vi pound fresh mushrooms, sliced 1 teaspoon fresh lemon juice Prepare the mushrooms. In separate large skillet, melt butter. Add mushrooms, and saute briefly over high heat, stirring frequently, until they begin to soften. Remove from heat, sprinkle with lemon juice, and add to vegetable mixture. Mix well. 4 phyllo pastry sheets (available in frozen-food section of supermarket or at food specialty shops) 2 tablespoons butter, melted 4 tablespoons dry whole-wheat bread crumbs Assemble the strudel. Preheat oven to 400 degrees. Strain mushroom-vegetable mixture in col­ ander, catching liquid in small bowl. Reserve liquid to add to soup, sauces, or gravy. Lightly butter cookie sheet. Place 1 phyllo sheet on damp towel. Brush lightly with melted butter. Place second phyllo sheet on top of first. Sprinkle 2 tablespoons of bread crumbs on left-hand side of phyllo. Fold right-hand side over to encase bread crumbs, making a rectangle. Brush top lightly with melted butter. Spread Vi vegetable mix­ ture along long edge, stopping 1 inch short of the short sides. Fold bor­ ders in to encase vegetables. Roll as you would a jelly roll. Place seam side down on buttered baking sheet. Brush roll with melted butter. Re­ peat for second roll. Bake until golden, about 30 minutes. Cut each into 3 or 4 sections. Serves 3-4. STEAMED VEGETABLES IN LEMON BUTTER SAUCE 20 Min. 4-6 tender young carrots, cut into '/2-inch cubes 2 medium zucchini 2 medium yellow squash 2 tablespoons butter, melted 2 teaspoons fresh lemon juice Place carrots in vegetable steamer, covered, over boiling water for approx­ imately 10 minutes. Add zucchini and squash, whole, and steam 5-7 206 • FIT FOR LIFE minutes or until just tender. Place vegetables in serving dish. Cut squash into quarters, lengthwise, and then into '/2-inch cubes. Combine butter and lemon juice in measuring cup, and pour over vegetables. Toss gently. Serves 4. ALL-FRUIT DAY DAY TWENTY-TWO—MONDAY BREAKFAST: Fresh fruit juice LUNCH: Fresh fruit juice, fruit salad of your choice, or assorted pieces of fruit; Cantaloupe Ice (see page 204), if desired DINNER: Fresh fruit Date or Strawberry Shake (see page 194), if desired The All-fruit Day is your best friend in the care, upkeep, and beautification of your body. Once you have mastered this valuable tool for weight loss and health, you are on your way to a new fitness life-style. DAY TWENTY-THREE—TUESDAY BREAKFAST: Same as Day One. LUNCH: Fresh fruit or carrot juice (optional) Nuts and Cukes (see page 162), or Romain
[ 369, 18406, 41778, 24822, 690, 990, 449, 904, 51034, 5879, 198, 479, 315, 24822, 3734, 1437, 32964, 8314, 11934, 11, 902, 8541, 311, 636, 26242, 13, 720, 43712, 456, 4893, 5042, 41778, 304, 14432, 323, 872, 1866, 65959, 617, 264, 5016, 720, 1517, 3372, 430, 4250, 387, 56003, 449, 1023, 17677, 5528, 13, 720, 2366, 7436, 7608, 4716, 61094, 220, 16, 10747, 62517, 11, 4018, 1139, 7060, 2489, 70045, 720, 17, 26446, 35267, 11, 83612, 11, 8502, 291, 11, 323, 4018, 1139, 3434, 19, 25224, 35354, 477, 220, 16, 720, 9181, 96970, 11, 4018, 1139, 3434, 17, 25224, 9943, 76430, 720, 16, 6462, 20268, 14337, 21543, 4671, 64, 27994, 720, 17, 3544, 1167, 86670, 11, 8502, 291, 323, 4018, 1139, 220, 16, 25224, 55204, 720, 17, 26446, 74873, 477, 293, 564, 523, 2303, 52011, 11, 1080, 1590, 989, 38525, 720, 20788, 13289, 10747, 14432, 720, 18, 56588, 7878, 88621, 11, 94927, 320, 13099, 8, 720, 20788, 13289, 42384, 61352, 477, 12290, 12862, 87319, 720, 36644, 42384, 9581, 12290, 320, 13099, 8, 720, 56753, 5015, 3776, 25349, 720, 4808, 20559, 24276, 311, 220, 15257, 12628, 13, 11004, 682, 24822, 304, 8987, 24276, 60267, 720, 66, 34858, 1286, 449, 27431, 13, 32362, 449, 14432, 13, 15883, 36244, 449, 88621, 11, 61352, 11, 9581, 12290, 11, 720, 438, 25349, 13, 18230, 323, 2035, 304, 24276, 369, 220, 1758, 12, 1272, 4520, 477, 3156, 13294, 64, 5879, 198, 39863, 527, 28682, 13, 720, 51, 3746, 449, 5217, 14432, 11, 422, 12974, 11, 323, 8854, 449, 33566, 13, 3053, 720, 19171, 387, 3779, 311, 33566, 311, 1304, 279, 12531, 19558, 1925, 69529, 33566, 13, 720, 50, 13583, 220, 19, 13, 720, 11180, 3059, 220, 17, 26446, 16869, 278, 283, 375, 11077, 4282, 320, 53, 17, 16869, 278, 283, 375, 8, 304, 459, 264, 2154, 492, 5593, 369, 720, 38501, 7924, 596, 42931, 278, 283, 375, 20534, 1603, 2133, 311, 4950, 13, 720, 34212, 36655, 1863, 56, 12, 5338, 2345, 50, 13508, 3097, 720, 90525, 60306, 25, 720, 56753, 23661, 323, 279, 14098, 33566, 315, 701, 5873, 11, 477, 8868, 15717, 7813, 60793, 283, 375, 720, 10254, 9831, 353, 323, 42931, 278, 283, 375, 20534, 353, 720, 43, 54856, 25, 720, 56753, 14098, 477, 75294, 23661, 320, 13099, 8, 720, 34, 10647, 7561, 2442, 34344, 320, 4151, 2199, 220, 8258, 705, 477, 15490, 283, 747, 2965, 323, 5255, 12634, 64646, 320, 4151, 2199, 720, 10161, 8, 720, 35, 59224, 25, 720, 56753, 95392, 66851, 93816, 11, 422, 12974, 320, 4151, 2199, 220, 9756, 8, 720, 50, 402, 683, 356, 57589, 4610, 664, 301, 1359, 477, 6031, 2230, 17019, 3441, 10011, 320, 4151, 2199, 220, 10336, 8, 720, 21573, 3690, 43800, 4893, 304, 52310, 31457, 61276, 353, 720, 35, 4473, 356, 1791, 372, 1941, 320, 4151, 2199, 220, 9741, 705, 477, 99068, 596, 3623, 645, 20510, 320, 4151, 2199, 720, 4468, 8, 720, 32, 75191, 13299, 33362, 67346, 3083, 3247, 7877, 445, 92220, 25784, 7436, 220, 9639, 56992, 33, 73995, 7813, 2891, 984, 12188, 1777, 54722, 793, 7614, 220, 605, 61697, 13, 720, 2028, 374, 264, 409, 772, 481, 7474, 14098, 33566, 13, 91963, 649, 387, 63196, 369, 279, 720, 66, 60793, 283, 375, 13, 362, 57796, 70368, 690, 387, 8579, 311, 7410, 719, 539, 30823, 88, 13, 1102, 1288, 720, 1395, 1633, 2579, 11, 14071, 85483, 11, 477, 14071, 39368, 13, 3082, 6307, 389, 264, 70368, 1280, 72, 5879, 198, 66, 988, 430, 433, 374, 539, 3686, 57796, 323, 690, 387, 20897, 13, 89694, 279, 70368, 11, 323, 4018, 279, 720, 36698, 505, 279, 10533, 13, 79692, 7474, 26390, 369, 12688, 45278, 13, 2057, 31030, 720, 1658, 12059, 11, 4018, 1124, 1139, 9863, 13, 3489, 14698, 527, 1455, 17125, 369, 1069, 14576, 11, 720, 2375, 277, 1572, 11, 21726, 292, 2469, 11, 5099, 13, 9084, 4108, 1253, 387, 2163, 4459, 13, 11220, 2439, 1288, 387, 4018, 720, 18614, 1403, 25224, 27855, 13, 23565, 26997, 649, 387, 20268, 4459, 11, 719, 1288, 387, 83612, 720, 3983, 13, 32743, 98440, 323, 51296, 437, 1288, 387, 83612, 323, 4018, 1139, 9863, 13, 435, 68998, 720, 5562, 387, 9277, 304, 264, 2154, 492, 24794, 323, 20268, 13, 2052, 20268, 26390, 649, 387, 720, 42286, 1139, 11364, 14098, 94477, 449, 264, 33597, 477, 507, 3751, 10479, 13296, 13, 720, 56, 89, 16869, 278, 283, 375, 11, 4018, 1139, 23556, 7321, 55204, 477, 304, 20953, 11, 477, 220, 16, 70368, 11, 4018, 304, 720, 66, 51725, 720, 17, 26441, 38253, 1069, 14576, 11, 83612, 323, 48715, 720, 16, 10747, 6437, 36989, 720, 16, 2678, 44196, 11, 4018, 1139, 35354, 320, 13099, 8, 720, 59183, 682, 26390, 3871, 13, 1952, 264, 4106, 7474, 1938, 11, 499, 2643, 1390, 311, 1948, 420, 720, 19776, 329, 449, 42931, 278, 283, 375, 20534, 320, 4151, 3770, 8, 323, 8854, 433, 369, 70917, 477, 16163, 13, 1102, 720, 19171, 3727, 264, 6366, 1176, 3388, 369, 14177, 13, 720, 34, 2891, 984, 12188, 1777, 41663, 220, 18, 61697, 13, 720, 36644, 16869, 278, 283, 375, 11, 4018, 1139, 55204, 323, 20268, 720, 8586, 596, 2500, 36210, 311, 7782, 264, 10479, 13296, 11, 902, 690, 539, 1193, 7431, 720, 9514, 311, 1304, 701, 1866, 7878, 65959, 11, 719, 690, 1101, 1825, 279, 6134, 311, 264, 720, 9783, 9824, 10054, 12932, 10778, 25, 435, 21915, 17067, 22572, 5745, 4082, 16655, 53967, 0, 25046, 31030, 374, 720, 3646, 6847, 10235, 304, 264, 10479, 13296, 13, 23804, 20268, 14098, 1555, 11, 323, 704, 720, 6716, 264, 81292, 20268, 43849, 11, 449, 912, 26333, 11, 85286, 11, 34479, 720, 10354, 11, 477, 13465, 0, 5884, 20268, 14098, 649, 387, 1511, 25, 16869, 278, 283, 375, 11, 44196, 11, 720, 496, 675, 36989, 11, 477, 8996, 499, 1093, 13, 2435, 649, 387, 1511, 304, 10824, 477, 720, 1729, 5694, 13, 1442, 499, 1541, 956, 617, 264, 10479, 13296, 11, 8579, 31030, 649, 387, 1903, 304, 701, 720, 14239, 18121, 477, 62895, 13, 720, 7854, 7436, 7608, 4716, 61094, 720, 25, 50276, 46, 1112, 40, 220, 19, 50, 6349, 13, 720, 16, 10747, 43939, 34153, 320, 16501, 70, 324, 8, 720, 59128, 12, 17, 26446, 3090, 720, 36644, 10747, 7878, 88621, 11, 38525, 720, 53, 89, 62611, 1156, 543, 919, 11, 94927, 720, 17, 56588, 7878, 29437, 11, 38525, 320, 2675, 1253, 28779, 220, 17, 720, 668, 300, 83188, 32720, 29437, 422, 7878, 374, 539, 2561, 6266, 720, 17, 56588, 33213, 5707, 720, 17, 93200, 7878, 30564, 23661, 720, 36644, 42384, 9581, 12290, 11, 52614, 12290, 11, 477, 12290, 12862, 87319, 720, 56753, 5015, 3776, 25349, 320, 13099, 8, 720, 16, 2678, 42120, 11, 38525, 320, 13099, 8, 720, 82214, 43939, 34153, 323, 3090, 11, 323, 61792, 3156, 34153, 374, 23585, 3696, 660, 323, 720, 13284, 374, 42101, 11, 505, 220, 966, 2345, 1399, 4520, 13, 2758, 88621, 11, 1156, 543, 919, 11, 29437, 11, 720, 337, 535, 5707, 11, 30564, 23661, 11, 12290, 11, 323, 25349, 11, 422, 12974, 13, 19771, 1664, 13, 2758, 42120, 720, 438, 6651, 30373, 13, 54032, 520, 3130, 9499, 11, 477, 37401, 3156, 5644, 311, 8854, 13, 720, 50, 13583, 220, 19, 13, 720, 7934, 53, 7668, 356, 45422, 3669, 12428, 52, 39432, 220, 16, 21694, 13, 220, 868, 3468, 13, 720, 16, 62611, 14432, 720, 19, 26446, 74873, 11, 61802, 75220, 720, 17, 26446, 293, 564, 523, 2303, 52011, 11, 75220, 720, 16, 62611, 10004, 1821, 320, 13099, 8, 720, 16, 2678, 38427, 11, 48715, 15792, 720, 17, 1156, 543, 919, 11, 38525, 720, 17, 56588, 7878, 294, 484, 11, 38525, 11, 477, 220, 16, 42384, 32720, 294, 484, 720, 17, 56588, 7878, 62444, 87290, 477, 88621, 11, 38525, 720, 36644, 42384, 9581, 12290, 11, 52614, 12290, 11, 477, 12290, 12862, 87319, 720, 51690, 279, 21973, 13, 720, 44, 3903, 14432, 304, 3544, 8987, 19737, 857, 13, 2758, 74873, 323, 293, 564, 523, 2303, 52011, 11, 720, 15789, 1821, 11, 38427, 11, 323, 1156, 543, 919, 13, 12797, 927, 11298, 28661, 8798, 11, 55054, 3541, 5879, 198, 447, 4501, 11, 369, 220, 18, 12, 19, 4520, 477, 3156, 52011, 3240, 311, 75596, 13, 2758, 294, 484, 11, 62444, 87290, 11, 720, 438, 9581, 12290, 11, 323, 4394, 369, 220, 16, 9568, 927, 1579, 8798, 11, 55054, 1664, 311, 73833, 5879, 198, 1409, 398, 33435, 42393, 1139, 24822, 13, 2638, 16038, 13, 720, 32, 75191, 13299, 33362, 67346, 3083, 3247, 7877, 549, 11673, 12, 83077, 7436, 220, 10866, 220, 16, 62611, 14432, 720, 36644, 31123, 7878, 48251, 11, 48715, 720, 16, 42384, 7878, 30564, 23661, 720, 51690, 279, 48251, 13, 720, 644, 8821, 3544, 79085, 11, 30099, 14432, 13, 2758, 48251, 11, 323, 829, 1088, 27851, 720, 2017, 1579, 8798, 11, 55054, 14134, 11, 3156, 814, 3240, 311, 81045, 13, 11016, 720, 1527, 8798, 11, 85947, 449, 30564, 23661, 11, 323, 923, 311, 36581, 21655, 13, 19771, 720, 9336, 13, 720, 19, 1343, 4010, 385, 74155, 25112, 320, 10547, 304, 20268, 64567, 3857, 315, 49313, 720, 269, 520, 3691, 36974, 20021, 8, 720, 17, 56588, 14432, 11, 50459, 720, 19, 56588, 9235, 4459, 2695, 20559, 16385, 97677, 720, 2170, 16167, 279, 610, 664, 301, 13, 720, 4808, 20559, 24276, 311, 220, 3443, 12628, 13, 4610, 467, 58466, 12, 83571, 481, 21655, 304, 1400, 5879, 198, 8363, 11, 34168, 14812, 304, 2678, 19763, 13, 25820, 14812, 311, 923, 311, 19724, 11, 720, 82, 2933, 1634, 11, 477, 88864, 13, 8828, 398, 14432, 12829, 11071, 13, 11004, 220, 16, 1343, 4010, 385, 11071, 389, 720, 67, 1141, 43713, 13, 34088, 34504, 449, 50459, 14432, 13, 11004, 2132, 1343, 4010, 385, 11071, 720, 263, 1948, 315, 1176, 13, 15883, 36244, 220, 17, 56588, 315, 16385, 97677, 389, 2163, 25417, 3185, 720, 1073, 1343, 4010, 385, 13, 61573, 1314, 25417, 3185, 927, 311, 3289, 521, 16385, 97677, 11, 3339, 264, 720, 56416, 13, 34088, 1948, 34504, 449, 50459, 14432, 13, 48816, 11655, 36581, 6651, 5879, 198, 5081, 3235, 1317, 6964, 11, 23351, 220, 16, 17560, 2875, 315, 279, 2875, 11314, 13, 61573, 32732, 5879, 198, 12601, 304, 311, 3289, 521, 24822, 13, 15028, 439, 499, 1053, 264, 52441, 6638, 13, 11004, 27494, 720, 3002, 1523, 389, 14432, 291, 28915, 11071, 13, 34088, 6638, 449, 50459, 14432, 13, 1050, 5879, 198, 11221, 369, 2132, 6638, 13, 53174, 3156, 21411, 11, 922, 220, 966, 4520, 13, 20223, 1855, 1139, 720, 18, 477, 220, 19, 14491, 13, 328, 13583, 220, 18, 12, 19, 13, 720, 59784, 70622, 61988, 3891, 3578, 50, 2006, 720, 877, 22053, 11155, 4292, 16998, 74639, 220, 508, 3468, 13, 720, 19, 12, 21, 28682, 3995, 62517, 11, 4018, 1139, 3434, 17, 25224, 55204, 720, 17, 11298, 1167, 86670, 720, 17, 11298, 14071, 59576, 720, 17, 56588, 14432, 11, 50459, 720, 17, 93200, 7878, 30564, 23661, 720, 17826, 62517, 304, 36581, 4179, 15589, 11, 9960, 11, 927, 50937, 3090, 369, 10049, 5879, 198, 7253, 220, 605, 4520, 13, 2758, 1167, 86670, 323, 59576, 11, 4459, 11, 323, 20930, 220, 20, 12, 22, 720, 11056, 7436, 7608, 4716, 61094, 4520, 477, 3156, 1120, 28682, 13, 11004, 24822, 304, 13788, 12269, 13, 20223, 59576, 720, 18614, 32573, 11, 3160, 4583, 11, 323, 1243, 1139, 3434, 17, 25224, 55204, 13, 47912, 14432, 720, 438, 30564, 23661, 304, 30090, 10747, 11, 323, 5019, 927, 24822, 13, 350, 3746, 720, 70, 4501, 13, 328, 13583, 220, 19, 13, 720, 4006, 7424, 49, 22572, 38788, 720, 34212, 36655, 1863, 56, 9469, 23513, 2345, 22053, 34212, 720, 90525, 60306, 25, 720, 56753, 14098, 23661, 720, 43, 54856, 25, 720, 56753, 14098, 23661, 11, 14098, 33566, 315, 701, 5873, 11, 477, 84542, 9863, 315, 14098, 26, 720, 34, 60793, 283, 375, 20534, 320, 4151, 2199, 220, 7854, 705, 422, 12974, 720, 35, 59224, 25, 720, 56753, 14098, 720, 1956, 477, 89077, 73423, 320, 4151, 2199, 220, 6393, 705, 422, 12974, 720, 791, 2052, 12, 36698, 6187, 374, 701, 1888, 4333, 304, 279, 2512, 11, 97196, 11, 323, 5017, 2461, 315, 720, 22479, 2547, 13, 9843, 499, 617, 71325, 420, 15525, 5507, 369, 4785, 4814, 323, 720, 12393, 11, 499, 527, 389, 701, 1648, 311, 264, 502, 17479, 2324, 11549, 13, 720, 34212, 36655, 1863, 56, 12, 3701, 6731, 2345, 51, 11560, 34212, 720, 90525, 60306, 25, 720, 19749, 439, 6187, 3861, 13, 720, 43, 54856, 25, 720, 56753, 14098, 477, 75294, 23661, 320, 13099, 8, 720, 45, 6256, 323, 356, 65850, 320, 4151, 2199, 220, 10674, 705, 477, 432, 3199 ]
0xBreath/holistic-books
ofu Mousse with Almond Praline   Carrot Coriander Soup 1 teaspoon ghee 1 cup leeks, chopped 1 tablespoon ginger, fresh, chopped 1 teaspoon black pepper ½ teaspoon red chili flakes 1 tablespoon Braggs Liquid Amino Acid or tamari sauce 3 cups carrots, cubed ¼ cup golden raisins, chopped 2 teaspoons coriander, dried 1 teaspoon cumin 1 teaspoon asafetida 4–5 cups vegetable stock 1 teaspoon lemon juice 1 cup low-fat coconut milk 2 tablespoons cilantro or parsley   In a soup pot, heat up the ghee and add the leeks and the ginger. Add the pepper, chili flakes, and 1 teaspoon of Braggs. Add the carrots and the raisins. Sauté for 2 to 3 minutes. Add the coriander, cumin, asa fetida and the rest of the Braggs. Continue to sauté 3 to 5 minutes. Sauté until lightly browned. If the mixture gets too dry, add a little broth. Add vegetable stock to cover and bring to aboil. Cook the soup u ntil carrots are soft. Puree soup with a food processor or a han d blender. Add lemon and coconut milk just before serving. Garnish with freshly chopped cilantro or parsley. Roasted V egetable Barley Risotto Barley 1 teaspoon ghee or olive oil 3 medium-size leeks, chopped 6–8 cups vegetable stock, made flavorful by adding herbs and leeks 1 teaspoon Braggs Liquid Amino Acid or tamari sauce 1 teaspoon balsamic vinegar 1 tablespoon basil, dried 1 teaspoon black pepper 2 cups pearl barley, or ganic   In a heated braising pan, heat ghee and add the leeks. Sauté 1 minute, add 2 tablespo ons vegetable stock, Braggs, vinegar, basil, and pepper. S auté until the leeks are clear. Add the barley. W ith a lar ge spoon, toss the barley around in the pan to brown. Don’ t let the barley get too dry. Add ½ cup of stock, if necessary. Sa uté until the barley becomes golden brown or caramelized. Co ntinue to add ½ cup of stock at a time when the mixture becomes dry. Always add enough stock to cover the barley as it cooks. Keep a lid h andy to use during the cooking process. Continue to check an d stir the barley every few minutes to make sure enough liquid is in the pot to cover the barley. This will take up to 30 minutes at a rapid boil. Roasted V egetables 2 carrots 2 zucchini 1 medium-size eggplant 1 tablespoon olive oil 1 tablespoon Braggs Liquid Amino Acid or tamari sauce 1 tablespoon balsamic vinegar 1 teaspoon black pepper 1 tablespoon Italian herbs  Remove the ends from the carrots, zucchini, and eggplant. Cut each in half. Slice each into ¼-inch slices. Set aside. Combine the oil, Braggs, vinegar, pepper, and Italian herbs in a lar ge bowl. Whisk together with a wire whisk. Add the vegetables and coat with the marinade. Remove from the bowl and lay out on a spra yed sheet pan. Roast in the oven for 30 minutes at 350 degrees. Y ou can also cook them on an outside grill. Remove from oven and cool of f. T o Assemble ½ cup roasted red pepper, fresh or from a jar 1 cup white beans, cooked, or 1 can, rinsed 1 tablespoon fresh rosemary, chopped 1 tablespoon fresh mint, chopped 2 tablespoons fresh basil, thinly sliced 1 cup tomatoes, chopped ¼ cup parsley, chopped   As the barley continu es to cook, and the l iquid absorbs, keep adding the stock until the barley is tender to the taste. Be careful not to overcook. Slice your roasted vegetables into 1-inch bite-size pieces. Add the chopped vegetables into the pot with the cooked barley. Add the roasted red peppers and the cooked white beans. Add freshly chopped rosemary, mint, and basil to the pot. T oss all ingredients. Place the risotto into an attractive serving dish and garnish with freshly chopped parsley and tomatoes. Add your favorite grated cheese for a rich taste. Cranberry and Sweet Potato Chutney 1 teaspoon ghee ½ cup leeks or shallots, chopped 1 teaspoon black pepper 1 teaspoon Braggs Liquid Amino Acid or tamari sauce 2 cups sweet potato, diced into small pieces 1 cup cranberries, dried 1 can apple juice concentrate, or ganic, frozen ½ teaspoon cloves, whole 3 cinnamon sticks ½ teaspoon cardamom, dried 1 tablespoon balsamic vinegar 1 teaspoon apple cider vinegar ½ teaspoon coriander  In a sauté pan heat the ghee and add leeks. Sauté for 1 minute and then add pepper, Braggs, and the sweet potatoes. Sauté together for 3 to 4 minutes. Add the cranberries and apple juice. As the apple juice concentrate begins to melt, add th e cloves and the cinnamon sticks. Add the cardamom, balsamic vinegar, apple cider vinegar, and the coriander once the liquid is melted and a rolling simmer is achieved. Allow the mixture to simmer at a reduced heat for up to an h our. The liquid should reduce to create a smooth yet thick consistency. Serve warm or chilled. Or ganic Field Greens with Apple V inaigrette 1 lar ge Granny Smith apple, chopped 1 tablespoon lemon juice poured into ½ cup water ¼ cup almonds, roasted 3 cups or ganic field greens 1 cup spinach, washed ¼ cup feta cheese, crumbled ½ cup cherry tomatoes or yellow pear tomatoes 1 cup sunflower or alfalfa sprouts   Dressing 1 cup apple juice ¼ cup balsamic vinegar ¼ cup honey 1 teaspoon tarragon 1 teaspoon thyme 2 tablespoons parsley, chopped 2 tablespoons basil, chopped ¼ cup olive oil   Soak the chopped apples in the lemon water. Place the almonds on a baking sheet and roast in the oven for 20 minutes or briefly dry sauté them. Combine the dressing ingredients in a blen der minus the olive oil. Blend until smooth. Slowly add the olive oil and blend until the mixture begins to thicken. Place the greens, drained apples, feta cheese, and tomatoes in a salad bowl. T oss with the dressing. Arrange the salad on a plate and garnish with almonds and sunflower sprouts.Cocoa T ofu Mousse with Almond Praline 2 tablespoons ghee, unsalted butter, or canola oil (for a vegan dessert) 2 tablespoons apple juice 1 cup Semi Sweet Chocolate Chips (T ropical Source) 2 teaspoons vanilla extract 12 ounces silken tofu, low-fat, firm or extra firm ¼ cup maple syrup 2 teaspoons vanilla extract Coconut or fresh fruit for garnish   In a small saucepan, melt the ghee and ap ple juice with the chips and vanilla. Stir frequently to avoid burn ing. Use a double boiler if you like. When the chips are melted, remove fr om the heat and stir into a creamy consistency. Set aside. In a blender or food processor, combine tofu, syrup, and vanilla extract. Blend at high speed for one minute. Scrape the sides down and continue to blend into a smooth consistency. Add the melted chips to the blender or processor. Continu e to blend until smooth and well incorporated. Spoon the mousse into small dessert bowls or reserve in a container with a tight-fitting lid. Place in the refrigerator to chill. Almond Praline 1 tablespoon ghee 2 tablespoons maple syrup 1 cup almonds, sliced   Heat the ghee and ma ple syrup in a small sauté pan. Add the almonds. Stirring frequently, coat the almonds well and sau té until golden brow n. Remove from heat and cool of f. Garnish mousse with almond praline and coconut or fresh fruit. MIDDLE EASTERN CUISINESpinach and Lentil Soup Hummus Quinoa T abouli Cr eamy T ofu Cucumber and Mint Raita Ratatouille Stew Maple W alnut Filo T riangles   Spinach and Lentil Soup 1 teaspoon ghee ½ teaspoon red chili flakes 3 cloves garlic (optional) 1 teaspoon ginger 2 cups leeks or onions ½ teaspoon black pepper 1 teaspoon rosemary, fresh, chopped 1 tablespoon Braggs Liquid Amino Acid or tamari sauce ½ cup bulgur wheat 1 teaspoon cumin ½ teaspoon allspice 1 cup lentils, sorted and rinsed 5 cups vegetable stock 2 bay leaves 2 tablespoons tomato paste 4 cups fresh spinach, chopped   In a soup pot, heat the ghee and add the red chili flakes, garlic, ginger, and leeks. Add pepper, rosemary, and Braggs. Sauté for 2 to 3 minutes. Add the bulgur and sauté until gold en brown. Add the cumin and allspic e and continue to sauté. Add the rinsed lentils, the stock, and the bay leaves. Bring the soup to a b oil. Add tomato
[ 315, 84, 386, 46651, 449, 1708, 12669, 2394, 278, 483, 198, 52050, 9028, 4744, 4563, 72, 8363, 61434, 198, 16, 42384, 342, 50153, 198, 16, 10747, 514, 21854, 11, 38525, 198, 16, 62611, 44768, 1174, 7878, 11, 38525, 198, 16, 42384, 3776, 25349, 198, 27154, 42384, 2579, 59717, 82723, 198, 16, 62611, 3320, 351, 5981, 42358, 362, 32924, 50234, 477, 26555, 2850, 19737, 198, 18, 26446, 62517, 11, 19250, 291, 198, 42973, 10747, 21411, 6503, 1354, 11, 38525, 198, 17, 93200, 1867, 72, 8363, 1174, 32720, 198, 16, 42384, 272, 10318, 198, 16, 42384, 439, 2642, 295, 4849, 198, 19, 4235, 20, 26446, 36581, 5708, 198, 16, 42384, 30564, 23661, 198, 16, 10747, 3428, 64354, 34557, 14403, 198, 17, 56588, 62444, 87290, 477, 88621, 198, 52050, 644, 264, 19724, 3419, 11, 8798, 709, 220, 279, 342, 50153, 323, 923, 279, 514, 21854, 323, 279, 44768, 662, 2758, 279, 25349, 1174, 59717, 220, 82723, 11, 323, 220, 16, 198, 668, 300, 33076, 315, 3320, 351, 5981, 13, 2758, 279, 62517, 323, 279, 6503, 1354, 13, 328, 94943, 369, 220, 17, 311, 220, 18, 4520, 13, 2758, 279, 1867, 72, 8363, 13801, 66, 10318, 11, 439, 64, 16872, 4849, 323, 279, 2800, 315, 279, 3320, 351, 5981, 13, 15353, 311, 829, 332, 978, 220, 18, 311, 220, 20, 4520, 13, 328, 94943, 3156, 34504, 198, 65, 45184, 13, 1442, 279, 21655, 5334, 2288, 9235, 1174, 923, 264, 2697, 45993, 13, 2758, 36581, 5708, 311, 3504, 323, 4546, 311, 671, 74913, 13, 12797, 220, 279, 19724, 577, 308, 1678, 62517, 527, 8579, 13, 30688, 68, 19724, 449, 264, 3691, 18121, 477, 264, 19538, 294, 62895, 662, 2758, 198, 273, 1677, 323, 34557, 14403, 1120, 1603, 13788, 13, 65132, 819, 449, 50999, 38525, 62444, 87290, 477, 88621, 16853, 39972, 15386, 650, 70763, 481, 4821, 3258, 54463, 36726, 198, 3511, 3258, 198, 16, 42384, 342, 50153, 477, 33213, 5707, 198, 18, 11298, 7321, 514, 21854, 11, 38525, 198, 21, 4235, 23, 26446, 36581, 5708, 11, 1903, 94631, 555, 7999, 42393, 198, 438, 514, 21854, 198, 16, 42384, 3320, 351, 5981, 42358, 362, 32924, 50234, 477, 26555, 2850, 19737, 198, 16, 42384, 293, 1147, 4079, 47205, 198, 16, 62611, 68186, 11, 32720, 198, 16, 42384, 3776, 25349, 198, 17, 26446, 70723, 81817, 1174, 477, 25893, 292, 198, 52050, 644, 264, 32813, 220, 20716, 3876, 7363, 11, 8798, 342, 50153, 323, 923, 279, 514, 21854, 13, 328, 94943, 220, 16, 9568, 11, 923, 220, 17, 38190, 78, 49549, 36581, 198, 13787, 11, 3320, 351, 5981, 11, 47205, 1174, 68186, 11, 323, 25349, 662, 328, 3154, 978, 3156, 279, 514, 21854, 527, 2867, 662, 2758, 279, 81817, 662, 468, 78942, 264, 45555, 3980, 198, 2203, 9186, 11, 26251, 279, 81817, 220, 2212, 304, 279, 7363, 311, 14198, 13, 4418, 529, 259, 1095, 279, 81817, 636, 2288, 9235, 662, 2758, 220, 27154, 10747, 315, 198, 13787, 11, 422, 5995, 662, 16233, 8791, 978, 3156, 279, 81817, 9221, 21411, 14198, 477, 59811, 1534, 13, 3623, 32512, 6364, 311, 923, 220, 27154, 198, 37765, 315, 5708, 520, 264, 892, 994, 279, 21655, 9221, 9235, 662, 24119, 923, 3403, 5708, 311, 3504, 279, 81817, 439, 198, 275, 73527, 13, 13969, 264, 27431, 305, 323, 88, 311, 1005, 2391, 279, 17677, 1920, 13, 15353, 311, 1817, 459, 294, 23935, 279, 81817, 198, 30115, 2478, 4520, 311, 1304, 2771, 3403, 14812, 374, 304, 279, 3419, 311, 3504, 279, 81817, 662, 1115, 690, 1935, 709, 311, 220, 966, 198, 38137, 520, 264, 11295, 44790, 627, 39972, 15386, 650, 70763, 4893, 198, 17, 62517, 198, 17, 1167, 86670, 198, 16, 11298, 7321, 19151, 21494, 198, 16, 62611, 33213, 5707, 198, 16, 62611, 3320, 351, 5981, 42358, 362, 32924, 50234, 477, 26555, 2850, 19737, 198, 16, 62611, 293, 1147, 4079, 47205, 198, 16, 42384, 3776, 25349, 198, 16, 62611, 15155, 42393, 198, 4194, 13319, 279, 10548, 505, 279, 62517, 11, 1167, 86670, 11, 323, 19151, 21494, 13, 20223, 1855, 304, 4376, 13, 57576, 1855, 1139, 220, 42973, 25224, 198, 82, 38514, 13, 2638, 16038, 13, 47912, 279, 5707, 11, 3320, 351, 5981, 11, 47205, 1174, 25349, 1174, 323, 15155, 42393, 304, 264, 45555, 3980, 19763, 13, 1254, 3267, 198, 998, 3522, 449, 264, 9244, 41759, 13, 2758, 279, 24822, 323, 23724, 449, 279, 90215, 1037, 13, 11016, 505, 279, 19763, 198, 438, 11203, 704, 389, 264, 8314, 64, 379, 291, 11071, 7363, 13, 12093, 561, 220, 304, 279, 24276, 369, 220, 966, 4520, 520, 220, 8652, 12628, 13, 816, 6033, 649, 1101, 198, 87895, 1124, 389, 459, 4994, 40158, 13, 11016, 505, 24276, 323, 7155, 315, 282, 627, 51, 297, 1666, 16167, 198, 27154, 10747, 54662, 2579, 25349, 1174, 7878, 477, 505, 264, 30695, 198, 16, 10747, 4251, 27994, 11, 30205, 11, 477, 220, 16, 649, 11, 97139, 291, 198, 16, 62611, 7878, 16392, 1563, 1174, 38525, 198, 16, 62611, 7878, 29437, 11, 38525, 198, 17, 56588, 7878, 68186, 11, 99531, 48715, 198, 16, 10747, 41613, 11, 38525, 198, 42973, 10747, 88621, 1174, 38525, 198, 52050, 2170, 279, 81817, 16513, 1560, 311, 4394, 11, 323, 279, 326, 602, 447, 307, 91111, 11, 2567, 7999, 279, 5708, 3156, 279, 81817, 374, 198, 83, 1693, 311, 279, 12945, 13, 2893, 16994, 539, 311, 927, 87895, 13, 57576, 701, 54662, 24822, 1139, 220, 16, 25224, 23556, 7321, 198, 47568, 13, 2758, 279, 38525, 24822, 1139, 279, 3419, 449, 279, 30205, 81817, 662, 2758, 279, 54662, 2579, 58573, 198, 438, 279, 30205, 4251, 27994, 13, 2758, 50999, 38525, 16392, 1563, 1174, 29437, 11, 323, 68186, 311, 279, 3419, 13, 350, 31159, 682, 198, 39220, 13, 11004, 279, 10025, 36726, 1139, 459, 19411, 13788, 12269, 323, 61016, 819, 449, 50999, 38525, 88621, 198, 438, 41613, 13, 2758, 701, 7075, 97276, 17604, 369, 264, 9257, 12945, 627, 34, 6713, 15717, 323, 27687, 78703, 921, 332, 3520, 198, 16, 42384, 342, 50153, 198, 27154, 10747, 514, 21854, 477, 4985, 2469, 11, 38525, 198, 16, 42384, 3776, 25349, 198, 16, 42384, 3320, 351, 5981, 42358, 362, 32924, 50234, 477, 26555, 2850, 19737, 198, 17, 26446, 10437, 39834, 11, 89964, 1139, 2678, 9863, 198, 16, 10747, 70637, 36989, 11, 32720, 198, 16, 649, 24149, 23661, 37455, 11, 477, 25893, 292, 11, 20268, 198, 27154, 42384, 85388, 11, 4459, 198, 18, 51992, 34240, 198, 27154, 42384, 3786, 309, 316, 11, 32720, 198, 16, 62611, 293, 1147, 4079, 47205, 198, 16, 42384, 24149, 66155, 47205, 198, 27154, 42384, 1867, 72, 8363, 198, 4194, 644, 264, 829, 332, 978, 7363, 8798, 279, 342, 50153, 323, 923, 514, 21854, 13, 328, 94943, 369, 220, 16, 9568, 323, 1243, 923, 25349, 1174, 3320, 351, 5981, 11, 323, 279, 198, 95928, 35267, 13, 328, 94943, 3871, 369, 220, 18, 311, 220, 19, 4520, 13, 2758, 279, 70637, 36989, 323, 24149, 23661, 13, 1666, 279, 24149, 198, 8783, 560, 37455, 12302, 311, 30099, 11, 923, 270, 384, 85388, 323, 279, 51992, 34240, 13, 2758, 279, 3786, 309, 316, 345, 65, 1147, 4079, 47205, 1174, 24149, 66155, 47205, 1174, 323, 279, 1867, 72, 8363, 3131, 279, 14812, 374, 50459, 323, 264, 20700, 198, 15124, 1195, 374, 17427, 13, 27628, 279, 21655, 311, 62915, 520, 264, 11293, 8798, 369, 709, 311, 459, 305, 1057, 662, 578, 14812, 198, 5562, 8108, 311, 1893, 264, 11113, 3686, 12314, 29237, 662, 54032, 8369, 477, 85042, 627, 2244, 25893, 292, 8771, 42691, 449, 8325, 650, 304, 64, 343, 68028, 198, 16, 45555, 3980, 89240, 9259, 24149, 11, 38525, 198, 16, 62611, 30564, 23661, 44033, 1139, 220, 27154, 10747, 3090, 198, 42973, 10747, 88922, 11, 54662, 198, 18, 26446, 477, 25893, 292, 2115, 52011, 198, 16, 10747, 68798, 11, 38593, 198, 42973, 10747, 282, 1955, 17604, 11, 1589, 26902, 198, 27154, 10747, 41980, 41613, 477, 14071, 38790, 41613, 198, 16, 10747, 7160, 39853, 477, 85766, 85526, 8314, 11934, 198, 52050, 35, 57881, 198, 16, 10747, 24149, 23661, 198, 42973, 10747, 293, 1147, 4079, 47205, 198, 42973, 10747, 26828, 198, 16, 42384, 259, 1138, 6241, 198, 16, 42384, 270, 31218, 198, 17, 56588, 88621, 1174, 38525, 198, 17, 56588, 68186, 11, 38525, 198, 42973, 10747, 33213, 5707, 198, 52050, 4516, 587, 279, 38525, 41776, 304, 279, 30564, 3090, 16853, 17826, 279, 88922, 389, 264, 28915, 11071, 323, 58785, 304, 279, 24276, 369, 220, 508, 4520, 477, 27851, 9235, 829, 332, 978, 1124, 627, 82214, 279, 32623, 14293, 304, 264, 1529, 268, 2761, 28382, 279, 33213, 5707, 13, 55248, 3156, 11113, 662, 39247, 398, 923, 198, 1820, 33213, 5707, 323, 20955, 3156, 279, 21655, 12302, 311, 270, 9890, 627, 17826, 279, 52011, 11, 61508, 41776, 11, 282, 1955, 17604, 11, 323, 41613, 304, 264, 33566, 19763, 13, 350, 31159, 449, 279, 32623, 627, 80335, 279, 33566, 389, 264, 12235, 323, 61016, 819, 449, 88922, 323, 7160, 39853, 8314, 11934, 732, 34402, 350, 315, 84, 386, 46651, 449, 1708, 12669, 2394, 278, 483, 198, 17, 56588, 342, 50153, 11, 7120, 62334, 14432, 1174, 477, 649, 8083, 5707, 320, 2000, 264, 30249, 198, 34107, 531, 340, 17, 56588, 24149, 23661, 198, 16, 10747, 55738, 27687, 39520, 87768, 320, 51, 49495, 950, 8922, 340, 17, 93200, 33165, 8819, 198, 717, 49138, 5554, 2779, 80247, 11, 3428, 64354, 11, 7626, 477, 5066, 7626, 198, 42973, 10747, 55480, 45322, 198, 17, 93200, 33165, 8819, 198, 7489, 27357, 477, 7878, 14098, 369, 61016, 819, 198, 52050, 644, 264, 2678, 19737, 857, 11, 30099, 279, 342, 50153, 323, 1469, 7245, 23661, 449, 279, 24512, 323, 33165, 13, 65292, 14134, 311, 198, 48956, 8395, 6892, 13, 5560, 264, 2033, 28725, 422, 499, 1093, 13, 3277, 279, 24512, 527, 50459, 11, 4148, 1448, 8019, 279, 8798, 323, 198, 267, 404, 1139, 264, 47985, 29237, 662, 2638, 16038, 627, 644, 264, 62895, 477, 3691, 18121, 1174, 16343, 80247, 11, 45322, 11, 323, 33165, 8819, 13, 55248, 520, 1579, 4732, 369, 198, 606, 9568, 13, 2522, 20432, 279, 11314, 1523, 323, 3136, 311, 20955, 1139, 264, 11113, 29237, 662, 2758, 279, 50459, 198, 331, 3153, 311, 279, 62895, 477, 18121, 662, 20915, 84, 384, 311, 20955, 3156, 11113, 323, 1664, 32762, 13, 94613, 279, 198, 76, 46651, 1139, 2678, 43849, 61080, 477, 21137, 304, 264, 5593, 449, 264, 10508, 2269, 15154, 27431, 13, 11004, 304, 279, 198, 1116, 65044, 859, 311, 37401, 627, 2149, 12669, 2394, 278, 483, 198, 16, 62611, 342, 50153, 198, 17, 56588, 55480, 45322, 198, 16, 10747, 88922, 11, 48715, 198, 52050, 62406, 279, 342, 50153, 323, 7643, 7245, 45322, 304, 264, 2678, 829, 332, 978, 7363, 13, 2758, 279, 88922, 13, 65292, 12928, 14134, 1174, 23724, 279, 198, 278, 55720, 1664, 323, 33254, 47289, 3156, 21411, 60375, 308, 13, 11016, 505, 8798, 323, 7155, 315, 282, 13, 65132, 819, 296, 46651, 449, 198, 278, 12669, 550, 278, 483, 323, 34557, 477, 7878, 14098, 627, 44, 49275, 78725, 13974, 356, 29621, 34708, 13576, 613, 323, 84470, 321, 61434, 198, 39, 27054, 355, 198, 2232, 80094, 350, 671, 283, 747, 720, 16384, 384, 27322, 350, 315, 84, 356, 42012, 323, 42410, 432, 1339, 64, 198, 49, 93584, 283, 4618, 800, 365, 720, 2276, 273, 468, 453, 24217, 16807, 78, 350, 25160, 17694, 198, 52050, 42838, 613, 323, 84470, 321, 61434, 198, 16, 42384, 342, 50153, 198, 27154, 42384, 2579, 59717, 82723, 198, 18, 85388, 31735, 320, 13099, 340, 16, 42384, 44768, 198, 17, 26446, 514, 21854, 477, 45697, 198, 27154, 42384, 3776, 25349, 198, 16, 42384, 16392, 1563, 1174, 7878, 11, 38525, 198, 16, 62611, 3320, 351, 5981, 42358, 362, 32924, 50234, 477, 26555, 2850, 19737, 198, 27154, 10747, 7173, 70, 324, 34153, 198, 16, 42384, 272, 10318, 198, 27154, 42384, 682, 2203, 560, 198, 16, 10747, 48907, 8839, 11, 10839, 323, 97139, 291, 198, 20, 26446, 36581, 5708, 198, 17, 23542, 11141, 198, 17, 56588, 42120, 25982, 198, 19, 26446, 7878, 68798, 11, 38525, 198, 52050, 644, 264, 19724, 3419, 11, 8798, 279, 342, 50153, 323, 923, 279, 2579, 59717, 82723, 11, 31735, 11, 44768, 1174, 323, 514, 21854, 13, 2758, 25349, 13801, 25888, 1563, 1174, 323, 3320, 351, 5981, 13, 328, 94943, 369, 220, 17, 311, 220, 18, 4520, 13, 2758, 279, 7173, 70, 324, 323, 829, 332, 978, 3156, 6761, 665, 14198, 13, 2758, 198, 1820, 272, 10318, 323, 682, 2203, 292, 384, 323, 3136, 311, 829, 332, 978, 13, 2758, 279, 97139, 291, 48907, 8839, 11, 279, 5708, 11, 323, 220, 279, 23542, 11141, 627, 65627, 279, 19724, 311, 264, 293, 5707, 13, 2758, 42120 ]
0xBreath/holistic-books
are cola drinks containing caffeine and sugar stimulants, cigarettes full of toxic substances, and eventually alcohol and street drugs, giving a brief ‘high’ and leading to addiction. The same vicious circle affects adults, too. Since the conventional American diet is devoid of live nutrients, the body remains unsatisfied and craves more—not quantity but quality, proper nutrition that it needs to function smoothly and well. Sadly, people don’t know or understand this, and so they try to satisfy their craving with rich desserts, ice cream, cakes and cookies. These don’t satisfy, either, but they do create weight gain, high cholesterol, high blood pressure, and eventually diabetes and worse. Obesity is a morbid condition indeed, and can only be overcome by changing to a junk-free, nutrient-rich wholesome diet. One doesn’t need a degree in nutrition to know that all kinds of sugar are fattening, and that the modern Western diet with its vast range of convenience foods is over-rich in sugar. However, when it comes to official policy concerning nutrition, such basic facts are often swept aside for Copyright © Charlotte Gerson, 2007. All rights reserved. This material may not be reproduced in any medium, print or electronic without prior written permission from the author.Page 7 3Healing the Gerson Way—Defeating Cancer and Other Chronic Diseases www.thegersonway.comcommercial reasons, which frequently clash with the interests of public health. One such recent clash concerned the upper safe limit of sugar added to food, as recommended by the WHO (World Health Organization). Professor Colin Campbell reported on this event in his book, The China Study, and with his permission we quote his account: “The recommendation on added sugar is as outrageous as the one for protein. When this FNB (Food and Nutrition Board) report was being released, an expert panel put together by the WHO (World Health Organization) and the FAO (Food and Agriculture Organization) was completing a new report on diet, nutrition and the prevention of chronic diseases. Professor Philip James was a member of this panel and a panel spokesperson on the added sugar recommendation. Early rumors of the report’s findings indicated that the WHO/FAO was on the verge of recommending an upper safe limit of 10% for added sugar, far lower than the 25% established by the American FNB group. “Politics, however, had early entered the discussion, as it had done in earlier reports on added sugars. According to a news release from the director-general’s office at the WHO, the US-based Sugar Association and the World Sugar Research Organization, who ‘represent the interests of the sugar growers and refiners, had mounted a strong lobbying campaign in an attempt to discredit the WHO report and suppress its release.’ According to The Guardian newspaper of London, the US sugar industry was threatening to ‘bring the WHO to its knees’ unless it abandoned these guidelines on added sugar. WHO people were describing the threat as ‘tantamount to blackmail.’ The US-based group even publicly threatened to lobby the US Congress to reduce the $406 million US funding of the WHO if it persisted in keeping the upper limit so low at 10%. There were reports that the Bush administration was inclined to side with the sugar industry. “So, for added sugars, we now have two different upper ‘safe’ limits: a 10% limit for the international community and a 25% limit for the US,” is Professor Campbell’s wry conclusion. Clearly, despite official claims, the obesity epidemic hitting the American people is not solely the result of insufficient exercise!” Osteoporosis Also known as ‘brittle bones,’ this progressive loss of bone mass is unfortunately becoming very common. It causes fractures or breaks at the slightest impact, such as a fall or other accident. Fractures are immensely painful and heal slowly—or, in old people, not at all. A serious break, necessitating weeks of bed rest, can lead to infected bedsores and other, potentially fatal complications. More women than men suffer from osteoporosis, so it is assumed to be caused by ageing, post- menopausal loss of the female sex hormone estrogen, lack of exercise, and smoking. However, we have seen a 28-year-old man suffering from this condition! The conventional medical treatment prescribes female hormones, calcium, Vitamin D, and regular exercise. The best that these can Copyright © Charlotte Gerson, 2007. All rights reserved. This material may not be reproduced in any medium, print or electronic without prior written permission from the author.Page 7 4Healing the Gerson Way—Defeating Cancer and Other Chronic Diseases www.thegersonway.comachieve is to slow down the disease process, not reverse it. Moreover, female sex hormones can cause cancer of the breast, the ovaries or the uterus; the body is unable to utilize the calcium and the synthetic Vitamin D; this treatment does not restore bone mass. In the course of worldwide research it was found that women in SE Asia, who regularly bear six to eight children and nurse them all, do not suffer from osteoporosis. In fact it is virtually unknown in those parts. Referring to this fact, the Physicians’ Committee for Responsible Medicine (PCRM) reports: “The average calcium intake in Singapore is 389 mg/day, less than half of the recommended daily allowance in the U.S. Yet the fracture rate in Singapore is five times lower than that of the U.S., where the calcium intake is much higher.” Further on the report comments: “Dietary and lifestyle factors that encourage the loss of calcium include: Animal protein, sodium, caffeine, phosphorus, tobacco and sedentary lifestyle.” In one study it was found that “Eliminating meat from the diet cuts the urinary calcium losses in half.” Also, “Cutting sodium intake by half can reduce calcium requirements by 160 milligrams per day. Avoiding tobacco has demonstrable effects: smokers have 10% weaker bones than non-smokers.” Despite clear scientific proof that calcium is not the answer to osteoporosis, in January of 1997 a new advertising campaign promoting milk consumption was launched, sponsored by the National Fluid Milk Processor Promotion Board. Among other things the publicity claimed, “With calcium galore, milk is one of the best things around.” The ads featured female or male celebrities sporting the new ‘celebrity milk moustache,’ The PCRM lodged a complaint with the Federal Trade Commission in Washington, D.C., pointing out that “increasing milk consumption is one of the weakest possible strategies for protecting the bones, and to suggest otherwise is dangerously misleading.” The PCRM also stated that since calcium was needed in the diet, the kind provided by green vegetables appeared to be of greater bio-availability (was better assimilated) than the calcium found in milk To underline their claim, they added: “Excessive calcium intake does not fool hormones into building much more bone, any more than delivery of an extra load of bricks will make a construction crew build a larger building.” As the evidence accumulates, it becomes increasingly clear that osteoporosis, like so many chronic degenerative complaints, is largely the result of wrong eating habits. Further confirmation comes from best-selling author John Robbins, considered to be a world-class expert on the dietary link with the environment and health. He writes, “One long-term study found that with as little as 75 grams of daily protein (less than three quarters of what the average meat-eating American consumes), more calcium is lost in the urine than is absorbed by the body, establishing from the diet a negative calcium balance.” 5 Every study came up with the same result: The more protein was taken in, the more calcium was lost. Dr. John McDougall, one of the nation’s leading medical authorities on dietary association with disease, adds: “I would like to emphasize that the calcium- losing effect of protein on the human body is not an area of controversy in scientific circles. Copyright © Charlotte Gerson, 2007. All rights reserved. This material may not be reproduced in any medium, print or electronic without prior written permission from the author.Page 7 5Healing the Gerson Way—Defeating Cancer and Other Chronic Diseases www.thegersonway.comThe many studies performed during the past 55 years consistently show that the most important dietary change that we can make if we want to create a positive calcium balance that will keep our bones solid, is to decrease the amount of protein we eat each day.” 6 All the above serves as yet another proof that the Gerson Therapy not only maintains the calcium balance of the body, but that it is also able to reverse osteoporosis by restricting animal protein, salt and smoking, while flooding the body with calcium from vegetable sources, along with the proper enzymes to lodge this calcium in the bones. In fact, in numerous patients bone mass has been increased and the discomfort or pain of osteoporosis has been cleared. Case History: After stumbling and falling on an uneven pavement, long-term recovered Gerson patient A.C. was sent for an X-ray by her doctor, to check whether her hip had been fractured. The hip turned out to be unharmed, but osteoporosis was discovered in three places in the spine. The woman doctor, who gave the patient the bad news, offered her a supply of painkillers, which she refused on the grounds of feeling no pain. Instead, she got in touch with Charlotte Gerson
[ 527, 84767, 21662, 8649, 720, 88860, 483, 323, 13465, 12936, 360, 1821, 11, 34576, 2539, 315, 21503, 33155, 11, 323, 9778, 13200, 323, 8761, 720, 3696, 13602, 11, 7231, 264, 10015, 3451, 12156, 529, 323, 6522, 311, 27471, 13, 720, 791, 1890, 43510, 12960, 22223, 12884, 11, 2288, 13, 8876, 279, 21349, 3778, 10173, 374, 76939, 720, 1073, 3974, 37493, 11, 279, 2547, 8625, 7120, 47365, 323, 1589, 4798, 810, 63938, 12472, 719, 4367, 11, 6300, 720, 83664, 430, 433, 3966, 311, 734, 39511, 323, 1664, 13, 57243, 11, 1274, 1541, 1431, 1440, 477, 3619, 420, 11, 720, 438, 779, 814, 1456, 311, 27651, 872, 64804, 449, 9257, 72513, 11, 10054, 12932, 11, 48669, 323, 8443, 13, 4314, 720, 15357, 1431, 27651, 11, 3060, 11, 719, 814, 656, 1893, 4785, 8895, 11, 1579, 39086, 11, 1579, 6680, 7410, 11, 323, 720, 3163, 1870, 20335, 323, 11201, 13, 95171, 374, 264, 4411, 21301, 3044, 13118, 11, 323, 649, 1193, 387, 23075, 720, 1729, 10223, 311, 264, 30774, 12862, 11, 50123, 41947, 88318, 10173, 627, 4054, 3250, 1431, 1205, 264, 8547, 304, 26677, 311, 1440, 430, 682, 13124, 315, 13465, 527, 87309, 6147, 11, 323, 430, 720, 1820, 6617, 11104, 10173, 449, 1202, 13057, 2134, 315, 19679, 15657, 374, 927, 41947, 304, 13465, 13, 4452, 11, 720, 9493, 433, 4131, 311, 4033, 4947, 18815, 26677, 11, 1778, 6913, 13363, 527, 3629, 41323, 16038, 369, 720, 13857, 7388, 29473, 480, 1293, 11, 220, 1049, 22, 13, 220, 2052, 3268, 4694, 627, 2028, 3769, 1253, 539, 387, 55717, 304, 904, 11298, 11, 1194, 477, 14683, 2085, 4972, 5439, 8041, 505, 279, 3229, 662, 2732, 220, 22, 220, 18, 1548, 6260, 279, 480, 1293, 12424, 2345, 2685, 91955, 26211, 323, 7089, 73782, 70674, 198, 2185, 13991, 797, 1293, 3195, 916, 84707, 8125, 11, 902, 14134, 41003, 449, 279, 12034, 315, 586, 2890, 13, 3861, 1778, 3293, 720, 566, 1003, 11920, 279, 8582, 6220, 4017, 315, 13465, 3779, 311, 3691, 11, 439, 11349, 555, 279, 40312, 320, 10343, 720, 14884, 21021, 570, 17054, 40979, 30524, 5068, 389, 420, 1567, 304, 813, 2363, 11, 578, 5734, 720, 49812, 11, 220, 323, 449, 813, 8041, 584, 12929, 813, 2759, 512, 14305, 28782, 389, 3779, 13465, 374, 439, 55588, 439, 279, 832, 369, 13128, 13, 3277, 420, 435, 34442, 720, 7988, 1411, 323, 39700, 8925, 8, 1934, 574, 1694, 6004, 11, 459, 6335, 7090, 2231, 3871, 555, 279, 40312, 720, 65499, 6401, 21021, 8, 323, 279, 15358, 46, 320, 27844, 323, 37963, 21021, 8, 574, 27666, 720, 64, 502, 1934, 389, 10173, 11, 26677, 323, 279, 27344, 315, 21249, 19338, 13, 17054, 26241, 7957, 720, 16514, 264, 4562, 315, 420, 7090, 323, 264, 7090, 29003, 389, 279, 3779, 13465, 28782, 13, 23591, 720, 10952, 1105, 315, 279, 1934, 753, 14955, 16717, 430, 279, 40312, 14, 3711, 46, 574, 389, 279, 59818, 315, 65774, 720, 276, 8582, 6220, 4017, 315, 220, 605, 4, 369, 3779, 13465, 11, 3117, 4827, 1109, 279, 220, 914, 4, 9749, 555, 279, 3778, 720, 37, 34442, 1912, 627, 2118, 97036, 11, 4869, 11, 1047, 4216, 10862, 279, 10430, 11, 439, 433, 1047, 2884, 304, 6931, 6821, 389, 3779, 720, 82, 773, 1590, 13, 10771, 311, 264, 3754, 4984, 505, 279, 7690, 69097, 753, 5274, 520, 279, 40312, 11, 279, 2326, 6108, 720, 84514, 10229, 323, 279, 4435, 32019, 8483, 21021, 11, 889, 3451, 36369, 279, 12034, 315, 279, 720, 82, 8734, 70077, 323, 2098, 40799, 11, 1047, 22563, 264, 3831, 47338, 4901, 304, 459, 4879, 311, 88119, 720, 1820, 40312, 1934, 323, 28321, 1202, 4984, 14639, 10771, 311, 578, 25460, 17222, 315, 7295, 11, 720, 1820, 2326, 13465, 5064, 574, 27903, 311, 3451, 82477, 279, 40312, 311, 1202, 31624, 529, 7389, 433, 23838, 1521, 720, 24343, 11243, 389, 3779, 13465, 13, 40312, 1274, 1051, 23524, 279, 6023, 439, 3451, 61512, 6173, 311, 88263, 14639, 720, 791, 2326, 6108, 1912, 1524, 17880, 21699, 311, 19865, 279, 2326, 8151, 311, 8108, 279, 400, 17264, 720, 59413, 2326, 11006, 315, 279, 40312, 422, 433, 54095, 304, 10494, 279, 8582, 4017, 779, 3428, 520, 220, 605, 14697, 2684, 720, 52898, 6821, 430, 279, 14409, 8735, 574, 43131, 311, 3185, 449, 279, 13465, 5064, 16853, 70214, 11, 369, 3779, 70913, 11, 584, 1457, 617, 1403, 2204, 8582, 3451, 19193, 529, 13693, 25, 264, 220, 605, 4, 4017, 369, 279, 720, 98697, 4029, 323, 264, 220, 914, 4, 4017, 369, 279, 2326, 2476, 374, 17054, 30524, 753, 289, 894, 17102, 13, 720, 75471, 11, 8994, 4033, 8349, 11, 279, 33048, 42620, 20129, 279, 3778, 1274, 374, 539, 21742, 279, 720, 1407, 315, 39413, 10368, 18319, 198, 46, 5455, 89766, 10934, 198, 13699, 3967, 439, 3451, 32414, 11489, 25896, 23189, 420, 23053, 4814, 315, 17685, 3148, 374, 26907, 10671, 720, 1225, 4279, 13, 1102, 11384, 78332, 477, 18808, 520, 279, 60147, 5536, 11, 1778, 439, 264, 4498, 477, 1023, 720, 4575, 1748, 13, 2939, 533, 1439, 527, 63689, 26175, 323, 27661, 14297, 51749, 11, 304, 2362, 1274, 11, 539, 520, 682, 13, 362, 6129, 720, 9137, 11, 4541, 50644, 5672, 315, 4950, 2800, 11, 649, 3063, 311, 29374, 4950, 708, 417, 323, 1023, 11, 13893, 19094, 720, 5807, 10939, 13, 720, 7816, 3278, 1109, 3026, 7831, 505, 52368, 89766, 10934, 11, 779, 433, 374, 19655, 311, 387, 9057, 555, 80043, 11, 1772, 7058, 5794, 454, 80174, 4814, 315, 279, 8954, 1877, 36908, 70180, 11, 6996, 315, 10368, 11, 323, 20149, 13, 4452, 11, 584, 720, 19553, 3970, 264, 220, 1591, 4771, 6418, 893, 16066, 505, 420, 3044, 0, 220, 578, 21349, 6593, 6514, 720, 24544, 56236, 8954, 44315, 11, 35719, 11, 45774, 423, 11, 323, 5912, 10368, 13, 578, 1888, 430, 1521, 649, 720, 13857, 7388, 29473, 480, 1293, 11, 220, 1049, 22, 13, 220, 2052, 3268, 4694, 627, 2028, 3769, 1253, 539, 387, 55717, 304, 904, 11298, 11, 1194, 477, 14683, 2085, 4972, 5439, 8041, 505, 279, 3229, 662, 2732, 220, 22, 220, 19, 1548, 6260, 279, 480, 1293, 12424, 2345, 2685, 91955, 26211, 323, 7089, 73782, 70674, 198, 2185, 13991, 797, 1293, 3195, 916, 613, 19704, 374, 311, 6435, 1523, 279, 8624, 1920, 11, 539, 10134, 433, 13, 23674, 11, 8954, 1877, 44315, 649, 720, 1593, 9572, 315, 279, 17659, 11, 279, 66168, 552, 477, 279, 85656, 26, 279, 2547, 374, 12153, 311, 29166, 279, 35719, 323, 720, 1820, 28367, 45774, 423, 26, 420, 6514, 1587, 539, 15301, 17685, 3148, 13, 720, 644, 279, 3388, 315, 15603, 3495, 433, 574, 1766, 430, 3278, 304, 5161, 13936, 11, 889, 15870, 11984, 720, 51464, 311, 8223, 2911, 323, 29198, 1124, 682, 11, 656, 539, 7831, 505, 52368, 89766, 10934, 13, 763, 2144, 433, 374, 21907, 720, 16476, 304, 1884, 5596, 13, 8718, 14782, 311, 420, 2144, 11, 279, 88599, 529, 10554, 369, 68728, 720, 13613, 55103, 320, 4977, 24575, 8, 6821, 25, 1054, 791, 5578, 35719, 23730, 304, 21181, 374, 220, 20422, 14060, 45839, 11, 2753, 1109, 720, 38106, 315, 279, 11349, 7446, 41458, 304, 279, 549, 815, 13, 14968, 279, 59904, 4478, 304, 21181, 374, 4330, 720, 15487, 4827, 1109, 430, 315, 279, 549, 815, 2637, 1405, 279, 35719, 23730, 374, 1790, 5190, 2029, 15903, 389, 279, 1934, 720, 15069, 25, 1054, 35, 3978, 661, 323, 19433, 9547, 430, 15253, 279, 4814, 315, 35719, 2997, 25, 21995, 720, 79565, 11, 39695, 11, 49750, 11, 33088, 30969, 11, 27531, 323, 11163, 306, 661, 19433, 2029, 763, 832, 4007, 433, 574, 1766, 720, 9210, 1054, 42113, 16252, 13339, 505, 279, 10173, 15455, 279, 72735, 35719, 18151, 304, 4376, 2029, 7429, 11, 1054, 38766, 1303, 720, 82, 47876, 23730, 555, 4376, 649, 8108, 35719, 8670, 555, 220, 6330, 2606, 84209, 824, 1938, 13, 35106, 287, 720, 83, 677, 20067, 706, 7912, 481, 6372, 25, 57757, 617, 220, 605, 4, 43383, 25896, 1109, 2536, 4773, 41781, 49216, 20397, 2867, 12624, 11311, 430, 35719, 374, 539, 279, 4320, 311, 52368, 89766, 10934, 11, 304, 6186, 315, 720, 2550, 22, 264, 502, 13172, 4901, 22923, 14403, 15652, 574, 11887, 11, 30638, 555, 720, 1820, 5165, 60696, 44925, 44477, 57204, 8925, 13, 22395, 1023, 2574, 279, 43763, 11922, 11, 720, 2118, 2409, 35719, 15730, 461, 11, 14403, 374, 832, 315, 279, 1888, 2574, 2212, 2029, 578, 14058, 15109, 8954, 477, 8762, 720, 70865, 35795, 36027, 279, 502, 3451, 70865, 1347, 488, 14403, 296, 26169, 1815, 23189, 578, 6812, 24575, 74732, 264, 12458, 449, 279, 720, 57853, 17657, 9849, 304, 6652, 11, 423, 732, 2637, 22364, 704, 430, 1054, 43842, 4522, 14403, 15652, 720, 285, 832, 315, 279, 81863, 3284, 15174, 369, 22973, 279, 25896, 11, 323, 311, 4284, 6062, 374, 720, 32550, 7162, 38309, 49216, 791, 6812, 24575, 1101, 11224, 430, 2533, 35719, 574, 4460, 304, 279, 10173, 11, 279, 3169, 3984, 555, 6307, 720, 83571, 4893, 9922, 311, 387, 315, 7191, 17332, 12, 54162, 320, 16514, 2731, 40054, 93583, 8, 1109, 279, 35719, 720, 15456, 304, 14403, 2057, 52974, 872, 3802, 11, 814, 3779, 25, 1054, 849, 87728, 35719, 23730, 1587, 539, 24931, 720, 71, 494, 3233, 1139, 4857, 1790, 810, 17685, 11, 904, 810, 1109, 9889, 315, 459, 5066, 2865, 315, 50137, 690, 720, 7072, 264, 8246, 13941, 1977, 264, 8294, 4857, 49216, 2170, 279, 6029, 15783, 24031, 11, 433, 9221, 15098, 2867, 430, 52368, 89766, 10934, 11, 1093, 779, 1690, 720, 7562, 292, 5367, 75989, 21859, 11, 374, 14090, 279, 1121, 315, 5076, 12459, 26870, 13, 15903, 20109, 720, 6716, 505, 1888, 48724, 3229, 3842, 88315, 11, 6646, 311, 387, 264, 1917, 15144, 6335, 389, 279, 34625, 720, 2125, 449, 279, 4676, 323, 2890, 13, 1283, 14238, 11, 1054, 4054, 1317, 9860, 4007, 1766, 430, 449, 439, 2697, 720, 300, 220, 2075, 34419, 315, 7446, 13128, 320, 1752, 1109, 2380, 32573, 315, 1148, 279, 5578, 13339, 5773, 1113, 3778, 720, 67776, 288, 705, 810, 35719, 374, 5675, 304, 279, 40335, 1109, 374, 42101, 555, 279, 2547, 11, 31692, 505, 279, 720, 94942, 264, 8389, 35719, 8335, 2029, 220, 20, 7357, 4007, 3782, 709, 449, 279, 1890, 1121, 25, 578, 810, 13128, 720, 16514, 4529, 304, 11, 279, 810, 35719, 574, 5675, 13, 2999, 13, 3842, 51353, 49404, 543, 11, 832, 315, 279, 7140, 753, 6522, 6593, 720, 3170, 1385, 389, 34625, 15360, 449, 8624, 11, 11621, 25, 1054, 40, 1053, 1093, 311, 47032, 430, 279, 35719, 7058, 18310, 2515, 315, 13128, 389, 279, 3823, 2547, 374, 539, 459, 3158, 315, 26654, 304, 12624, 26432, 13, 720, 13857, 7388, 29473, 480, 1293, 11, 220, 1049, 22, 13, 220, 2052, 3268, 4694, 627, 2028, 3769, 1253, 539, 387, 55717, 304, 904, 11298, 11, 1194, 477, 14683, 2085, 4972, 5439, 8041, 505, 279, 3229, 662, 2732, 220, 22, 220, 20, 1548, 6260, 279, 480, 1293, 12424, 2345, 2685, 91955, 26211, 323, 7089, 73782, 70674, 198, 2185, 13991, 797, 1293, 3195, 916, 791, 1690, 7978, 10887, 2391, 279, 3347, 220, 2131, 1667, 21356, 1501, 430, 279, 1455, 3062, 720, 94942, 661, 2349, 430, 584, 649, 1304, 422, 584, 1390, 311, 1893, 264, 6928, 35719, 8335, 430, 690, 2567, 1057, 720, 82091, 6573, 11, 374, 311, 18979, 279, 3392, 315, 13128, 584, 8343, 1855, 1938, 662, 863, 220, 21, 720, 2460, 279, 3485, 17482, 439, 3686, 2500, 11311, 430, 279, 480, 1293, 40143, 539, 1193, 33095, 279, 720, 27684, 2411, 8335, 315, 279, 2547, 11, 719, 430, 433, 374, 1101, 3025, 311, 10134, 52368, 89766, 10934, 555, 65951, 10065, 720, 79565, 11, 12290, 323, 20149, 11, 1418, 39262, 279, 2547, 449, 35719, 505, 36581, 8336, 11, 3235, 720, 4291, 279, 6300, 56067, 311, 60891, 420, 35719, 304, 279, 25896, 13, 763, 2144, 11, 304, 12387, 6978, 17685, 720, 27428, 706, 1027, 7319, 323, 279, 44776, 477, 6784, 315, 52368, 89766, 10934, 706, 1027, 23803, 627, 4301, 11346, 25, 220, 4740, 88455, 323, 16054, 389, 459, 61437, 65442, 11, 1317, 9860, 26403, 720, 38, 1293, 8893, 362, 732, 13, 220, 574, 3288, 369, 459, 1630, 30630, 555, 1077, 10896, 11, 311, 1817, 3508, 1077, 18638, 1047, 1027, 720, 1658, 533, 3149, 13, 578, 18638, 6656, 704, 311, 387, 653, 13279, 2106, 11, 719, 52368, 89766, 10934, 574, 11352, 304, 2380, 7634, 720, 258, 279, 35776, 13, 578, 5333, 10896, 11, 889, 6688, 279, 8893, 279, 3958, 3754, 11, 9076, 1077, 264, 8312, 315, 720, 92724, 11088, 388, 11, 902, 1364, 16436, 389, 279, 21319, 315, 8430, 912, 6784, 13, 12361, 11, 1364, 2751, 304, 5916, 449, 720, 96995, 480, 1293 ]
0xBreath/holistic-books
ball up in the air and there is a lone fielder in that region. The fielder looks up at the ball, forms the intention of catching it, and then the pro - cess of logical thinking stops. With his mind he cannot factor in the force with which the ball was hit, the trajectory of the moving object, the force and direction of the wind that day, his own running speed and so on. All those fac - tors get into the act and he finds himself at the right spot at the right time to receive the fall - ing ball. Of course, he has to be a fielder who is passionate about his game; of course, he needs to be in shape and practised at his craft. But he could not have used his logic and mind to work out a solution. There are so many variables at work here; the force with which the ball is struck, the angle at which it rises up, the force of any wind that day. The speed at which the fielder takes off, the distance he has to judge and so on. If any of these variables changes during the effort, the fielder’s body has to adjust and accommodate those changes. Most of this occurs automatically without any conscious control on his part. In fact his attempt to consciously correct the changes would impede the process. So there is a built-in corrective mechanism which works like a servo mechanism in physics. Needless to say, it may not work perfectly on every occasion. This may be due to various fac - tors including the fact that conscious efforts to control the outcome on the part of the fielder december 9             lead ~ story may hamper the process. I believe that there are some things we can do to help or hamper this process. Any top athlete will tell you that after a certain stage has been achieved by physical training and practice, it is always the mental process that gives him an edge. But here is the catch: it is not necessarily more mental effort; in fact less effort may work better. It is about under - standing the quality of the mental energy that is required. Remember Nissar’s experience with his wife’s ID card? It is not about the intensity of the inten - tion effort; it is about affirming a sim - ple, direct intention and then stepping back, letting go, staying detached from the outcome, and letting the creative principle take over. Some cricket coaches and players have told me that this method has helped them take their game to a different level. Santhkumar had an intention at the beginning of a five-day retreat he attended along with his wife. “I am experiencing deeper connection with my wife”. At the end of the retreat, his wife went out shop - ping and returned with a stack of the books he was most longing to read, although he had not mentioned their names to her. For him, there couldn’t have been a more significant proof of the new connection between them. Reframe your goals Many individuals have difficulty in dis - tinguishing the affirming of an inten - tion from the statement of their goals. This requires some introspection and prac - tice. In the beginning it may be helpful to turn to a mentor or counsellor for sugges - tions. I like to think of this part as refram - ing. For example, instead of stating the goal Dr Chopra is the author of more than 50 books translated into over 35 languages, is a fellow of the American College of Physicians and a senior scien - tist with The Gallup Organisation. An excerpt from a talk on the healing quest. People think, “Oh, intention is just a thought. Actually, intention is like a force in nature. Just like electro magnetism is a force in nature. So too, intention is a force in nature. “In biology, we have a term called Teleology. It is a term that went out of fashion a while ago but it is coming back. The principle of teleology tells us that if you want to know about the mechanism of a biological phenomenon in evolution, for example, then you have to know what the intended outcome is. “If you want to know how birds had wings, then you have to say, what was the intention? Of course, the intention was to fly. “Amphibians became birds, and classical Darwinian Theory says, “Oh, that was random adaptation to environmental forces and you know, the amphibians developed feathers and they were able to fly….” “If you just develop feathers, you are actually a weaker species because the other animals will come and eat you up. You have to simultaneously develop feathers, a new born structure, a new muscular skeletal system, a new metabolism and that requires a simultaneous, inner dependent co-arising of many things that is orchestrated by intention. “So, intention is a force in nature that at the deepest levels of na - ture causes the simultaneous co-arising of inter-dependent events. It is quantum creativity that an intention creates. “If you want to heal yourself, then first of all, you have to have clarity of what your intended outcome is. “Your intended outcome can’t be in negative terms, “I don’t want to have heart disease, I don’t want to have cancer…”. “The intended outcome is, “I want to be physically and mentally active, to have increased physical and mental capacity, I want to have time to have fun with my children and my family, I want to be able to run up the stairs…” “When you have clarity of that intention in consciousness, then you must feel it, you must smell it and you must be it. “And then you introduce that intention into consciousness, and when in meditation, you go to a field of silence and intention or - chestrates its own fulfilment and becomes a very powerful force.” attention- intentiondecember 9             lead ~ story as “I want to be a millionaire by the end of December 2012”, one can reframe this as: “I experience abundance in my life” or “The abundant universe is available to me now”. This does a few dramatic things. It allows me to function in the Now. It opens up unlimited possibilities instead of setting limits. It helps me to acknowledge the abun - dance I already have; it helps me to focus on action in the present instead of hopes and plans for the “future”. Let me turn to the example of Maya, a young lady presently employed as a school - teacher, who deeply desires “to become a the power of intention Psychologist Wayne Dyer, Ph.D., author of over 30 self-empower - ment books, describes a new ap - proach to fulfilment in his latest book, The Power of Intention: Learning to Co-create Your World Your Way Dyer has a different take on the Law of Attraction. He calls it the Power of Intention. “Most people’s mistake in try - ing to apply the law of attraction is they want things; they demand things. But God doesn’t work that way,” continues Dyer. “It’s all about allowing.” Dyer refers to the Tao Te Ching, written by Lao Tzu. “He says in there, 2,500 years ago, if you live from these virtues, then all that you could ever need or want could be provided for you.” Dyer excitedly retrieves his personal copy of the book, leans forward and reads the words that touch him so deeply. He explains how virtue is a very im - portant concept in the Law of Attraction. “This is called the Hua Hu Ching, written by Lao Tzu. It’s the unknown teachings of Lao Tzu. Number 51 says, ‘Those who want to know the truth of the universe should practice the four cardinal virtues. The first is reverence for all of life. These manifest as unconditional love and respect for oneself and all other beings. The second is natural sincerity. This manifests as honesty, simplicity and faithfulness. The third is gentleness, which manifests as kindness, consideration for others and sensitivity to spir - itual truth. The fourth is supportiveness. This manifests as service to others without expectation of reward.”“All great spiritual masters are teaching what we’re talking about,” says Dyer. “They’re teach - ing fogiveness. They’re teaching kindness They’re teaching love. They’re not teaching wanting. They’re not teaching greed.” So the notion of seeking what you want, or think you need, is not what the Power of Intention is all about. “The ego’s mantra is ‘What’s in it for me? How can I get more? I want a BMW in my drive - way next Thursday,’” he explains. “All of that is what most spiritual teachers call the false self
[ 5041, 720, 455, 304, 279, 3805, 323, 1070, 374, 264, 47766, 2115, 261, 304, 430, 720, 4030, 13, 578, 2115, 261, 5992, 709, 520, 279, 5041, 11, 7739, 720, 1820, 14944, 315, 34168, 433, 11, 323, 1243, 279, 463, 18722, 1140, 315, 20406, 7422, 18417, 13, 3161, 813, 4059, 568, 720, 34360, 8331, 304, 279, 5457, 449, 902, 279, 5041, 720, 16514, 4295, 11, 279, 35782, 315, 279, 7366, 1665, 11, 279, 720, 9009, 323, 5216, 315, 279, 10160, 430, 1938, 11, 813, 720, 785, 4401, 4732, 323, 779, 389, 13, 2052, 1884, 3547, 18722, 98266, 636, 1139, 279, 1180, 323, 568, 14035, 5678, 520, 279, 2355, 1315, 7858, 520, 279, 1314, 892, 311, 5371, 279, 4498, 18722, 287, 5041, 13, 5046, 3388, 11, 568, 706, 311, 387, 264, 2115, 261, 889, 720, 285, 25429, 922, 813, 1847, 26, 315, 3388, 11, 568, 2355, 56345, 311, 387, 304, 6211, 323, 3856, 4147, 520, 813, 11003, 13, 720, 4071, 568, 1436, 539, 617, 1511, 813, 12496, 323, 4059, 720, 998, 990, 704, 264, 6425, 627, 3947, 527, 779, 1690, 7482, 520, 990, 1618, 26, 279, 720, 9009, 449, 902, 279, 5041, 374, 17948, 11, 279, 9392, 720, 266, 902, 433, 38268, 709, 11, 279, 5457, 315, 904, 10160, 430, 720, 1316, 13, 578, 4732, 520, 902, 279, 2115, 261, 5097, 1022, 11, 720, 1820, 6138, 568, 706, 311, 11913, 323, 779, 389, 13, 1442, 904, 720, 1073, 1521, 7482, 4442, 2391, 279, 5149, 11, 279, 720, 2630, 261, 753, 2547, 706, 311, 7652, 323, 29376, 720, 54719, 4442, 13, 7648, 315, 420, 13980, 9651, 720, 30096, 904, 17371, 2585, 389, 813, 961, 13, 763, 2144, 720, 26301, 4879, 311, 70903, 4495, 279, 4442, 720, 41450, 3242, 15686, 279, 1920, 13, 2100, 1070, 374, 264, 5918, 3502, 720, 20523, 535, 17383, 902, 4375, 1093, 264, 59412, 720, 2727, 5776, 2191, 304, 22027, 627, 24581, 1752, 311, 2019, 11, 433, 1253, 539, 990, 14268, 389, 720, 30115, 13402, 13, 1115, 1253, 387, 4245, 311, 5370, 3547, 18722, 98266, 2737, 279, 2144, 430, 17371, 9045, 311, 720, 2935, 279, 15632, 389, 279, 961, 315, 279, 2115, 261, 720, 8332, 1402, 33595, 250, 110, 110937, 108, 110937, 108, 24, 33595, 251, 105, 33595, 251, 102, 33595, 251, 99, 33595, 251, 98, 220, 33595, 251, 108, 33595, 251, 107, 33595, 251, 111, 33595, 251, 102, 33595, 251, 112, 33595, 251, 102, 33595, 251, 114, 33595, 251, 98, 256, 33595, 250, 111, 110937, 108, 27152, 220, 4056, 3446, 198, 18864, 13824, 716, 279, 1920, 13, 358, 4510, 430, 720, 19041, 527, 1063, 2574, 584, 649, 656, 311, 1520, 477, 720, 5721, 716, 420, 1920, 13, 5884, 1948, 34880, 690, 720, 73457, 499, 430, 1306, 264, 3738, 6566, 706, 1027, 720, 613, 32077, 555, 7106, 4967, 323, 6725, 11, 720, 275, 374, 2744, 279, 10723, 1920, 430, 6835, 720, 40617, 459, 6964, 13, 2030, 1618, 374, 279, 2339, 25, 433, 374, 539, 720, 77, 74753, 810, 10723, 5149, 26, 304, 2144, 2753, 720, 6581, 371, 1253, 990, 2731, 13, 1102, 374, 922, 1234, 18722, 10276, 279, 4367, 315, 279, 10723, 4907, 720, 9210, 374, 2631, 627, 29690, 452, 1056, 277, 753, 3217, 449, 813, 720, 48841, 753, 3110, 3786, 5380, 2181, 374, 539, 922, 279, 21261, 315, 279, 528, 268, 18722, 28491, 5149, 26, 433, 374, 922, 33449, 287, 264, 1675, 18722, 698, 11, 2167, 14944, 323, 1243, 36567, 2355, 1445, 11, 20806, 733, 11, 19994, 45017, 505, 2355, 1820, 15632, 11, 323, 20806, 279, 11782, 2355, 652, 16379, 1935, 927, 13, 720, 8538, 37099, 24909, 323, 4311, 617, 720, 83, 820, 757, 430, 420, 1749, 706, 9087, 1124, 720, 23609, 872, 1847, 311, 264, 2204, 2237, 627, 24661, 339, 74, 31967, 1047, 459, 14944, 520, 279, 720, 7413, 1251, 315, 264, 4330, 11477, 31114, 568, 18677, 720, 39393, 449, 813, 7555, 13, 1054, 40, 1097, 25051, 720, 451, 10653, 3717, 449, 856, 7555, 11453, 2468, 279, 720, 408, 315, 279, 31114, 11, 813, 7555, 4024, 704, 8221, 18722, 10194, 323, 6052, 449, 264, 5729, 315, 279, 6603, 720, 383, 574, 1455, 79422, 311, 1373, 11, 8051, 568, 720, 32345, 539, 9932, 872, 5144, 311, 1077, 13, 720, 2520, 1461, 11, 1070, 7846, 1431, 617, 1027, 264, 810, 720, 91645, 11311, 315, 279, 502, 3717, 720, 42967, 1124, 627, 697, 6906, 701, 9021, 198, 8607, 7931, 617, 17250, 304, 834, 18722, 1303, 84, 11218, 279, 33449, 287, 315, 459, 528, 268, 18722, 28491, 505, 279, 5224, 315, 872, 9021, 13, 2355, 2028, 7612, 1063, 26609, 16463, 323, 61986, 18722, 83, 560, 13, 763, 279, 7314, 433, 1253, 387, 11190, 311, 720, 413, 311, 264, 36528, 477, 2346, 35935, 269, 369, 274, 2661, 288, 18722, 83, 919, 13, 358, 1093, 311, 1781, 315, 420, 961, 439, 19914, 309, 18722, 287, 13, 1789, 3187, 11, 4619, 315, 28898, 279, 5915, 2999, 65097, 969, 374, 279, 3229, 315, 810, 1109, 220, 1135, 6603, 720, 54342, 1139, 927, 220, 1758, 15823, 11, 374, 264, 12637, 315, 279, 720, 29518, 9304, 315, 88599, 323, 264, 10195, 1156, 3675, 18722, 83, 380, 449, 578, 80901, 47843, 13, 1556, 50565, 505, 720, 64, 3137, 389, 279, 21730, 2271, 627, 16298, 1781, 11, 1054, 12174, 11, 14944, 374, 1120, 264, 3463, 13, 720, 53692, 11, 14944, 374, 1093, 264, 5457, 304, 7138, 13, 4702, 720, 4908, 25396, 33297, 2191, 374, 264, 5457, 304, 7138, 13, 2100, 2288, 11, 14944, 374, 2355, 64, 5457, 304, 7138, 13, 720, 46233, 34458, 11, 584, 617, 264, 4751, 2663, 13875, 2508, 13, 1102, 374, 264, 4751, 430, 720, 42700, 704, 315, 11401, 264, 1418, 4227, 719, 433, 374, 5108, 1203, 13, 578, 17966, 720, 1073, 8122, 2508, 10975, 603, 430, 422, 499, 1390, 311, 1440, 922, 279, 17383, 720, 1073, 264, 24156, 25885, 304, 15740, 11, 369, 3187, 11, 1243, 499, 720, 19553, 311, 1440, 1148, 279, 10825, 15632, 374, 13, 720, 38684, 499, 1390, 311, 1440, 1268, 20229, 1047, 27296, 11, 1243, 499, 617, 311, 2019, 11, 720, 12840, 574, 279, 14944, 30, 5046, 3388, 11, 279, 14944, 574, 311, 11722, 13, 720, 2118, 6219, 764, 581, 5493, 6244, 20229, 11, 323, 29924, 45480, 1122, 31535, 2355, 98036, 11, 1054, 12174, 11, 430, 574, 4288, 34185, 311, 12434, 8603, 720, 438, 499, 1440, 11, 279, 89022, 5493, 8040, 56994, 323, 814, 1051, 720, 481, 311, 11722, 1981, 2029, 720, 38684, 499, 1120, 2274, 56994, 11, 499, 527, 3604, 264, 43383, 9606, 720, 28753, 279, 1023, 10099, 690, 2586, 323, 8343, 499, 709, 13, 1472, 617, 720, 998, 25291, 2274, 56994, 11, 264, 502, 9405, 6070, 11, 264, 502, 720, 38827, 22077, 69397, 1887, 11, 264, 502, 39097, 323, 430, 7612, 264, 720, 15124, 495, 18133, 11, 9358, 18222, 1080, 58493, 3876, 315, 1690, 2574, 430, 374, 720, 22312, 15462, 660, 555, 14944, 13, 720, 70214, 11, 14944, 374, 264, 5457, 304, 7138, 430, 520, 279, 51621, 5990, 315, 4415, 18722, 5081, 11384, 279, 58632, 1080, 58493, 3876, 315, 958, 43918, 4455, 13, 720, 2181, 374, 31228, 28697, 430, 459, 14944, 11705, 13, 720, 38684, 499, 1390, 311, 27661, 6261, 11, 1243, 1176, 315, 682, 11, 499, 617, 311, 617, 720, 566, 10981, 315, 1148, 701, 10825, 15632, 374, 13, 720, 2118, 7927, 10825, 15632, 649, 1431, 387, 304, 8389, 3878, 11, 1054, 40, 1541, 1431, 720, 53757, 311, 617, 4851, 8624, 11, 358, 1541, 1431, 1390, 311, 617, 9572, 1981, 11453, 720, 14305, 10825, 15632, 374, 11, 1054, 40, 1390, 311, 387, 22655, 323, 34325, 720, 3104, 11, 311, 617, 7319, 7106, 323, 10723, 8824, 11, 358, 1390, 311, 720, 19553, 892, 311, 617, 2523, 449, 856, 2911, 323, 856, 3070, 11, 358, 1390, 311, 387, 720, 481, 311, 1629, 709, 279, 32249, 51279, 720, 51928, 499, 617, 32373, 315, 430, 14944, 304, 25917, 11, 1243, 720, 9514, 2011, 2733, 433, 11, 499, 2011, 22843, 433, 323, 499, 2011, 387, 433, 13, 720, 68932, 1243, 499, 19678, 430, 14944, 1139, 25917, 11, 2355, 438, 994, 304, 33862, 11, 499, 733, 311, 264, 2115, 315, 21847, 323, 14944, 477, 18722, 331, 15462, 988, 1202, 1866, 64201, 479, 323, 9221, 264, 1633, 8147, 5457, 49216, 54203, 12, 14944, 8332, 1402, 33595, 250, 110, 110937, 108, 110937, 108, 24, 33595, 251, 105, 33595, 251, 102, 33595, 251, 99, 33595, 251, 98, 220, 33595, 251, 108, 33595, 251, 107, 33595, 251, 111, 33595, 251, 102, 33595, 251, 112, 33595, 251, 102, 33595, 251, 114, 33595, 251, 98, 256, 33595, 250, 111, 110937, 109, 27152, 220, 4056, 3446, 198, 300, 1054, 40, 1390, 311, 387, 264, 90044, 555, 279, 842, 720, 1073, 6790, 220, 679, 17, 9520, 832, 649, 312, 6906, 420, 720, 300, 25, 1054, 40, 3217, 37492, 304, 856, 2324, 863, 477, 720, 14305, 44611, 15861, 374, 2561, 311, 757, 720, 3409, 11453, 1115, 1587, 264, 2478, 22520, 2574, 13, 1102, 720, 56967, 757, 311, 734, 304, 279, 4800, 13, 1102, 16264, 720, 455, 27862, 24525, 4619, 315, 6376, 13693, 13, 1102, 8779, 757, 311, 25670, 279, 671, 359, 18722, 99975, 358, 2736, 617, 26, 433, 8779, 757, 311, 5357, 389, 720, 1335, 304, 279, 3118, 4619, 315, 16388, 323, 720, 79624, 369, 279, 1054, 21733, 113068, 10267, 757, 2543, 311, 279, 3187, 315, 51444, 11, 264, 720, 82279, 17240, 50801, 20011, 439, 264, 2978, 18722, 24247, 11, 889, 17693, 32097, 1054, 998, 3719, 264, 720, 1820, 2410, 315, 14944, 198, 69803, 16549, 28640, 423, 27253, 11, 2405, 920, 2637, 720, 3170, 315, 927, 220, 966, 659, 12, 3342, 1223, 18722, 479, 6603, 11, 16964, 264, 502, 1469, 18722, 782, 613, 311, 64201, 479, 304, 813, 5652, 720, 2239, 11, 578, 7572, 315, 1357, 3012, 25, 720, 48567, 311, 3623, 40779, 4718, 4435, 720, 7927, 12424, 198, 35, 27253, 706, 264, 2204, 1935, 389, 279, 720, 39166, 315, 2468, 27523, 13, 1283, 6880, 433, 720, 1820, 7572, 315, 1357, 3012, 13, 2355, 2118, 13622, 1274, 753, 16930, 304, 1456, 18722, 287, 311, 3881, 279, 2383, 315, 33464, 720, 285, 814, 1390, 2574, 26, 814, 7631, 720, 58174, 13, 2030, 4359, 3250, 1431, 990, 430, 720, 3195, 2476, 9731, 423, 27253, 13, 1054, 2181, 753, 682, 922, 10923, 49216, 35, 27253, 19813, 311, 279, 60608, 2722, 921, 287, 1174, 5439, 555, 445, 3524, 350, 26738, 13, 720, 40565, 2795, 304, 1070, 11, 220, 17, 11, 2636, 1667, 4227, 11, 422, 499, 3974, 505, 1521, 720, 48481, 1157, 11, 1243, 682, 430, 499, 1436, 3596, 1205, 477, 1390, 1436, 720, 1395, 3984, 369, 499, 2029, 423, 27253, 12304, 398, 71771, 813, 4443, 720, 8728, 315, 279, 2363, 11, 93936, 4741, 323, 16181, 279, 4339, 430, 720, 22794, 1461, 779, 17693, 13, 1283, 15100, 1268, 35460, 374, 264, 1633, 737, 18722, 403, 519, 7434, 304, 279, 7658, 315, 2468, 27523, 627, 31378, 374, 2663, 279, 473, 4381, 22546, 921, 287, 1174, 5439, 555, 445, 3524, 350, 26738, 13, 720, 2181, 753, 279, 9987, 45572, 315, 445, 3524, 350, 26738, 13, 5742, 220, 3971, 2795, 11, 720, 14336, 23025, 889, 1390, 311, 1440, 279, 8206, 315, 279, 15861, 1288, 720, 60621, 279, 3116, 56980, 66627, 13, 578, 1176, 374, 98464, 720, 2000, 682, 315, 2324, 13, 4314, 14794, 439, 84663, 3021, 323, 720, 45734, 369, 57669, 323, 682, 1023, 23837, 13, 578, 2132, 374, 720, 53980, 100226, 13, 1115, 84332, 439, 48948, 11, 40075, 323, 720, 75710, 31514, 13, 578, 4948, 374, 16265, 77319, 11, 902, 84332, 439, 720, 15674, 2136, 11, 18361, 369, 3885, 323, 27541, 311, 18823, 18722, 275, 940, 8206, 13, 578, 11999, 374, 1862, 13071, 13, 1115, 84332, 439, 720, 8095, 311, 3885, 2085, 31293, 315, 11565, 2029, 2118, 2460, 2294, 18330, 36467, 720, 548, 12917, 1148, 584, 3207, 7556, 720, 9274, 2476, 2795, 423, 27253, 13, 1054, 7009, 3207, 4639, 18722, 287, 31349, 13071, 13, 2435, 3207, 12917, 720, 15674, 2136, 2435, 3207, 12917, 3021, 13, 720, 7009, 3207, 539, 12917, 19762, 13, 720, 7009, 3207, 539, 12917, 56926, 49216, 4516, 279, 23035, 315, 11125, 1148, 720, 9514, 1390, 11, 477, 1781, 499, 1205, 11, 374, 720, 1962, 1148, 279, 7572, 315, 1357, 3012, 720, 285, 682, 922, 13, 1054, 791, 37374, 753, 68009, 374, 720, 14336, 3923, 753, 304, 433, 369, 757, 30, 2650, 649, 358, 636, 720, 6518, 30, 358, 1390, 264, 30864, 304, 856, 6678, 18722, 3195, 1828, 7950, 92264, 568, 15100, 13, 720, 99083, 315, 430, 374, 1148, 1455, 18330, 13639, 1650, 279, 905, 720, 726 ]
0xBreath/holistic-books
his face clearly. “I feel alone,” she said. “Often feelings aren’t trustworthy,” Ramana pointed out. Suddenly there was rustling in the bushes by the side of the path. Savitri jumped back. “What was that?” she exclaimed, feeling the return of her anxiety. “Ghosts.” Ramana had stopped short. “It’s time you met them, for having traveled beyond this life, ghosts and spirits have much to teach.” He stood still and beckoned her to keep quiet. Savitri froze in place, and a chill passed over her skin. After a moment someone emerged from the dimness of the forest—a little girl no more than two years old, toddling toward them but not looking their way. “Don’t!” Ramana warned, anticipating that Savitri would want to run and hold the baby. The baby looked around blankly, then it crossed the path and disappeared into the woods again. “Did you recognize her?” Ramana asked. “No, how could I? Is she lost?” Savitri felt confused and disturbed by what she’d witnessed. Instead of answering her directly, Ramana said, “There are more. You’re attracting them.” At that moment a second ghost appeared, this time a girl of four. Savitri was dumbfounded. “Do you know that one?” he asked. “It’s me!” At that, the ghost peered her way for a moment before wandering away. “And the baby was also me?” Ramana nodded. “Every former self you have left behind is a ghost. Your body is no longer the body of a child. Your thoughts, desires, fears, and hopes have changed. It would be terrible to walk around with all your dead selves holding on. Let them go.”Savitri could say nothing. One by one apparitions of herself appeared. She witnessed the girl of ten who sat by her mother’s side in the kitchen, the girl of twelve blushing to talk to a boy, the ardent young woman obsessed with Satyavan, her first love. The last ghost was the most startling, because it was like a mirror image, exactly her age and wearing the same shawl that Savitri had thrown on when she fled her hut. “You see, even the self you had today is a ghost,” said Ramana. When this last apparition had faded back into the forest, Savitri said, “What do they have to teach me?” “That death has been with you every moment of your life,” Ramana replied. “You have survived thousands of deaths every day as your old thoughts, your old cells, your old emotions, and even your old identity passed away. Everyone is living in the afterlife right now. What is there to fear or doubt?” “But they seemed so real,” Savitri said. “Yes, as real as dreams,” said Ramana. “But you are in the here and now, not in the past.” Savitri had never seen herself in this way, and the sight gave her new courage. “I am still determined to defeat death, for I want Satyavan in my arms again. But if Yama is victorious, I won’t cling to ghosts. At least I have won that much wisdom.” THE FIELD OF DREAMS When people wonder if the personality survives death, the answer is that the personality doesn’t even survive while we are alive. We are not the same person we were five, ten, or fifteen years ago and it would be a sorry state if we were. Our personalities are constantly evolving, transforming, growing. If the question becomes, Does the individual survive death?, the answer is, What’s an individual? In reality what we call “me” is different from day to day, week to week, year to year. Which individual are you talking about, the young person who was in love and full of romance and desire, or the child who was full of innocence and wonder? Perhaps we must wait for the one who is senescent and dying. Which one would you survive as? Perhaps none. Vedanta tells us that the afterlife brings the opportunity for a creative leap. As our choices continue to expand, we will experience a new reality that is far richer than the conventional notion of heaven. Heaven is an end point, whereby definitions, all transformation, stops. Souls lounge around in a blessed state that sounds, frankly, like eternal assisted living. Why should consciousness become inert? In the afterlife survival would be meaninglessunless we continued to respond. The biggest difference is that in the afterlife the input of the five senses no longer stimulates us. The furniture of the mind has been cleared away, leaving a space that is both inside and outside ourselves. This is why Jesus wasn’t being paradoxical when he sometimes talked about heaven “within you” and heaven “with the Father.” When you empty a room of furniture, the space left behind is empty, but the Vedic rishis say that mental space is different. It is full of possibilities. Anything can be born there. They called this pregnant space Akasha . The closest equivalent in English would be “dream space,” or at least that’s a good place to begin. A dream is like a blank screen on which anything can be projected: any event, place, or person. Akasha is the same. When Vedanta says that every world is a projection of the mind, it is describing an Akashic dream. “Worlds come and go like specks of dust in a beam of sunlight,” declares a famous Vedic saying. In Akasha we realize the transience of all things and the immensity of the unknown. The Akashic dream is cosmic, unlike the personal dreams we have at night. NDEs tell us that the stage of “crossing over”—the temporary realm preceding the full experience of the afterlife—still feels personal. People report seeing their deceased friends and relations, for example. The dying person continues to see the room in which his body lies, and memories and associations keep tying him back to physical existence. The possibility of taking a creative leap has yet to be realized. As long as you continue to feel like the person you were, you can’t experience the unknown. Let me give you an example. On a speaking engagement a few years ago I met Gerald, a man who told me that he had become fascinated by the healing powers of shamans in the Southwest. What
[ 9793, 285, 1186, 580, 41508, 398, 627, 10378, 1186, 96551, 197, 32676, 2476, 1942, 383, 1942, 3864, 627, 2118, 78013, 1186, 96551, 826, 197, 9329, 1431, 26665, 592, 43629, 2476, 11391, 309, 3444, 59574, 291, 14294, 627, 98331, 197, 19041, 6831, 300, 7145, 592, 2785, 17886, 33188, 2282, 1136, 288, 197, 1729, 33188, 94864, 44323, 33188, 27879, 13, 7721, 44210, 462, 198, 44396, 291, 78546, 13, 197, 44130, 6831, 300, 64442, 12671, 1942, 383, 8285, 21974, 11, 1186, 68, 20659, 33188, 862, 44323, 197, 1964, 198, 276, 16708, 627, 2118, 38, 45792, 2029, 11391, 309, 3444, 9793, 329, 18895, 18033, 49081, 13, 197, 17818, 753, 22724, 197, 9514, 2157, 295, 197, 49818, 11, 2066, 9793, 2370, 198, 376, 29285, 2282, 23478, 2090, 8986, 1643, 11, 197, 39754, 82, 53577, 1942, 5682, 1220, 9793, 525, 2157, 1412, 32809, 197, 668, 613, 49216, 1548, 18895, 1411, 18895, 484, 53577, 197, 55177, 20262, 197, 1964, 32809, 197, 13397, 197, 44750, 13, 7721, 44210, 462, 1186, 299, 3059, 17886, 197, 2050, 11, 53577, 11575, 198, 331, 484, 42531, 291, 197, 2017, 197, 1964, 1942, 8148, 13, 197, 6153, 11575, 2157, 13209, 1942, 638, 606, 67304, 52625, 43827, 33188, 198, 13223, 2136, 44323, 33188, 1186, 42519, 29096, 8986, 2433, 3253, 2881, 73204, 2157, 461, 197, 54895, 3324, 1146, 197, 42820, 62928, 11, 3324, 14898, 2785, 198, 83, 83071, 197, 49818, 2282, 332, 98366, 197, 20986, 33188, 404, 197, 3195, 627, 2118, 8161, 1431, 18319, 11391, 309, 3444, 6831, 1923, 291, 11, 197, 8322, 575, 1113, 64442, 7721, 44210, 462, 6831, 619, 51880, 32809, 57842, 53577, 198, 6416, 33188, 2282, 6243, 627, 791, 2282, 6243, 197, 7349, 291, 197, 20019, 197, 10399, 398, 11, 59733, 24263, 1470, 2177, 291, 33188, 27879, 53577, 35697, 99567, 198, 18614, 33188, 197, 82129, 197, 33871, 627, 2118, 7131, 197, 9514, 197, 34551, 553, 197, 1964, 12671, 11391, 309, 3444, 197, 1091, 291, 627, 61559, 11, 197, 5269, 1470, 619, 25494, 30, 197, 3957, 1942, 383, 197, 55437, 12671, 7721, 44210, 462, 1186, 3903, 68950, 2656, 53577, 75582, 75325, 197, 1729, 198, 12840, 1942, 383, 7070, 6831, 8251, 291, 13, 197, 31887, 44323, 44679, 86, 4776, 197, 1964, 2765, 1248, 398, 11, 11391, 309, 3444, 1942, 3864, 11, 197, 35816, 198, 548, 2157, 461, 13, 197, 2675, 3207, 36547, 2193, 287, 197, 49818, 2029, 197, 1688, 64442, 2157, 13209, 11575, 197, 5686, 197, 39754, 197, 99567, 345, 576, 22724, 11575, 3253, 2881, 44323, 1186, 414, 13, 7721, 44210, 462, 6831, 300, 2765, 3635, 69, 13382, 13, 197, 2118, 5519, 197, 9514, 16868, 3409, 64442, 197, 606, 12671, 198, 383, 197, 1091, 291, 627, 17818, 753, 50394, 18319, 198, 1688, 64442, 11, 33188, 197, 39754, 197, 375, 12616, 197, 1964, 197, 3195, 2066, 11575, 2157, 13209, 64334, 6831, 61380, 197, 14075, 627, 68932, 33188, 2282, 6243, 6831, 300, 197, 19171, 50394, 12671, 198, 64948, 3444, 9215, 347, 9988, 13, 197, 2118, 11769, 197, 35627, 5311, 197, 9514, 9793, 525, 36357, 197, 30998, 485, 20501, 11575, 197, 39754, 13, 197, 7927, 198, 2664, 20501, 73204, 17972, 261, 33188, 36502, 44323, 11575, 59491, 13, 197, 7927, 197, 61665, 82, 11, 54012, 3946, 11, 1186, 7596, 11, 53577, 9793, 19031, 198, 19553, 197, 17805, 13, 62635, 6831, 619, 74242, 197, 466, 12560, 32809, 6831, 1727, 197, 20019, 48048, 52060, 14862, 414, 197, 34854, 1942, 4372, 198, 43591, 25653, 13, 197, 10267, 197, 49818, 31780, 2029, 50, 44210, 462, 1470, 619, 1942, 352, 197, 42312, 13, 197, 4054, 197, 1729, 197, 606, 29336, 277, 6055, 44323, 9793, 388, 491, 197, 99567, 13, 7721, 383, 198, 86, 8251, 291, 33188, 3253, 2881, 44323, 197, 2002, 197, 14965, 1942, 266, 197, 1729, 197, 1964, 2157, 1605, 753, 94864, 17886, 33188, 16868, 7606, 11, 33188, 3253, 2881, 198, 1073, 3324, 86, 21903, 97521, 41913, 32809, 3324, 1727, 32809, 11575, 197, 17627, 11, 33188, 197, 569, 306, 197, 82279, 6831, 7053, 197, 5598, 22456, 48048, 198, 35982, 88, 32005, 11, 197, 1964, 43290, 197, 31153, 13, 33026, 34196, 197, 39754, 6831, 300, 33188, 2157, 537, 22087, 2785, 11, 2282, 6769, 24263, 6831, 300, 198, 4908, 11575, 2157, 29912, 32526, 11, 8285, 33839, 197, 1964, 197, 425, 53577, 6831, 13992, 33188, 1942, 373, 37296, 88548, 64442, 7721, 44210, 462, 198, 32345, 71579, 4935, 25653, 61280, 1942, 383, 1186, 839, 197, 1964, 9793, 332, 627, 33672, 197, 4151, 11, 7883, 1055, 33188, 5311, 197, 9514, 9793, 329, 3324, 6423, 20501, 11575, 197, 39754, 2476, 1942, 3864, 11391, 309, 3444, 627, 4599, 2090, 34196, 29336, 277, 684, 9793, 329, 1186, 14589, 78546, 2129, 78, 33188, 1186, 42519, 11, 7721, 44210, 462, 1942, 3864, 345, 44130, 20530, 197, 20670, 9793, 525, 32809, 197, 668, 613, 50394, 12671, 198, 49977, 59451, 589, 64355, 74242, 268, 48048, 197, 9514, 7883, 1225, 2157, 13209, 44323, 14862, 414, 8986, 1643, 2476, 11391, 309, 3444, 198, 265, 3523, 13, 197, 33672, 9793, 525, 1942, 97860, 2270, 71579, 40137, 44323, 59451, 27382, 7883, 1225, 99297, 61551, 14862, 414, 62928, 198, 61665, 82, 11, 14862, 414, 62928, 1470, 6572, 11, 14862, 414, 62928, 67304, 41356, 11, 53577, 7883, 1055, 14862, 414, 62928, 197, 17341, 42531, 291, 198, 14075, 13, 197, 34124, 20501, 8986, 2299, 17886, 33188, 197, 10924, 14789, 49021, 82022, 13, 197, 3923, 20501, 197, 19041, 32809, 1186, 686, 82266, 198, 67, 5599, 83, 12671, 198, 61603, 197, 20670, 85786, 16809, 197, 708, 92974, 2476, 7721, 44210, 462, 1942, 3864, 627, 86508, 11, 61551, 92974, 61551, 2765, 1259, 82, 2476, 1942, 3864, 11391, 309, 3444, 13, 197, 61603, 197, 9514, 197, 548, 17886, 33188, 197, 6881, 53577, 82022, 345, 1962, 17886, 33188, 3303, 561, 49216, 50, 44210, 462, 9793, 329, 197, 37593, 197, 29412, 9793, 388, 491, 17886, 2090, 197, 3195, 11, 53577, 33188, 1942, 492, 3253, 525, 197, 1964, 8808, 198, 66, 61140, 13, 197, 10378, 197, 309, 18895, 484, 2765, 47737, 32809, 7604, 33166, 59451, 589, 11, 2066, 25494, 51880, 7721, 51071, 32005, 17886, 13938, 198, 16293, 197, 33871, 13, 197, 4071, 748, 66422, 3105, 20501, 5306, 858, 22766, 11, 25494, 6831, 263, 1431, 40507, 287, 32809, 197, 39754, 82, 13, 197, 1688, 197, 56371, 25494, 9793, 525, 198, 55767, 64442, 2157, 1412, 6831, 285, 5717, 49216, 17673, 13017, 10580, 197, 12766, 11198, 16294, 50, 198, 4599, 197, 16455, 6831, 14518, 748, 33188, 99905, 2786, 1942, 97860, 1924, 59451, 589, 11, 33188, 73670, 20501, 64442, 33188, 198, 9164, 2786, 2765, 7217, 77, 1431, 7883, 1055, 1942, 97860, 535, 5329, 197, 906, 197, 548, 197, 52061, 13, 197, 1687, 197, 548, 98366, 33188, 1942, 373, 198, 9164, 197, 906, 6831, 486, 1186, 535, 11, 197, 2002, 11, 82266, 1186, 333, 15247, 197, 42820, 197, 6438, 53577, 24263, 6831, 619, 74242, 11575, 1942, 8635, 25277, 748, 198, 906, 6831, 486, 13, 197, 8140, 99905, 278, 1385, 197, 548, 4882, 18007, 75937, 20222, 11, 51324, 287, 11, 3253, 25156, 13, 52792, 198, 1820, 197, 7998, 2282, 762, 20969, 11, 197, 22186, 33188, 197, 55977, 1942, 97860, 535, 59451, 589, 12909, 33188, 73670, 20501, 345, 3923, 753, 80557, 197, 55977, 30, 71267, 17643, 2786, 197, 12840, 197, 906, 68388, 197, 2118, 2727, 863, 20501, 2765, 18780, 43827, 99297, 32809, 198, 1316, 11, 197, 10476, 32809, 197, 10476, 11, 197, 3236, 32809, 197, 3236, 13, 197, 23956, 197, 55977, 197, 548, 197, 9514, 3324, 30855, 197, 9274, 11, 33188, 198, 82279, 99905, 197, 14965, 6831, 300, 17886, 197, 31153, 53577, 95142, 44323, 197, 442, 685, 53577, 54012, 556, 11, 82266, 33188, 59491, 198, 14965, 6831, 300, 95142, 44323, 197, 6258, 511, 768, 53577, 6831, 14518, 30, 197, 32576, 197, 906, 2157, 592, 49850, 2066, 33188, 197, 606, 198, 14965, 20501, 1942, 22383, 1189, 53577, 2765, 7169, 13, 197, 23956, 197, 606, 6831, 619, 197, 9514, 1942, 97860, 535, 61551, 5380, 32576, 197, 6836, 13, 17904, 291, 8424, 3324, 6572, 71275, 64442, 33188, 197, 10924, 14789, 81355, 826, 33188, 40803, 68164, 2066, 198, 64, 197, 52817, 197, 273, 391, 13, 197, 2170, 197, 414, 197, 25825, 11926, 32809, 197, 33417, 11, 197, 906, 6831, 484, 8285, 13267, 11575, 8808, 198, 265, 2786, 64442, 20501, 1186, 277, 7145, 29164, 197, 54895, 33188, 38303, 44322, 98366, 290, 44323, 197, 383, 5389, 13, 197, 1548, 5389, 20501, 80557, 198, 408, 59574, 11, 56842, 1729, 7604, 4144, 82, 11, 52060, 73553, 1659, 11, 18895, 3806, 13, 7721, 283, 4835, 8986, 26645, 197, 20019, 198, 258, 11575, 2282, 1752, 291, 25277, 64442, 1942, 3171, 11, 1186, 13430, 398, 11, 197, 4908, 197, 295, 3051, 197, 395, 13539, 8986, 2299, 13, 197, 10445, 197, 5562, 198, 64589, 2136, 2282, 52521, 17886, 531, 30, 71267, 33188, 197, 10924, 14789, 1942, 97860, 4023, 6831, 619, 74242, 2157, 5420, 287, 1752, 39870, 197, 906, 197, 86957, 32809, 197, 6961, 627, 791, 2282, 343, 7114, 2765, 18691, 20501, 64442, 17886, 33188, 197, 10924, 14789, 33188, 23235, 44323, 33188, 1186, 535, 1942, 4377, 73204, 198, 4930, 261, 18895, 318, 24031, 71275, 13, 33026, 1186, 25597, 44323, 33188, 2157, 485, 64355, 74242, 268, 1602, 9326, 1636, 198, 197, 14075, 11, 197, 273, 2370, 198, 64, 1942, 1330, 64442, 20501, 197, 21704, 197, 42450, 53577, 14294, 3002, 197, 2530, 4372, 13, 41065, 20501, 197, 35734, 17538, 43493, 6831, 66636, 1431, 198, 35214, 197, 1768, 40197, 950, 61280, 197, 383, 1942, 12982, 3324, 1727, 291, 197, 9274, 197, 383, 5389, 197, 2118, 56950, 197, 9514, 863, 53577, 198, 383, 5389, 197, 2118, 4291, 33188, 13017, 1894, 2029, 197, 4599, 197, 9514, 197, 3274, 11575, 197, 3039, 44323, 1186, 25597, 11, 33188, 1942, 1330, 36357, 198, 30998, 485, 20501, 197, 3274, 11, 2282, 332, 33188, 17904, 34383, 7145, 819, 285, 1942, 352, 64442, 197, 93221, 1942, 1330, 20501, 2765, 18780, 13, 62635, 20501, 198, 9054, 44323, 197, 9007, 13757, 13, 197, 78403, 94036, 74242, 2282, 1540, 197, 19041, 13, 197, 7009, 1470, 4841, 2090, 3303, 40381, 519, 198, 8920, 1602, 56902, 31543, 198, 13, 33026, 28973, 267, 7883, 447, 12031, 17886, 197, 23392, 6831, 619, 74242, 197, 2118, 57291, 1942, 1330, 2476, 82266, 198, 266, 197, 56371, 64442, 753, 11575, 3253, 1411, 197, 2050, 32809, 81531, 627, 32, 2765, 1259, 20501, 197, 4908, 11575, 197, 10399, 72939, 25653, 197, 8370, 197, 73254, 94036, 74242, 73570, 291, 25, 197, 3852, 198, 3163, 11, 197, 2050, 11, 82266, 99905, 13, 23845, 74, 31543, 20501, 33188, 1942, 373, 13, 197, 4599, 17904, 291, 8424, 1942, 954, 64442, 7883, 1225, 198, 14957, 20501, 11575, 197, 61571, 44323, 33188, 2157, 485, 11, 24263, 20501, 54012, 44631, 80557, 23845, 74, 1003, 292, 2765, 1259, 13, 197, 2118, 10343, 82, 198, 2063, 53577, 31780, 197, 4908, 1942, 375, 14895, 44323, 2765, 592, 17886, 11575, 197, 54971, 44323, 1942, 359, 4238, 2476, 197, 10210, 5518, 11575, 1186, 23333, 198, 53, 34383, 1942, 17718, 13, 71267, 23845, 74, 31543, 197, 906, 92974, 553, 33188, 73553, 1873, 44323, 52060, 197, 58174, 53577, 33188, 198, 12828, 8127, 44323, 33188, 197, 16476, 13, 33026, 23845, 74, 1003, 292, 2765, 1259, 20501, 1470, 437, 21914, 11, 21113, 4908, 33188, 99905, 278, 198, 57291, 82, 197, 906, 9793, 525, 36547, 9215, 492, 627, 45, 1170, 82, 3324, 616, 71275, 64442, 33188, 92675, 44323, 197, 2118, 29942, 287, 197, 2017, 63750, 1820, 16679, 7746, 17643, 7828, 198, 27244, 287, 33188, 95142, 8285, 13267, 44323, 33188, 197, 10924, 14789, 2345, 44466, 1186, 68, 2053, 99905, 278, 13, 10230, 68, 1184, 198, 11998, 197, 66154, 33188, 404, 59451, 95304, 1186, 12337, 53577, 197, 66434, 11, 2066, 8285, 1545, 13, 33026, 2765, 7169, 198, 9164, 197, 22025, 1157, 32809, 197, 4151, 33188, 197, 3039, 17886, 197, 8370, 9793, 285, 36502, 8986, 552, 11, 53577, 14477, 2490, 53577, 198, 25304, 811, 197, 13397, 197, 1919, 287, 9793, 318, 78546, 32809, 197, 47692, 8285, 81624, 13, 33026, 197, 9007, 3225, 44323, 198, 89894, 11575, 197, 52817, 197, 273, 391, 64355, 14862, 295, 32809, 74242, 92974, 1534, 13, 197, 2170, 17972, 61551, 197, 9514, 11926, 32809, 1186, 96551, 198, 4908, 33188, 99905, 197, 9514, 6831, 486, 11, 197, 9514, 94036, 1431, 8285, 13267, 33188, 197, 16476, 13, 197, 10267, 50394, 3253, 535, 197, 9514, 198, 276, 8285, 1545, 627, 1966, 11575, 1942, 375, 1802, 197, 833, 3531, 11575, 1186, 365, 197, 42820, 197, 6438, 25494, 2157, 295, 9796, 25380, 11, 11575, 197, 1543, 197, 14965, 3324, 820, 198, 2727, 64442, 197, 383, 9793, 329, 2282, 52521, 1186, 5171, 15846, 197, 1729, 33188, 197, 383, 6260, 3303, 16345, 44323, 37296, 309, 598, 17886, 33188, 198, 26070, 11285, 13, 197, 3923 ]
0xBreath/holistic-books
when describing your interactions with both worlds, you intuitively use the word “I,” as in “I was flying through the clouds with my arms open wide, then I suddenly woke up and realized I was in my bed.” In The Yoga Sutras of Patanjali, which is a very ancient yogic text, Patanjali discusses the topic of deep, dreamless sleep. He says that when you go to sleep and there are no dreams, it’s not that you are not conscious, it’s that you are conscious of nothing. If you spend time contemplating this, you’re going to find that you’re always conscious in there. Even people who get knocked unconscious, or go into a coma, often come back and tell us what they were experiencing. People have near-death experiences in which they leave their bodies and come back to tell about it. Whatever the source of these experiences, the same you in there experienced them and were able to describe what you experienced. How can you call that not being conscious? Medically, what we call “conscious” has to do with awareness of our external surroundings. However, the concept of whether you in there are consciously aware of anything—that’ s another story altogether. You’re always conscious. You’ve been conscious from the beginning. You’re aware of whate ver you focus on, internally or externally. Who are you? Who is that consciously aware entity inside?Chapter 3. Living Inside We are back to the most basic truths of your life: you’re in there, you know that you’re in there, and you’v e been in there all along. This raises some interesting quest ions, such as, when the body dies, will you still be aware of being? Isn’t that an interesting question? Don’ t get excited, we’re not going to answer that for you. Eventu ally, however, there will be someone who provides that answer: You. You are guara nteed to personally find out someday whether you will be there after the body dies. Why do people have so much trouble with death? It’s got to be one of the most exciting aspects of your life. It’s truly a once-in-a -lifetime experience! That is what’ s waiting for you at the time of death. After that final moment, either you are going to be there or you are not. If you’re not there, don’t worry. It’s not like, “Oh my god, I’m not here. I don’t like this.” No. You’re not there, so it’s not going to be a problem. The other alternative, however, is much more interesting—what if you are there? Then you’re going to find out what it’s like to explore a whole other universe where you don’t even have a body. Let’s not talk about it further because it runs into people’ s belie fs, concepts, or views about the subject. Let’s just let it be something to look forward to as the ultimate once-in-a-lifetime experience. The reason some people have so much trouble with death is because they identify with their bodies. As if that’s not enough, they also identify with their cars and houses. People project their sense of self onto things that are not their self. When they do that, they feel afraid to lose those things. As you work your way through your inner growth, you won’ t identify with these outer objects anymore. You’ll identify with the deeper sense of self within. Now that it’s clear that you’re in there, it becomes reasonable to ask: What do you do in there? Even more relevant, what’ s it like in there? Whatan interesting question to ask: What’ s it like in there? If people answered honestly, most would say that it’s not always so much fun in there. In fact, sometimes it’s downright tough. What’ s that all about? This is where we get down to a real honest discussi on about inner growth. Most people don’t realize that it can always be nice in there. Take the nicest it’s ever been: holding your first child, the day of your wedding, your first kiss, winning the lottery. Recall that state, then increase it multifold and have it be that way all the time—except that it keeps getting higher. That is what you are capable of experiencing inside. That’ s the truth. It is really beautiful in there, but something is messing it up. Imagine walking into a house that has dirt, banana peels, and pizza crusts all over the place. It happens to be a beautiful house, but no one took care of it. It can be beautiful again, but some work needs to be done. This is exactly the situation inside you. In fact, that is why we’re on this inner exploration. Everybody wants the same thing: they would like it to be nice in there. People do all kinds of things trying to make it nice in there. Some run around trying to have exciting experiences, find fulfilling relationships, or even take the edge off with drinking or drugs—all for the same reason. The problem is they’re approaching the issue in the wrong way. They’re asking how to make it nice in there, while the more relevant question is why is it not nice? If you find out why it’s not nice, and you get rid of that, you’re going to find out it can be really nice in there. Life doesn’ t have to be a game of, “Since it’s not nice in here, I need to find things that will compensate for that in order to feel a little bit better.” That is what everybody’ s doing. They are trying to find people, places, and things in the outside world that will unfold in a way that makes it more comfortable inside. People are trying to use the outside to fix the inside—b etter to find out why it’ s not nice inside to begin with.Chapter 4. The Three-Ring Circus “I’m in here. I’m conscious, and what I am conscious of is that it’s not always so nice in here.” That honest statement is a wonderful launching pad for continuing our exploration of Self and the power of acceptance. What is it you experience that sometimes makes it nice inside, and sometimes makes it very difficult? There are only three things you experience in there, so let’s take a look at them. First, you experience the outside world coming in through your senses. There’ s a whole world out there, and what’ s in front of you comes in through your eyes, ears, nose, and senses of taste and touch. When it comes in, it’s either a pleasant experi ence, an unpleasant experience, or a just- passing-through experience. Thus, the outside world is one of the things you deal with that has a profound ef fect on your inner state. As overwhelming as the outside world can be, it’s not all you experience inside. You also have thoughts in there. You hear the thoughts saying, “I don’t know if I like this. I don’t even understand why she did it.” Or perhaps, “Wow! I’d like to have a car like that. I would go for long weekend rides in the country.” If you’re asked who is saying all this inside your head, you’ll probably say it’s you. But it is not you. Those are thoughts, and you are the one who is noticing the thoughts. Thoughts are just another thing you notice in there. You notice the world coming in from outside, and you notice the thoughts that are generated inside. Where do thoughts come from? We’re going to discuss that at length later, but for right now, understand that thoughts and the outside world are two of the three things you experience inside. The third thing youexperience is your feelings or emotions. There are feelings that come up suddenly, like fear. Your mind can say, “I feel scared,” but if you didn’ t actually feel scared, the impact would be much less. It’s the fact that you actually experience the emotio n of fear that causes the problem. Some feelings are pleasant: “I felt love. I felt more love than I have ever felt before.” You like that feeling. Other feelings are unpleasant: “I’m feeling fear, embarrassment, and guilt coming up all at the same time.” You don’t like that, do you? We’ve already come a long way in our exploration of Self. We’ve proven you’re in there, and the strongest proof is you know that you’re in there. This is your seat of awar eness. Anytim e you get lost, just stand in front of the mirror and say, “Hi, are you in there?” Wave at yourself, and realize, “Yep, I see somebody waving. Who am I that sees that?” This is a way to center back to your seat of awareness. While you stand there, notice what else you’re aware of. Notice your surroundings coming in through your senses, your thoughts passing through your mind, and any emotions that arise in your heart creating feelings of comfort or discom fort within. These three inner experiences are the arena in which your consciousness plays the game of life on planet Earth. Bottom line, you don’t stand a chance in there. The constant barrage of these three expe riences is like a three-ring circus going on inside all the time. The
[ 994, 23524, 701, 22639, 449, 2225, 24800, 345, 9514, 97301, 3210, 1005, 279, 3492, 1054, 40, 2476, 439, 304, 1054, 40, 574, 16706, 1555, 279, 30614, 449, 198, 2465, 11977, 1825, 7029, 11, 1243, 358, 15187, 39826, 709, 323, 15393, 358, 574, 304, 856, 4950, 49216, 644, 578, 38673, 328, 332, 13075, 315, 7281, 53191, 8115, 11, 220, 902, 374, 264, 1633, 14154, 42453, 292, 220, 1495, 345, 47, 16623, 73, 8115, 35434, 279, 8712, 315, 5655, 11, 8063, 1752, 6212, 13, 1283, 2795, 430, 994, 198, 9514, 733, 311, 6212, 323, 1070, 527, 912, 19226, 11, 433, 753, 539, 430, 499, 527, 539, 17371, 345, 275, 753, 430, 499, 527, 17371, 315, 4400, 13, 1442, 499, 8493, 892, 79342, 420, 345, 9514, 3207, 2133, 311, 1505, 430, 499, 3207, 2744, 17371, 304, 1070, 13, 7570, 1274, 889, 198, 456, 33085, 40711, 11, 477, 733, 1139, 264, 70398, 11, 3629, 2586, 1203, 323, 3371, 603, 198, 12840, 814, 1051, 25051, 13, 9029, 617, 3221, 97586, 11704, 304, 902, 198, 20670, 5387, 872, 13162, 323, 2586, 1203, 311, 3371, 922, 433, 13, 33739, 279, 2592, 198, 1073, 1521, 11704, 11, 279, 1890, 499, 304, 1070, 10534, 1124, 323, 1051, 3025, 198, 998, 7664, 1148, 499, 10534, 13, 2650, 649, 499, 1650, 430, 539, 1694, 198, 64589, 30, 3344, 2740, 1174, 1148, 584, 1650, 1054, 64589, 863, 706, 311, 656, 449, 17985, 315, 198, 414, 9434, 40190, 13, 4452, 1174, 279, 7434, 315, 3508, 499, 304, 1070, 527, 198, 444, 71888, 8010, 315, 4205, 41128, 529, 274, 2500, 3446, 31155, 662, 1472, 3207, 198, 33222, 17371, 13, 1472, 4070, 1027, 17371, 505, 279, 7314, 13, 1472, 3207, 8010, 198, 1073, 421, 349, 2807, 499, 5357, 389, 11, 34167, 477, 69442, 662, 10699, 527, 499, 30, 10699, 374, 198, 9210, 70903, 8010, 5502, 4871, 30, 26072, 220, 18, 13, 720, 45605, 28468, 198, 1687, 527, 1203, 220, 311, 279, 1455, 6913, 53219, 315, 701, 2324, 25, 499, 3207, 304, 1070, 11, 499, 1440, 198, 9210, 499, 3207, 304, 1070, 11, 323, 499, 529, 85, 384, 1027, 304, 1070, 682, 3235, 13, 1115, 25930, 1063, 198, 88657, 2271, 65125, 11, 1778, 439, 11, 994, 279, 2547, 8898, 11, 690, 499, 2103, 387, 8010, 315, 198, 35214, 30, 53296, 1431, 430, 459, 7185, 3488, 30, 4418, 529, 259, 636, 12304, 11, 584, 3207, 539, 2133, 198, 998, 4320, 430, 369, 499, 13, 3749, 84, 31953, 11, 4869, 1174, 1070, 690, 387, 4423, 889, 198, 782, 68254, 430, 4320, 25, 1472, 13, 1472, 527, 1709, 5169, 308, 668, 291, 311, 16102, 1505, 704, 198, 82, 25111, 352, 3508, 499, 690, 387, 1070, 1306, 279, 2547, 8898, 13, 8595, 656, 1274, 617, 198, 708, 1790, 12544, 449, 4648, 30, 1102, 753, 2751, 311, 387, 832, 315, 279, 1455, 13548, 13878, 198, 1073, 701, 2324, 13, 1102, 753, 9615, 264, 3131, 3502, 7561, 482, 98157, 3217, 0, 3011, 374, 1148, 529, 274, 8748, 198, 2000, 499, 520, 279, 892, 315, 4648, 13, 4740, 430, 1620, 4545, 11, 3060, 499, 527, 2133, 311, 198, 1395, 1070, 477, 499, 527, 539, 13, 1442, 499, 3207, 539, 1070, 11, 1541, 1431, 11196, 662, 1102, 753, 539, 1093, 11, 1054, 12174, 198, 2465, 10087, 11, 358, 4344, 539, 1618, 13, 358, 1541, 1431, 1093, 420, 2029, 2360, 13, 1472, 3207, 539, 1070, 1174, 779, 433, 753, 539, 198, 9738, 311, 387, 264, 3575, 13, 578, 1023, 10778, 11, 4869, 1174, 374, 1790, 810, 198, 88657, 2345, 12840, 422, 499, 527, 1070, 30, 5112, 499, 3207, 2133, 311, 1505, 704, 1148, 433, 753, 198, 4908, 311, 13488, 264, 4459, 1023, 15861, 1405, 499, 1541, 1431, 1524, 617, 264, 2547, 16853, 10267, 753, 539, 3137, 922, 433, 4726, 1606, 433, 8640, 1139, 1274, 529, 274, 2888, 8789, 11, 19476, 345, 269, 6325, 922, 279, 3917, 13, 6914, 753, 1120, 1095, 433, 387, 2555, 311, 1427, 4741, 311, 198, 300, 279, 17139, 3131, 3502, 7561, 2922, 29615, 3217, 627, 791, 2944, 1063, 1274, 617, 779, 1790, 12544, 449, 4648, 374, 1606, 198, 20670, 10765, 449, 872, 13162, 13, 1666, 422, 430, 753, 539, 3403, 11, 814, 1101, 10765, 198, 4291, 872, 9515, 323, 15316, 13, 9029, 2447, 872, 5647, 315, 659, 8800, 2574, 430, 198, 548, 539, 872, 659, 13, 3277, 814, 656, 430, 11, 814, 2733, 16984, 311, 9229, 1884, 2574, 13, 1666, 198, 9514, 990, 701, 1648, 1555, 701, 9358, 6650, 11, 499, 2834, 529, 259, 10765, 449, 198, 45010, 16335, 6302, 14926, 13, 1472, 4805, 10765, 449, 279, 19662, 5647, 315, 659, 198, 56950, 627, 7184, 430, 433, 753, 2867, 430, 499, 3207, 304, 1070, 11, 433, 9221, 13579, 311, 2610, 512, 3923, 656, 499, 656, 304, 1070, 30, 7570, 810, 9959, 11, 1148, 529, 274, 433, 1093, 304, 1070, 30, 3639, 276, 7185, 3488, 311, 2610, 25, 3639, 529, 274, 433, 1093, 304, 1070, 30, 1442, 1274, 19089, 198, 71, 81572, 1174, 1455, 1053, 2019, 430, 433, 753, 539, 2744, 779, 1790, 2523, 304, 1070, 13, 763, 2144, 345, 57753, 433, 753, 71052, 11292, 13, 3639, 529, 274, 430, 682, 922, 30, 1115, 374, 1405, 584, 636, 198, 2996, 311, 264, 1972, 10978, 4358, 72, 389, 922, 9358, 6650, 13, 7648, 1274, 1541, 1431, 198, 8110, 553, 430, 433, 649, 2744, 387, 6555, 304, 1070, 13, 12040, 279, 17778, 478, 433, 753, 3596, 1027, 512, 43591, 701, 1176, 1716, 11, 279, 1938, 315, 701, 13306, 11, 701, 1176, 21735, 11, 11230, 198, 1820, 39339, 662, 80640, 430, 1614, 11, 1243, 5376, 433, 2814, 49385, 323, 617, 433, 387, 430, 198, 3195, 682, 279, 892, 2345, 11945, 430, 433, 13912, 3794, 5190, 662, 3011, 374, 1148, 499, 527, 198, 11600, 481, 315, 25051, 4871, 13, 3011, 529, 274, 279, 8206, 13, 1102, 374, 2216, 6366, 304, 1070, 345, 8248, 2555, 374, 76851, 433, 709, 13, 38891, 11689, 1139, 264, 3838, 430, 706, 26351, 345, 88847, 1069, 2053, 11, 323, 23317, 40712, 82, 682, 927, 279, 2035, 13, 1102, 8741, 311, 387, 264, 6366, 198, 7830, 11, 719, 912, 832, 3952, 2512, 315, 433, 13, 1102, 649, 387, 6366, 1578, 11, 719, 1063, 990, 198, 56345, 311, 387, 2884, 13, 1115, 374, 7041, 279, 6671, 4871, 499, 13, 763, 2144, 11, 430, 374, 3249, 198, 906, 3207, 389, 420, 9358, 27501, 13, 51898, 6944, 279, 1890, 220, 3245, 25, 814, 198, 41450, 1093, 433, 311, 387, 6555, 304, 1070, 627, 16298, 656, 682, 13124, 315, 2574, 4560, 311, 1304, 433, 6555, 304, 1070, 13, 4427, 1629, 198, 20019, 4560, 311, 617, 13548, 11704, 11, 1505, 50698, 12135, 11, 477, 198, 17206, 1935, 279, 6964, 1022, 449, 16558, 477, 11217, 87247, 369, 279, 1890, 2944, 13, 578, 198, 35686, 374, 814, 3207, 31047, 279, 4360, 304, 279, 5076, 1648, 13, 2435, 3207, 10371, 198, 5269, 311, 1304, 433, 6555, 304, 1070, 11, 1418, 279, 810, 9959, 3488, 374, 3249, 374, 433, 198, 1962, 6555, 30, 1442, 499, 1505, 704, 3249, 433, 753, 539, 6555, 11, 323, 499, 636, 9463, 315, 430, 11, 499, 3207, 198, 9738, 311, 1505, 704, 433, 649, 387, 2216, 6555, 304, 1070, 13, 9601, 3250, 529, 259, 617, 311, 387, 264, 198, 5924, 315, 11, 1054, 12834, 433, 753, 539, 6555, 304, 1618, 11, 358, 1205, 311, 1505, 2574, 430, 690, 198, 5807, 729, 349, 369, 430, 304, 2015, 311, 2733, 264, 2697, 2766, 2731, 662, 863, 3011, 374, 1148, 198, 30115, 2664, 529, 274, 3815, 13, 2435, 527, 4560, 311, 1505, 1274, 11, 7634, 11, 323, 2574, 304, 279, 198, 68090, 1917, 430, 690, 28572, 304, 264, 1648, 430, 3727, 433, 810, 10882, 198, 42450, 13, 9029, 527, 4560, 311, 1005, 279, 4994, 311, 5155, 279, 4871, 2345, 65, 56916, 311, 1505, 198, 412, 3249, 433, 529, 274, 539, 6555, 4871, 311, 3240, 449, 6487, 2943, 220, 19, 13, 720, 791, 14853, 11151, 287, 87921, 198, 10378, 4344, 304, 1618, 13, 358, 4344, 17371, 11, 323, 1148, 358, 1097, 17371, 315, 374, 430, 433, 753, 539, 198, 33222, 779, 6555, 304, 1618, 49216, 4897, 10978, 5224, 220, 374, 264, 11364, 28818, 11262, 369, 14691, 1057, 198, 30992, 7769, 315, 10323, 323, 279, 2410, 315, 26586, 13, 3639, 374, 433, 499, 3217, 198, 9210, 7170, 3727, 433, 6555, 4871, 11, 323, 7170, 3727, 433, 1633, 5107, 5380, 3947, 527, 1193, 2380, 2574, 499, 3217, 304, 1070, 11, 779, 1095, 753, 1935, 264, 1427, 520, 198, 49818, 13, 5629, 11, 499, 3217, 279, 4994, 1917, 5108, 304, 1555, 701, 198, 82, 4377, 13, 2684, 529, 274, 264, 4459, 1917, 704, 1070, 11, 323, 1148, 529, 274, 304, 4156, 315, 499, 4131, 304, 198, 20322, 701, 6548, 11, 25212, 11, 19689, 11, 323, 38207, 315, 12945, 323, 5916, 13, 3277, 433, 4131, 198, 258, 11, 433, 753, 3060, 264, 24729, 5866, 665, 346, 11, 459, 47989, 3217, 1174, 477, 264, 1120, 7058, 6519, 287, 43847, 3217, 13, 14636, 11, 279, 4994, 1917, 374, 832, 315, 279, 2574, 499, 198, 30739, 449, 430, 706, 264, 28254, 31469, 282, 440, 389, 701, 9358, 1614, 627, 2170, 22798, 439, 279, 4994, 1917, 649, 387, 11, 433, 753, 539, 682, 499, 198, 50659, 4871, 13, 1472, 1101, 617, 11555, 304, 1070, 13, 1472, 6865, 279, 11555, 198, 82, 17718, 11, 1054, 40, 1541, 1431, 1440, 422, 358, 1093, 420, 13, 358, 1541, 1431, 1524, 3619, 3249, 1364, 1550, 433, 49216, 2244, 8530, 11, 1054, 36981, 0, 358, 7070, 1093, 311, 617, 264, 1841, 1093, 430, 13, 358, 1053, 733, 369, 1317, 198, 10476, 408, 32327, 304, 279, 3224, 662, 863, 1442, 499, 3207, 4691, 889, 374, 5605, 682, 420, 4871, 198, 22479, 2010, 11, 499, 4805, 4762, 2019, 433, 753, 499, 13, 2030, 433, 374, 539, 499, 13, 13266, 527, 198, 61665, 82, 11, 323, 499, 527, 279, 832, 889, 374, 62464, 279, 11555, 13, 61399, 527, 198, 4345, 2500, 3245, 499, 5406, 304, 1070, 13, 1472, 5406, 279, 1917, 5108, 304, 505, 198, 68090, 11, 323, 499, 5406, 279, 11555, 430, 527, 8066, 4871, 627, 9241, 656, 11555, 2586, 505, 30, 1226, 3207, 2133, 311, 4358, 430, 520, 3160, 198, 68676, 11, 719, 369, 1314, 1457, 11, 3619, 430, 11555, 323, 279, 4994, 1917, 527, 198, 20375, 315, 279, 2380, 2574, 499, 3217, 4871, 13, 578, 4948, 220, 3245, 499, 50659, 374, 701, 16024, 477, 21958, 13, 2684, 527, 16024, 430, 2586, 709, 198, 82, 44806, 1174, 1093, 8850, 13, 4718, 4059, 649, 2019, 11, 1054, 40, 2733, 27207, 2476, 719, 422, 499, 3287, 529, 259, 198, 74128, 2733, 27207, 11, 279, 5536, 1053, 387, 1790, 2753, 13, 1102, 753, 279, 2144, 430, 499, 198, 74128, 3217, 279, 10382, 822, 308, 315, 8850, 430, 11384, 279, 3575, 13, 4427, 198, 57676, 826, 527, 24729, 25, 1054, 40, 6612, 3021, 13, 358, 6612, 810, 3021, 1109, 358, 617, 3596, 6612, 198, 15145, 2029, 1472, 1093, 430, 8430, 13, 7089, 16024, 527, 47989, 25, 1054, 40, 4344, 8430, 198, 69, 686, 11, 60030, 11, 323, 34951, 5108, 709, 682, 520, 279, 1890, 892, 2029, 1472, 1541, 1431, 198, 4908, 430, 11, 656, 499, 5380, 1687, 4070, 2736, 2586, 264, 1317, 1648, 304, 1057, 27501, 315, 10323, 13, 1226, 4070, 198, 782, 1055, 499, 3207, 304, 1070, 11, 323, 279, 31005, 11311, 374, 499, 1440, 430, 499, 3207, 304, 198, 19041, 13, 1115, 374, 701, 10954, 315, 1384, 277, 665, 434, 13, 220, 5884, 20693, 384, 499, 636, 5675, 11, 1120, 2559, 304, 198, 7096, 315, 279, 18327, 323, 2019, 11, 1054, 13347, 11, 527, 499, 304, 1070, 12671, 32418, 520, 6261, 11, 323, 198, 8110, 553, 11, 1054, 88643, 11, 358, 1518, 18570, 64211, 13, 10699, 1097, 358, 430, 16008, 430, 12671, 1115, 374, 264, 198, 3195, 311, 4219, 1203, 311, 701, 10954, 315, 17985, 13, 6104, 499, 2559, 1070, 11, 5406, 198, 12840, 775, 499, 3207, 8010, 315, 13, 25773, 701, 40190, 5108, 220, 304, 1555, 198, 22479, 38207, 11, 701, 11555, 12579, 1555, 701, 4059, 11, 323, 904, 21958, 198, 9210, 31889, 304, 701, 4851, 6968, 16024, 315, 6981, 477, 834, 884, 12108, 2949, 627, 9673, 2380, 9358, 11704, 527, 279, 25946, 304, 902, 701, 25917, 198, 28897, 279, 1847, 315, 2324, 389, 11841, 9420, 627, 11530, 1584, 11, 499, 1541, 1431, 2559, 264, 6140, 304, 1070, 13, 578, 6926, 81690, 315, 198, 45010, 2380, 506, 375, 436, 12242, 374, 1093, 264, 2380, 77029, 68124, 2133, 389, 4871, 682, 279, 198, 1712, 13, 578 ]
0xBreath/holistic-books
cave system in Indonesia on the South Sulawesi Peninsula, still in use by the native people. Radiocarbon analysis has date d the Indonesian paintings at between 35,000 and 42,000 years ago. Gazing at photos of these prehistoric artifacts (easily found online) is a fo rm of time tra vel, not physical but mental. At the oldest French site, the Chauvet-Pont-d’Arc Cave, which is on a limestone cliff above an ancient riverbed, now dry, the paintings are not hing less than art. Di scovered in 1994 and soon named a World H eritage Site by UNESCO, the Chauvet Cave features very large, very well-preserved animal figures by the hundreds, depicting thirteen species. In other Ice Age paintings, the chief subjects are herbivores, like horses and cattle, but the Chauvet artists added predators, like the cave lion, the panther, the bear, and the hyena. The circ umstances behind th e art were arduous. The cave walls are dee p inside, far from o utside light, which means that the painters worked in the dark by the light of flickering torches. As the ligh t bobbe d back and fo rth, the painters still had suc h a sure hand that the major curves o f each specific animal—horns, back, head, and legs—were done in a single stroke, the way an accomplished draftsman would do them today. The walls were apparently cleaned and smo othed to give a suitable pale area, a bare canvas, before the actual painting began. Two woolly rhinoceroses a re pictured butting heads, reflecting a desire by the original artist to portray scenes, and many animals are shown in motion, not like a child’s stick-figure drawings. As you could im agine, the desire to paint a picture isn’t si mple and nev er has been. Are these paintings mystical, ritualistic, or magical? The mental state o f the artists cannot be conclusively determined. There is beauty in how the animals were drawn, or are we simply imposing “beau ty” from our own familiar concepts? Whatever cave painters had in mind, it went viral, so to sp eak. The same images are repeated by cultures thousands of miles apart. A s maller mystery within the larger one is why the cave painters didn’t depict them selves. At Chauvet thirty thousand years ag o, the painters portrayed no full human figures and onlyone par tial figu re (the lower h alf of a female body, with prominent sexual organs), but there are numerous outlines of human hands imprinted on the wall. These were done by blowing red ochre pigment around someone’s hand as it was pressed against the stone. Outlines of hands also appear in the Indonesian caves thousands of years earlier, then in Argentina between nine thousand and thirteen thousand years ago, and in petroglyphs of the An asazi, or ancient ones, of the Southwest of the United States. These scattered handprints lead to no definite conclusion. Perhaps they mark tribal alle giances, or simply the message I was here. The explosion of sophisticate d art, on a global scale, testifies to a hidd en potential comin g to life as an awaken ing in consciousness, vibrant and full-blown. Art must be considered evolutionary in Homo sapiens, be cause it h as persisted as a dominant trait of our species in every society without dy ing out. Yet it seems un likely that art somehow provided a survival value. Cave painting testifies to prehistoric humans’ caring for something beyond physical needs, and this something emerged directly from their consciousness. To me the Chauvet cave paintings clearly drew on the whole mind. A prehis toric Picasso didn’t step up to the blank canvas of a limestone wall and let fly his genius. Homo sapiens evolved much more ho listically. At the very least, the desire to create art involves the following attributes we ca n all identify with, even if we aren’t artists: Curiosity Intelligence Purpose Motivation Diligence Eye-hand coordination Learning a skill setThese m ental traits have to exist in order to build the Taj Mahal, invent the internal combustion engine, or paint a woolly rhinoceros on a cave wall. And the whole collection of traits has to come t ogether into a single intention. Figuring out how this happens may be impossible scientifically. There is no way to gather evidenc e when what you are looking for is invisib le. Even so, the capaci ty to use the whole mind convinces me that our remote ancestors contained the seeds of metahuman. Being able to access the whole mind destroys the myth that our ancestors were primitive. Their potential was already infinite. A B r a i n T e a s e r Once Homo sapiens found a path to whole mind, the experience became embedded in human evolution. If we examine ourselves closely, it is clear that we are whole-mind cr eatures. Let’s te st this proposition with a simple chore like driving to the grocery store to buy a child’s birthday cake. Behind the simplicity of the task is a complex of mental activities we take for granted. The ingredients in the mix include the following: Knowing the concept of “birthday cake” and matching the words to a physical object. Wanting to do something nice for your child. Putting the cake on your to-do list. Knowing how to drive. Remembering the route to the grocery store. Giving priority to this task over other demands on your time. Selecting one cake out of many, using judgment about which one your child will like the best.These things span emotion, intention, visual recognition, memory, moto r coordinatio n, and stored skills—for one small errand! Neuro science can locate and isolate where some of these mental activiti es are represented in the brain, but how th ey mesh into a unified outcome—shopping for a birthday cake—cannot be explained. The process of ge tting billions of brain cells t o fire in sync makes herding cats lo ok simple. It’s more like wrangling every cat in the world. Even less can anyone explain how the brain shifts gears without any visible transition from A to B. One incredibly com plicated pattern of brain activity spontaneously shifts to another. Unlike a car, the re’s no transmission or gearshift. Imagine that you are reading a novel and forget that there’s a roast in th e oven. Absorbed in The Lord of the Rings or Jane Eyre, you suddenly notice the acrid smell of smoke in the air. Instantly, this simple sensation of smell causes you to leap into action, and the book is forgotten. Carbon molecules stimulating receptors for detecting odor th row your brain into a new pattern of coordinated action. Relaxation turns to stress in an instant. To s ay that you r brain noticed the burning roast doesn’t ex plain your reaction. Your brain processed the raw data of smoke particles entering the nasal passage, but it takes a person to notice the smell and g ive it significance. The same smell, when applied to charring a steak on the grill in summer, provokes no alarm, even though the physical process taking place in the nose and brain is identical. Elec trochemical a ctivity buzzing around the cortex forms one pattern for the house burning down and another for a barbecue. That’s all a neuroscientist has to work with, and it’s not nearly enough. Even if neuroscience could map every minute area of brain activity, down to the smallest detail—as is currently being attempted by the National Institutes of Health through the federally fund ed Brain Initiative—consciousness would be undetectable. If the brain is a red herring in regard to a whiff of smoke, it may be a red herri ng in lots of other ways as well. Two would-be poet s could be writing a sonnet, causing specific brain activity to light up on an fMRI scan, but nobody would be able to pick out which writer is Shakespeare and which a duffer.Einstein’s brain was autops ied after death to determine if the world’s greate st genius, as he was popularly tagged, had an unusual brain; he didn’t. On YouTube, you can find numerous videos o f child prodigies playing the piano at the age of three or four when, according to normal brain development, such a complex display of muscle coordination shouldn’t be possible. Attaining skill at piano playin g ordinarily takes years or de cades to achieve. Having escape d the constraints of physical evolution, Homo sapiens stoppe d being puppets of the brain. Despite every finding revealed by neuroscience—many of them fascinating and important—the bottom line is that you rule your brain, not the other w ay around. The path to metahuman is a path of self- awareness about this very thing. You can control who you are, even if you thi nk you can’t. T he trail of clues has led us far along the path. Now we are ready to undertake a reality shift even more
[ 26457, 1887, 220, 304, 24922, 389, 279, 4987, 46962, 675, 34183, 198, 29305, 36473, 11, 2103, 304, 1005, 555, 279, 10068, 1274, 13, 35969, 511, 52745, 6492, 198, 4752, 2457, 294, 279, 59929, 36692, 520, 1990, 220, 1758, 11, 931, 323, 220, 2983, 11, 931, 198, 42820, 4227, 627, 38, 6795, 520, 7397, 315, 1521, 864, 74416, 36136, 320, 68, 38367, 1766, 198, 26732, 8, 374, 264, 12018, 19535, 315, 892, 9781, 9231, 11, 539, 7106, 719, 10723, 13, 2468, 279, 198, 337, 5086, 8753, 2816, 11, 279, 921, 2933, 17553, 9483, 546, 1773, 529, 37909, 50492, 11, 902, 374, 389, 264, 198, 75, 36541, 44106, 3485, 459, 14154, 15140, 2788, 11, 1457, 9235, 11, 279, 36692, 198, 548, 539, 305, 287, 2753, 1109, 1989, 13, 7923, 274, 21468, 304, 220, 2550, 19, 323, 5246, 7086, 264, 198, 10343, 473, 2781, 18950, 13207, 555, 81876, 11, 279, 921, 2933, 17553, 50492, 4519, 1633, 198, 17185, 11, 1633, 1664, 2320, 52202, 10065, 12678, 555, 279, 11758, 345, 15237, 858, 287, 61759, 9606, 13, 763, 1023, 20534, 13381, 36692, 11, 279, 10388, 198, 65882, 527, 39999, 344, 4692, 11, 1093, 220, 27928, 323, 36952, 11, 719, 279, 921, 2933, 17553, 198, 77735, 3779, 56217, 11, 1093, 279, 26457, 40132, 11, 279, 7363, 700, 11, 279, 11984, 345, 438, 279, 6409, 7304, 627, 791, 4319, 4543, 9623, 4920, 270, 384, 1989, 1051, 802, 1072, 788, 13, 578, 26457, 14620, 198, 548, 45833, 281, 4871, 11, 3117, 505, 297, 8791, 3002, 3177, 11, 902, 3445, 430, 279, 198, 34717, 388, 6575, 304, 279, 6453, 555, 279, 3177, 315, 29447, 4776, 7990, 288, 13, 1666, 198, 1820, 326, 1108, 259, 36292, 1395, 294, 1203, 323, 12018, 436, 339, 11, 279, 97953, 2103, 1047, 11405, 305, 264, 2771, 198, 10888, 430, 279, 3682, 37033, 297, 282, 1855, 3230, 10065, 2345, 71, 44129, 11, 1203, 345, 2025, 11, 323, 14535, 2345, 52898, 2884, 304, 264, 3254, 12943, 11, 279, 1648, 459, 198, 73087, 501, 3384, 64692, 1543, 1053, 656, 1124, 3432, 13, 578, 14620, 1051, 198, 680, 31227, 28822, 323, 44673, 297, 79371, 311, 3041, 264, 14791, 28639, 3158, 11, 264, 198, 55202, 10247, 11, 1603, 279, 5150, 19354, 6137, 13, 9220, 39640, 398, 198, 41196, 258, 511, 6398, 288, 264, 312, 42666, 719, 1303, 14971, 11, 42852, 264, 12876, 555, 279, 198, 10090, 10255, 311, 25920, 16451, 11, 323, 1690, 10099, 527, 6982, 304, 198, 49975, 11, 539, 1093, 264, 1716, 753, 9396, 100096, 38940, 627, 2170, 499, 1436, 737, 945, 483, 11, 279, 12876, 311, 6308, 264, 6945, 4536, 1431, 4502, 296, 698, 198, 438, 102306, 2781, 706, 1027, 13, 8886, 1521, 36692, 69532, 11, 28278, 4633, 11, 477, 198, 31606, 950, 30, 578, 10723, 1614, 297, 282, 279, 13820, 4250, 387, 84082, 3210, 198, 67, 47737, 13, 2684, 374, 13444, 304, 1268, 279, 10099, 1051, 15107, 11, 477, 198, 548, 584, 5042, 49941, 1054, 1395, 2933, 13892, 863, 505, 1057, 1866, 11537, 19476, 5380, 47916, 26457, 220, 97953, 1047, 304, 220, 4059, 11, 433, 4024, 29962, 11, 779, 311, 993, 384, 587, 13, 578, 198, 25030, 5448, 527, 11763, 555, 27833, 9214, 315, 8931, 10980, 627, 32, 274, 296, 14283, 23347, 2949, 279, 8294, 832, 374, 3249, 279, 26457, 198, 34717, 388, 3287, 1431, 43504, 1124, 84137, 13, 2468, 921, 2933, 17553, 27219, 16579, 198, 42820, 945, 297, 11, 279, 97953, 45877, 912, 2539, 3823, 12678, 323, 1193, 606, 1370, 259, 532, 4237, 84, 312, 320, 1820, 4827, 305, 85766, 315, 264, 8954, 2547, 11, 449, 21102, 198, 44687, 36853, 705, 719, 1070, 527, 12387, 50729, 315, 3823, 6206, 198, 318, 53313, 389, 279, 7147, 13, 4314, 1051, 2884, 555, 41442, 2579, 12218, 265, 198, 90600, 479, 2212, 4423, 753, 1450, 439, 433, 574, 17770, 2403, 279, 198, 11046, 13, 4470, 8128, 315, 6206, 1101, 5101, 304, 279, 59929, 66664, 198, 339, 40137, 315, 1667, 6931, 11, 1243, 304, 32164, 1990, 11888, 198, 339, 52949, 323, 61759, 16579, 1667, 4227, 11, 323, 304, 6896, 12184, 9717, 82, 315, 198, 1820, 1556, 439, 18291, 11, 477, 14154, 6305, 11, 315, 279, 46785, 315, 279, 3723, 198, 24137, 13, 4314, 38067, 1450, 26822, 3063, 311, 912, 44870, 17102, 627, 32576, 814, 1906, 40489, 12584, 342, 22566, 11, 477, 5042, 279, 1984, 358, 574, 198, 6881, 16853, 791, 25176, 315, 24940, 349, 294, 1989, 11, 389, 264, 3728, 5569, 11, 1296, 9803, 311, 198, 64, 305, 1810, 665, 4754, 470, 258, 342, 311, 2324, 439, 459, 42518, 6892, 304, 198, 64589, 2136, 11, 34076, 323, 2539, 16677, 785, 13, 5277, 2011, 387, 6646, 198, 5230, 3294, 661, 304, 84497, 82295, 729, 1174, 387, 5353, 433, 305, 439, 54095, 439, 264, 198, 5717, 86396, 18027, 220, 315, 1057, 9606, 304, 1475, 8396, 2085, 14282, 6892, 704, 627, 29174, 433, 5084, 653, 4461, 430, 1989, 17354, 3984, 264, 20237, 907, 627, 34, 525, 19354, 1296, 9803, 311, 864, 74416, 12966, 529, 30598, 369, 2555, 198, 65, 23478, 7106, 3966, 11, 323, 420, 2555, 22763, 6089, 505, 198, 50828, 25917, 627, 1271, 757, 279, 921, 2933, 17553, 26457, 36692, 9539, 24465, 389, 279, 4459, 198, 38824, 13, 362, 220, 864, 26301, 5801, 292, 67283, 3287, 1431, 3094, 709, 311, 279, 10321, 10247, 315, 264, 198, 75, 36541, 7147, 220, 323, 1095, 11722, 813, 35201, 13, 84497, 82295, 729, 220, 28995, 1790, 198, 6518, 11640, 1160, 2740, 13, 2468, 279, 1633, 3325, 11, 279, 12876, 311, 1893, 1989, 18065, 198, 1820, 2768, 8365, 584, 2211, 308, 682, 10765, 449, 11, 1524, 422, 584, 7784, 1431, 198, 77735, 512, 17119, 33279, 198, 1090, 8677, 198, 75133, 198, 61032, 40227, 198, 35, 74376, 768, 198, 51158, 25417, 38793, 198, 48567, 264, 10151, 743, 9673, 296, 1218, 278, 25022, 617, 311, 3073, 304, 2015, 311, 1977, 279, 67799, 198, 47308, 278, 11, 17459, 279, 5419, 59333, 4817, 11, 477, 6308, 264, 39640, 398, 198, 41196, 258, 511, 6398, 389, 264, 26457, 7147, 13, 1628, 279, 4459, 4526, 315, 25022, 706, 311, 198, 2063, 259, 297, 3522, 1139, 264, 3254, 14944, 13, 23966, 1711, 704, 1268, 420, 198, 71, 680, 729, 1253, 387, 12266, 220, 74647, 13, 2684, 374, 912, 1648, 311, 198, 96825, 5339, 967, 384, 994, 1148, 499, 527, 3411, 369, 374, 100137, 581, 514, 13, 7570, 198, 708, 11, 279, 23878, 72, 13892, 311, 1005, 279, 4459, 4059, 21770, 1634, 757, 430, 1057, 198, 18643, 38618, 13282, 279, 19595, 315, 2322, 1494, 7282, 13, 21347, 3025, 198, 998, 2680, 279, 4459, 4059, 60832, 279, 21849, 430, 1057, 38618, 198, 52898, 28694, 13, 11205, 4754, 574, 2736, 24746, 627, 720, 32, 220, 426, 436, 264, 602, 308, 220, 350, 384, 264, 274, 384, 436, 198, 12805, 84497, 82295, 729, 220, 1766, 264, 1853, 311, 4459, 4059, 11, 279, 198, 50659, 6244, 23711, 304, 3823, 15740, 13, 1442, 584, 21635, 198, 2530, 4372, 15499, 11, 433, 374, 2867, 430, 584, 527, 4459, 1474, 485, 1589, 384, 2859, 627, 10267, 753, 1028, 357, 420, 41180, 449, 264, 4382, 50671, 1093, 10043, 311, 279, 198, 42511, 22228, 3637, 311, 3780, 264, 1716, 753, 220, 15553, 19692, 13, 43474, 279, 40075, 198, 1073, 279, 3465, 374, 264, 6485, 315, 10723, 7640, 584, 1935, 369, 11938, 627, 791, 14293, 304, 279, 6651, 2997, 279, 2768, 512, 96621, 279, 7434, 315, 1054, 52365, 19692, 863, 323, 12864, 279, 198, 5880, 311, 264, 7106, 1665, 627, 29923, 287, 311, 656, 2555, 6555, 369, 701, 1716, 627, 99004, 279, 19692, 389, 701, 311, 30659, 1160, 627, 96621, 1268, 311, 6678, 627, 29690, 287, 279, 6149, 311, 279, 30687, 3637, 627, 97602, 10844, 311, 420, 3465, 927, 1023, 18651, 389, 701, 198, 1712, 627, 3461, 287, 832, 19692, 704, 315, 1690, 11, 1701, 19971, 922, 198, 8370, 832, 701, 1716, 690, 1093, 279, 1888, 5221, 2423, 2574, 9575, 20356, 11, 14944, 11, 9302, 18324, 345, 17717, 11, 74056, 436, 30478, 6400, 308, 11, 323, 9967, 7512, 72318, 832, 2678, 198, 618, 438, 0, 32359, 8198, 649, 25539, 323, 43223, 1405, 1063, 315, 1521, 198, 93221, 4197, 12583, 1560, 527, 15609, 304, 279, 8271, 11, 719, 1268, 270, 3999, 11546, 198, 18614, 264, 43790, 15632, 2345, 51666, 369, 264, 15553, 19692, 2345, 34360, 387, 198, 81950, 13, 578, 220, 1920, 315, 3980, 259, 1303, 33151, 315, 8271, 7917, 259, 297, 4027, 304, 198, 13293, 3727, 1077, 7113, 19987, 781, 5509, 4382, 13, 1102, 753, 810, 1093, 3189, 91204, 198, 30115, 8415, 304, 279, 1917, 627, 13461, 2753, 649, 5606, 10552, 1268, 279, 8271, 29735, 54260, 2085, 198, 3852, 9621, 9320, 505, 362, 311, 426, 13, 3861, 17235, 470, 281, 14040, 198, 14676, 315, 8271, 5820, 88558, 29735, 311, 2500, 13, 27140, 264, 198, 7063, 11, 279, 312, 753, 912, 18874, 477, 14787, 13724, 13, 38891, 430, 499, 527, 198, 6285, 264, 11775, 323, 10894, 430, 1070, 753, 264, 58785, 304, 270, 384, 24276, 627, 28878, 269, 2788, 304, 578, 10425, 315, 279, 47380, 220, 477, 22195, 44511, 265, 1174, 499, 15187, 198, 24467, 279, 1645, 1907, 22843, 315, 16603, 304, 279, 3805, 13, 18549, 398, 11, 420, 4382, 198, 82, 42725, 315, 22843, 11384, 499, 311, 32571, 1139, 1957, 11, 323, 279, 2363, 374, 198, 97944, 10503, 13, 22208, 35715, 65792, 44540, 369, 54626, 198, 50017, 270, 2872, 701, 8271, 1139, 264, 220, 502, 5497, 315, 47672, 1957, 627, 6882, 710, 367, 10800, 311, 8631, 304, 459, 9888, 627, 1271, 274, 19432, 430, 499, 436, 8271, 14000, 279, 20252, 58785, 3250, 1431, 506, 14733, 198, 22479, 13010, 13, 220, 4718, 8271, 15590, 279, 7257, 828, 315, 16603, 198, 69598, 16661, 279, 72188, 21765, 11, 719, 433, 5097, 264, 1732, 311, 5406, 198, 1820, 22843, 323, 342, 99677, 433, 26431, 13, 578, 1890, 22843, 11, 994, 9435, 311, 198, 331, 20450, 264, 50059, 389, 279, 40158, 304, 7474, 11, 2605, 8099, 912, 17035, 11, 1524, 198, 4636, 279, 7106, 1920, 4737, 2035, 304, 279, 19689, 323, 8271, 374, 198, 1748, 950, 13, 27039, 66, 8348, 32056, 264, 20864, 1968, 86424, 2212, 279, 220, 49370, 198, 10008, 832, 5497, 369, 279, 3838, 20252, 1523, 323, 2500, 369, 264, 198, 2308, 53085, 13, 3011, 753, 682, 264, 18247, 56447, 380, 706, 311, 990, 449, 11, 323, 433, 753, 539, 198, 77, 22928, 3403, 627, 13461, 422, 220, 93048, 1436, 2472, 1475, 9568, 3158, 315, 8271, 198, 7323, 11, 1523, 311, 279, 25655, 7872, 60654, 374, 5131, 1694, 198, 56605, 291, 555, 279, 5165, 73828, 315, 6401, 1555, 279, 198, 69, 7442, 750, 3887, 1608, 31417, 38756, 2345, 64589, 2136, 1053, 387, 198, 1263, 13478, 481, 13, 1442, 279, 8271, 374, 264, 2579, 305, 14782, 304, 5363, 311, 264, 421, 3168, 315, 198, 3647, 4845, 11, 433, 1253, 387, 264, 2579, 1077, 462, 7933, 304, 10283, 315, 1023, 5627, 439, 1664, 13, 9220, 198, 41450, 15502, 40360, 274, 1436, 387, 4477, 264, 4538, 4816, 11, 14718, 3230, 8271, 198, 7323, 311, 3177, 709, 389, 459, 282, 79770, 8737, 11, 719, 19093, 1053, 387, 220, 3025, 311, 198, 30345, 704, 902, 7061, 374, 42482, 323, 902, 264, 294, 2084, 5253, 37494, 753, 8271, 574, 3154, 3806, 602, 291, 1306, 4648, 311, 8417, 422, 279, 198, 14957, 753, 342, 979, 357, 35201, 11, 439, 568, 574, 5526, 398, 38213, 11, 1047, 459, 198, 359, 81324, 8271, 26, 568, 3287, 1431, 13, 1952, 13674, 11, 499, 649, 1505, 12387, 198, 35123, 297, 282, 1716, 220, 14814, 343, 552, 5737, 279, 27374, 520, 279, 4325, 315, 2380, 477, 198, 35124, 994, 11, 4184, 311, 4725, 8271, 4500, 11, 1778, 264, 198, 24126, 3113, 315, 16124, 38793, 13434, 1431, 387, 3284, 627, 10673, 2101, 10151, 520, 27374, 1514, 258, 342, 98081, 5097, 1667, 477, 409, 272, 3536, 311, 198, 613, 19704, 627, 29132, 12731, 294, 279, 17413, 315, 7106, 15740, 11, 84497, 198, 82, 2113, 729, 220, 3009, 375, 294, 1694, 15241, 65301, 315, 279, 8271, 13, 18185, 1475, 9455, 198, 92076, 5962, 555, 93048, 2345, 35676, 315, 1124, 27387, 323, 198, 15693, 22416, 5740, 1584, 374, 430, 499, 6037, 701, 8271, 11, 539, 279, 198, 1605, 289, 19432, 2212, 13, 578, 1853, 311, 2322, 1494, 7282, 374, 264, 1853, 315, 659, 7058, 20111, 2136, 922, 420, 1633, 3245, 13, 1472, 649, 2585, 889, 499, 527, 345, 17206, 422, 499, 62428, 80591, 499, 649, 1431, 13, 350, 568, 9025, 315, 43775, 706, 6197, 603, 3117, 3235, 198, 1820, 1853, 13, 4800, 584, 527, 5644, 311, 49643, 264, 8903, 6541, 1524, 810 ]
0xBreath/holistic-books
toxins. To the extent that we can accomplish these tasks well, we can significantly extend the length and the quality of our lives. In the real world, these two tasks are never accomplished perfectly. As a result, cells suffer, we age, the quality of life is diminished and we die. The variable in this sequence is how fast we allow this to happen. What about other causes of disease, such as genetic inheritance and infections by microorganisms? Yes, genes and germs trigger cellular malfunction, but they do so by causing deficiencies or toxicities, which are always the common denominators of disease. Eliminate these factors and you eliminate disease. For example, consider diseases with a genetic basis, such as ALD (adrenoleukodystrophy), the genetic disease featured in the movie Lorenzo’s Oil. People with ALD develop abnormally high levels of very long-chain fatty acids, which are molecules that are natural to the body. These fatty acids can build up to levels that are toxic to cells. This toxicity is the result of a genetically caused deficiency of special protein molecules that keep these fatty acid levels within normal limits. Lorenzo’s parents compensated for the genetic deficiency by supplementing their son’s diet with a combination of oils that helped to lower the level of the offending fatty acids, thereby reducing the toxic effect on his body. What caused Lorenzo’s disease? Was it genetics? Yes, but for his disease to manifest, his cells had to be deficient and toxic. Deficiency and toxicity are always the common denominators of all disease. The same is true of infections from microorganisms. Anthrax, for example, makes us sick and kills by producing toxins. Without deficiency and toxicity causing cells to malfunction, there is no disease.What about stress? Hasn’t that been proven to cause disease? True, stress is a major factor that contributes to disease. Chronic stress results in an excessive buildup of natural chemicals in the body, which at higher levels become toxic. In addition, stress depletes the body of certain nutrients, resulting in deficiency. Stress is a contributor to disease, but only by expressing itself through the common denominators of all disease: deficiency and toxicity. Deficiency and toxicity, regardless of their cause, increasingly compromise the functioning of cells, making a person steadily more vulnerable to developing a diagnosable disease. By the time you contract a diagnosable disease (whether we’re talking about the common cold, allergies, cancer or heart disease), you have probably been “sick” for a long time. You have suffered enough cellular damage from deficiency and toxicity that cells throughout your body are malfunctioning. You are sick long before you get sick. By the time symptoms are produced, cellular malfunction has become widespread, cell-to-cell communications have been disrupted and the systemic manifestations are the symptoms. Remember that disease does not just randomly happen, like a meteorite falling out of the sky. Health, not disease, is the natural state of human existence, but forgetting this point is easy when we see all the disease around us. Symptoms Versus the One Disease Our society’s current understanding of disease is based on the concept of symptomology. Symptomology is about focusing on, identifying and categorizing symptoms—in other words, the effects produced by disease. In this manner, doctors supposedly can differentiate one disease from another. Because the entirety of modern medicine and everything we have ever learned about disease is based on symptomology, the concept of only one disease may seem unacceptably simplistic. Actually the symptomology concept is the flawed one. Symptomology is based on a fundamental misconception, one held by virtually all medical establishments in Western society. The misconception is that thousands of different diseases exist, each with different symptoms, causes and treatments. This misconception stems from the many different ways that cells can malfunction, and therefore the thousands of different symptoms that can be produced. The modern medical treatment of almost all disease focuses on the management of these symptoms (the effects of disease), rather than eliminating the causes, which are deficiency and toxicity. People are told to take insulin to manage their blood sugar rather than eliminating their diabetes, or to take diuretics to treat their hypertension rather than normalizing their blood pressure. They are told to have a bypass operation rather than reversing theirheart disease or to undergo chemotherapy rather than healing their cancer. Diagnosis by symptoms is the process by which modern medicine gives each collection of symptoms a particular name. Medicine views symptoms as enemies, and physicians are trained to eliminate them, even if that means aggressively assaulting the body with dangerous toxins, radiation or invasive surgery. Symptomology leads the medical profession to look at symptoms individually, organize them into thousands of categories, label them as different diseases and then prescribe a currently accepted protocol to suppress those symptoms. This approach adds needless complexity, creates massive confusion and results in an inability to deal with disease in a meaningful way. In truth, each collection of symptoms—each specific “disease”—is just a different expression of malfunctioning cells. However, with all of our different types of cells, and all of the different ways in which each cell can malfunction, the number of possible combinations of symptoms becomes vast. In other words, when cells malfunction, we may feel sick in many different ways. Cells that are malfunctioning because of a vitamin C deficiency exhibit different symptoms than those malfunctioning because of a zinc deficiency. Cells malfunctioning because of lead toxicity exhibit different symptoms from those malfunctioning because of mercury toxicity. Various combinations of deficiencies and toxicities produce a myriad of complex symptoms (thousands of “diseases”), but the symptoms are not relevant. To solve any problem, you have to address the causes, not the symptoms. Modern medicine, by placing the focus on symptoms, has yet to develop any theory regarding the relationship between health and disease. Medicine looks at these as if they are two different states, while health and disease are really different sides of the same coin in a constantly shifting continuum. Lacking a practical theory, physicians have no framework in
[ 32809, 87, 1354, 13, 197, 1271, 33188, 197, 71272, 64442, 197, 906, 94036, 197, 73087, 501, 819, 197, 45010, 3324, 4707, 198, 9336, 11, 197, 906, 94036, 70154, 98864, 197, 26103, 33188, 50146, 53577, 33188, 197, 10692, 44323, 197, 414, 8986, 1924, 13, 71267, 33188, 198, 8110, 77608, 11, 197, 45010, 3324, 1146, 3324, 4707, 197, 548, 197, 37593, 197, 73087, 501, 3384, 197, 64185, 398, 13, 197, 2170, 11575, 9753, 11, 1470, 6572, 198, 82, 2084, 11, 197, 906, 197, 425, 11, 33188, 197, 10692, 44323, 8986, 1643, 20501, 2765, 318, 25682, 53577, 197, 906, 38004, 13, 33026, 2462, 2205, 17886, 2090, 198, 15880, 20501, 197, 5269, 1186, 561, 197, 906, 197, 7331, 2090, 32809, 9793, 64860, 627, 3923, 197, 9274, 197, 1605, 197, 936, 4881, 44323, 2765, 56407, 11, 1942, 1412, 61551, 83381, 5411, 197, 13119, 685, 53577, 17886, 25384, 198, 1729, 2157, 2823, 76991, 30, 197, 9642, 11, 3253, 22383, 53577, 197, 1414, 1026, 84328, 47087, 1299, 2157, 278, 1723, 11, 2282, 332, 197, 20670, 198, 3055, 197, 708, 197, 1729, 197, 936, 985, 7604, 43690, 82266, 32809, 14668, 1385, 11, 197, 8370, 197, 548, 197, 33222, 33188, 84925, 198, 5294, 8129, 3046, 44323, 2765, 56407, 13, 23626, 4763, 3357, 197, 45010, 1186, 21846, 53577, 197, 9514, 197, 40895, 3357, 2765, 56407, 13, 197, 2520, 198, 8858, 11, 197, 25742, 2765, 1082, 2315, 48048, 11575, 83381, 5411, 2282, 10949, 11, 1942, 1412, 61551, 98372, 35, 198, 44879, 1466, 1286, 3178, 347, 599, 58175, 705, 33188, 83381, 5411, 2765, 56407, 1186, 15563, 67, 17886, 33188, 2157, 6461, 1602, 43, 24568, 13028, 753, 49149, 321, 627, 16298, 48048, 98372, 35, 197, 16219, 197, 370, 86336, 9793, 1108, 197, 43664, 44323, 197, 1225, 17972, 66286, 1186, 23758, 82300, 3447, 345, 8370, 197, 548, 2157, 82206, 64442, 197, 548, 9215, 4688, 32809, 33188, 36502, 13, 197, 9673, 1186, 23758, 82300, 3447, 94036, 70471, 60910, 198, 998, 197, 43664, 64442, 197, 548, 32809, 14668, 32809, 1470, 6572, 13, 41065, 1602, 998, 14668, 488, 1602, 285, 33188, 9753, 44323, 11575, 83381, 37774, 197, 936, 2656, 198, 755, 10603, 1602, 1073, 1942, 3037, 197, 79565, 2157, 82206, 64442, 197, 13397, 197, 45010, 1186, 23758, 197, 58156, 197, 43664, 48048, 258, 198, 8416, 197, 42178, 13, 15420, 24568, 13028, 753, 25841, 82, 197, 5807, 729, 660, 2066, 33188, 83381, 5411, 7604, 10603, 197, 1729, 198, 13066, 2833, 287, 33188, 404, 197, 942, 753, 2765, 3978, 48048, 11575, 197, 76128, 44323, 23021, 8839, 64442, 88740, 291, 32809, 8986, 1223, 198, 1820, 54843, 44323, 33188, 197, 1885, 2518, 1186, 23758, 82300, 3447, 11, 197, 19041, 1729, 17643, 1072, 6253, 33188, 32809, 14668, 89170, 25653, 9793, 285, 198, 2664, 13, 197, 3923, 197, 936, 2656, 15420, 24568, 13028, 753, 2765, 56407, 30, 17749, 300, 24263, 83381, 25265, 30, 197, 9642, 11, 2282, 332, 2066, 9793, 285, 2765, 56407, 198, 998, 197, 43415, 11, 9793, 285, 1470, 6572, 9793, 329, 32809, 74242, 7604, 5499, 53577, 32809, 14668, 13, 1602, 2685, 10603, 53577, 32809, 14668, 488, 197, 548, 198, 33222, 33188, 84925, 2765, 268, 8129, 3046, 44323, 52060, 2765, 56407, 13, 1602, 791, 1942, 373, 20501, 43908, 44323, 17886, 25384, 198, 1527, 2157, 2823, 76991, 13, 197, 2127, 61124, 710, 11, 2066, 8285, 1545, 11, 2157, 2094, 71275, 1942, 875, 53577, 16868, 3385, 197, 1729, 198, 8723, 6253, 32809, 87, 1354, 13, 197, 27131, 7604, 10603, 53577, 32809, 14668, 488, 197, 936, 985, 1470, 6572, 32809, 2157, 278, 1723, 345, 19041, 20501, 73204, 2765, 56407, 76241, 197, 9274, 18895, 676, 30, 197, 10493, 77, 1431, 64442, 74242, 268, 197, 782, 1055, 32809, 197, 1593, 2765, 56407, 30, 197, 2575, 11, 18895, 676, 20501, 11575, 198, 37605, 1186, 5739, 64442, 38303, 3688, 32809, 2765, 56407, 13, 197, 1163, 8535, 18895, 676, 56597, 17886, 80557, 8285, 87728, 198, 5957, 455, 44323, 9215, 4688, 197, 32056, 82, 17886, 33188, 36502, 11, 197, 8370, 36547, 9793, 1108, 261, 197, 43664, 2282, 52521, 32809, 14668, 13, 71267, 198, 723, 684, 11, 18895, 676, 59451, 698, 2392, 33188, 36502, 44323, 1470, 7770, 9215, 332, 32930, 11, 9753, 287, 17886, 7604, 10603, 627, 626, 676, 20501, 11575, 38303, 1356, 4936, 32809, 2765, 56407, 11, 2282, 332, 197, 3323, 197, 1729, 8285, 1911, 287, 24263, 726, 197, 20322, 33188, 198, 5581, 2765, 268, 8129, 3046, 44323, 52060, 2765, 56407, 25, 7604, 10603, 53577, 32809, 14668, 488, 627, 2685, 10603, 53577, 32809, 14668, 488, 11, 38113, 30920, 44323, 33188, 404, 197, 1593, 11, 17886, 76562, 398, 197, 5807, 5386, 198, 1820, 7679, 287, 44323, 1470, 6572, 11, 2157, 1802, 11575, 99905, 18895, 3228, 1570, 2157, 461, 5306, 94007, 32809, 197, 16219, 287, 198, 64, 2765, 72, 3326, 437, 481, 2765, 56407, 13, 197, 1383, 33188, 22724, 197, 9514, 197, 20871, 11575, 2765, 72, 3326, 437, 481, 2765, 56407, 197, 7, 49864, 198, 906, 3207, 3324, 30855, 197, 9274, 33188, 84925, 1470, 820, 11, 52060, 2431, 552, 11, 1470, 11967, 82266, 197, 18207, 2765, 56407, 705, 197, 9514, 198, 19553, 197, 55540, 74242, 268, 197, 2118, 82, 875, 863, 2066, 11575, 17972, 22724, 13, 197, 2675, 9793, 525, 1942, 2084, 291, 82948, 1409, 47087, 1299, 198, 43965, 43827, 7604, 10603, 53577, 32809, 14668, 488, 64442, 1470, 6572, 197, 20322, 412, 14862, 414, 36502, 197, 548, 198, 14991, 1723, 287, 13, 197, 2675, 1602, 548, 1602, 82, 875, 17972, 64334, 197, 9514, 1602, 456, 1602, 82, 875, 13, 197, 1383, 33188, 22724, 1942, 1631, 52273, 198, 548, 197, 8723, 2041, 11, 47087, 1299, 2157, 278, 1723, 64355, 2282, 52521, 6831, 3422, 21376, 11, 47087, 4791, 33001, 198, 44410, 9793, 525, 74242, 268, 35697, 87054, 53577, 33188, 41393, 292, 197, 43415, 811, 197, 548, 33188, 198, 24738, 52273, 13, 197, 29690, 64442, 2765, 56407, 2765, 7217, 98366, 197, 4345, 84728, 398, 9793, 64860, 11, 197, 4908, 11575, 198, 98874, 635, 1186, 17157, 14294, 44323, 33188, 1942, 8050, 13, 197, 14884, 11, 98366, 2765, 56407, 11, 20501, 33188, 9215, 4688, 25277, 44323, 9793, 7282, 198, 93772, 11, 2282, 332, 2066, 51210, 2090, 59574, 20501, 7883, 6539, 61280, 197, 906, 197, 4151, 52060, 33188, 2765, 56407, 197, 20019, 71275, 627, 29012, 52273, 17904, 388, 355, 33188, 197, 4054, 11198, 56407, 198, 8140, 1942, 6180, 753, 20725, 197, 8154, 10276, 44323, 2765, 56407, 20501, 2282, 1503, 25653, 33188, 38303, 1512, 44323, 198, 24738, 80797, 2508, 13, 7721, 1631, 80797, 2508, 1602, 285, 197, 9274, 1186, 87595, 25653, 11, 197, 1748, 7922, 53577, 1470, 7747, 4954, 198, 24738, 52273, 49525, 197, 1605, 197, 5880, 11, 33188, 7883, 41027, 197, 8723, 2041, 197, 1729, 2765, 56407, 13, 71267, 2090, 2157, 4992, 345, 3055, 12816, 1942, 455, 3950, 398, 94036, 2765, 18780, 6629, 197, 606, 2765, 56407, 43827, 197, 43063, 13, 13083, 6769, 33188, 198, 306, 556, 1919, 44323, 43328, 944, 197, 83543, 53577, 7883, 1225, 1626, 197, 906, 9793, 525, 197, 2099, 197, 12964, 291, 197, 9274, 2765, 56407, 198, 285, 2282, 1503, 25653, 1942, 1631, 80797, 2508, 11, 33188, 38303, 1512, 44323, 197, 3323, 197, 606, 2765, 56407, 2157, 352, 85786, 336, 198, 359, 10543, 2915, 1942, 6517, 4633, 13, 197, 53692, 33188, 1942, 1631, 80797, 2508, 38303, 1512, 20501, 33188, 1186, 20510, 291, 197, 606, 627, 29012, 80797, 2508, 20501, 2282, 1503, 25653, 11575, 1186, 1263, 44186, 2157, 285, 444, 1010, 11, 197, 606, 9793, 789, 197, 1729, 198, 48481, 1870, 52060, 197, 69216, 197, 34500, 1392, 17886, 17749, 478, 944, 1942, 6180, 13, 33026, 2157, 285, 444, 1010, 20501, 198, 9210, 71579, 40137, 44323, 2765, 18780, 2765, 1082, 2315, 8285, 380, 11, 7883, 613, 48048, 2765, 18780, 1942, 1631, 52273, 11, 197, 936, 4881, 198, 438, 3324, 1244, 1392, 13, 41065, 2157, 285, 444, 1010, 18895, 12116, 43827, 33188, 197, 35676, 2765, 18780, 197, 2336, 64442, 198, 37791, 94036, 2157, 278, 1723, 11, 53577, 197, 19041, 1348, 33188, 71579, 40137, 44323, 2765, 18780, 1942, 1631, 52273, 64442, 198, 4919, 74242, 197, 8723, 2041, 13, 33026, 43328, 944, 197, 69216, 3324, 35320, 44323, 197, 60301, 52060, 2765, 56407, 1186, 3466, 288, 25653, 198, 1820, 197, 43573, 44323, 197, 45010, 1942, 1631, 52273, 197, 31524, 7883, 41027, 44323, 2765, 56407, 705, 7145, 1894, 197, 54895, 198, 40895, 16252, 33188, 197, 936, 4881, 11, 197, 8370, 197, 548, 7604, 10603, 53577, 32809, 14668, 488, 13, 10230, 68, 1184, 197, 548, 3324, 820, 32809, 3324, 731, 198, 1354, 24292, 32809, 197, 26174, 33188, 404, 2282, 4659, 1942, 8734, 7145, 1894, 197, 54895, 197, 40895, 16252, 33188, 404, 2765, 72, 16629, 11, 82266, 32809, 198, 23609, 2765, 72, 554, 13024, 32809, 3324, 1244, 33188, 404, 9793, 1100, 531, 2711, 7145, 1894, 197, 54895, 197, 8416, 4954, 33188, 404, 2282, 4659, 198, 47074, 13, 197, 7009, 197, 548, 3324, 820, 32809, 9793, 525, 11575, 2282, 51011, 197, 9446, 7145, 1894, 197, 54895, 17643, 3078, 287, 33188, 404, 18207, 2765, 56407, 82266, 32809, 197, 8154, 3427, 197, 2464, 42811, 7145, 1894, 197, 54895, 197, 383, 6260, 33188, 404, 1470, 11967, 627, 22427, 50915, 197, 1729, 1942, 1631, 52273, 20501, 33188, 54414, 197, 1729, 197, 8370, 43328, 944, 197, 83543, 3253, 1924, 7883, 613, 198, 13727, 44323, 1942, 1631, 52273, 11575, 73972, 24553, 11870, 13, 9391, 92001, 197, 5182, 1942, 1631, 52273, 61551, 198, 268, 11288, 11, 53577, 197, 42305, 9818, 197, 548, 26665, 2692, 32809, 197, 40895, 3357, 197, 49818, 11, 7883, 1055, 748, 64442, 50394, 598, 198, 351, 2542, 3210, 197, 395, 957, 287, 33188, 36502, 48048, 2765, 4091, 788, 32809, 87, 1354, 11, 7145, 2836, 367, 82266, 17886, 78134, 198, 82, 85392, 13, 7721, 1631, 80797, 2508, 197, 99470, 33188, 197, 69216, 197, 97235, 32809, 197, 7349, 36547, 1942, 1631, 52273, 198, 485, 65023, 1870, 11, 197, 8629, 553, 197, 49818, 2129, 78, 71579, 40137, 44323, 1470, 5381, 11, 30377, 197, 49818, 61551, 2765, 18780, 198, 67, 1082, 2315, 53577, 59733, 3303, 417, 3191, 11575, 20725, 398, 197, 55674, 197, 17447, 32809, 1942, 455, 1911, 197, 54719, 198, 24738, 52273, 13, 41065, 197, 16082, 613, 13008, 82, 197, 17483, 1752, 197, 24126, 488, 11, 197, 59619, 2157, 395, 535, 68950, 7713, 198, 438, 56597, 17886, 80557, 17886, 2968, 32809, 197, 30739, 48048, 2765, 56407, 17886, 11575, 2157, 5420, 287, 1285, 197, 3195, 627, 644, 26665, 952, 11, 7883, 613, 1470, 1947, 44323, 1942, 1631, 52273, 2345, 9739, 1942, 15934, 197, 2118, 67, 56407, 63750, 285, 197, 4345, 11575, 198, 64750, 8285, 4099, 44323, 2157, 278, 1723, 287, 1470, 6572, 13, 197, 11458, 11, 48048, 52060, 44323, 197, 414, 2765, 18780, 198, 9426, 44323, 1470, 6572, 11, 53577, 52060, 44323, 33188, 2765, 18780, 197, 2336, 17886, 197, 8370, 7883, 613, 47087, 94036, 2157, 278, 1723, 345, 1820, 58235, 44323, 197, 10236, 33910, 74729, 44323, 1942, 1631, 52273, 2282, 762, 20969, 5306, 561, 13, 71267, 197, 1605, 197, 5880, 345, 9493, 1470, 6572, 2157, 278, 1723, 11, 197, 906, 2157, 352, 1186, 96551, 1942, 875, 17886, 197, 35676, 2765, 18780, 197, 2336, 627, 21526, 64442, 197, 548, 2157, 278, 1723, 287, 2282, 6769, 44323, 11575, 5306, 76652, 6391, 7604, 10603, 8285, 66917, 198, 64750, 1942, 1631, 52273, 197, 54895, 197, 54719, 2157, 278, 1723, 287, 2282, 6769, 44323, 11575, 21499, 2910, 7604, 10603, 627, 21526, 2157, 278, 1723, 287, 2282, 6769, 44323, 197, 27152, 32809, 14668, 488, 8285, 66917, 2765, 18780, 1942, 1631, 52273, 43827, 198, 54719, 2157, 278, 1723, 287, 2282, 6769, 44323, 197, 1195, 26533, 32809, 14668, 488, 13, 197, 73741, 33910, 74729, 44323, 198, 755, 43690, 53577, 32809, 14668, 1385, 197, 98374, 11575, 13938, 47639, 44323, 197, 24126, 1942, 1631, 52273, 197, 25364, 40137, 44323, 198, 2118, 67, 1082, 2315, 56955, 2282, 332, 33188, 1942, 1631, 52273, 197, 548, 98366, 17643, 8532, 13, 197, 1271, 1942, 4035, 197, 3852, 197, 35686, 11, 197, 9514, 9793, 525, 198, 998, 64302, 33188, 197, 936, 4881, 11, 98366, 33188, 1942, 1631, 52273, 627, 49552, 197, 83543, 11, 197, 1729, 197, 49033, 33188, 1186, 3466, 25653, 1942, 1631, 52273, 11, 64355, 14862, 295, 32809, 197, 16219, 197, 3852, 198, 94304, 38113, 29510, 33188, 197, 37195, 2282, 10259, 197, 12393, 53577, 2765, 56407, 13, 9391, 92001, 197, 95373, 36547, 198, 45010, 61551, 748, 197, 20670, 197, 548, 3324, 1146, 2765, 18780, 18895, 988, 11, 5329, 197, 12393, 53577, 2765, 56407, 197, 548, 17643, 750, 198, 64750, 1942, 3422, 44323, 33188, 1942, 373, 197, 7307, 17886, 11575, 4882, 18007, 37296, 18148, 197, 22025, 21066, 13, 15420, 9162, 11575, 198, 652, 37119, 33188, 683, 11, 197, 42305, 9818, 9793, 525, 73204, 1186, 5914, 17886 ]
0xBreath/holistic-books
primitives of deficient foods develop in general the same facial and dental arch deformities and skeletal defects. Note the characteristic narrowing of the dental arches and crowding of the teeth of this modernized generation of Aborigines and their similarity to the facial patterns of modern whites. FIG. 56. The disturbance in facial growth is often so serious as to make normal breathing through the nose very difficult. This is primarily due to faulty development of the maxillary bones. 7/29/13 Nutrition and Physical Degeneration gutenberg.net.au/ebooks02/0200251h.html#toc 109/250FIG. 57. Deformity patterns produced in the modernized Aborigines of Australia by white men's food. Note the undershot mandible, upper left, the pinched nostrils and facial deformity of all four. The data obtained from a study of the native Australians who are located in a reservation near Sydney, at LeParouse, revealed that among the Aborigines 47.5 per cent of the teeth had been attacked by dental caries, and 40 per cent of the individuals had abnormal dental arches. For the women of this group, 81.3 per cent of all the teeth had been attacked by dental caries, and for the men, 60.4 per cent, and for the children, 16.5 per cent. In this group 100 per cent of the individuals were affected by dental caries. Palm Island is a government reservation situated in the ocean about fifty miles from the mainland, off the east coast of Australia, about two-thirds of the way up the coast. It was reached by a government launch. Included in the population of this reservation are a large number of adults who have been moved from various districts on the mainland of Central and Eastern Australia and many children who were born either before or after their parents were moved to this reservation. The food available on the Island is almost entirely that provided by the government. Of ninety-eight individuals examined and measured, 53.1 per cent of them had dental caries. For the group as a whole, 8.9 per cent of all of the teeth were affected; for the women, 21.2 per cent; for the men, 14.2 per cent; and for the children, 5.8 per cent. Fifty per cent of the children had deformed dental arches, which occurred in only 11 per cent of the adults. Cape Bedford is situated about three-fourths of the way up the east coast and is so isolated that it was necessary for us to use a special aeroplane to reach it. Landing was made on the beach. This group of people is under the management of a German Lutheran missionary. They are dependent almost entirely on the food provided by the mission and the government. The official in charge had spent fifty years in devoted service to these native people. We found him exceedingly sad because of the very rapid breakdown that was in progress among the natives in his care. The dental caries for the group of eighty-three individuals studied was 12.4 per cent of their 2,176 teeth examined. For the women, this amounted to 37.2 per cent of the teeth; for the men, 8.4 per cent; and for the children, 6.1 per cent. Of the eighty-three individuals, 48.1 per cent had been affected by dental caries. Many of the adults in this group had been born on plantations under the influence of the modern nutrition, and many of the children had been born in the mission. For the adults, 46 per cent had abnormally formed dental arches, and for the children, 41.6 per cent. We were advised that deaths occurred very frequently from tuberculosis. This reservation does not provide the natives with natural hunting grounds capable of providing the people with animal life for7/29/13 Nutrition and Physical Degeneration gutenberg.net.au/ebooks02/0200251h.html#toc 110/250food. The coast for some distance inland is a series of sand dunes which are slowly being transferred over the vegetation by wind, completely smothering it. While the coast is well supplied with a variety of deep-water fish the natives have practically no equipment for obtaining them, a condition which restricts them very largely to the use of the imported foods supplied by the officials. Our next stop, using the special aeroplane, was at Lockhart River, which is about four-fifths of the way up the east coast of Australia. Here again we were able to land on the beach near a large group of primitive Aborigines. The isolation here is so nearly complete that they are dependent upon the sea and the land for their foods. This part of Australia, namely, the York Peninsula, is still so primitive that there has been very little encroachment by the white population. It will be remembered that in this area there are no roads, the country being a primitive wilderness. Of fifty- eight individuals examined, their 1,784 teeth revealed that only 4.3 per cent had been attacked by dental caries. For the women, this amounted to 3.4 per cent; for the men, 6.1 per cent; and for the children, 3.2 per cent. Some of these men had at some time worked on cattle ranches for the white men. Of the children, only 6.3 per cent had abnormal dental arches, and of the adults, 8.7 per cent. In this group, therefore, 91.4 per cent of all ages had reproduced the typical racial pattern as compared with 56 per cent of the group at Cape Bedford, 62 per cent of the group at Palm Island, and 60 per cent at LeParouse. At Lockhart River, 32.7 per cent of the individuals had dental caries. A reservation called Cowall Creek on the west side of York Peninsula situated on the Gulf of Carpenteria, was reached by flying our special plane to Horn Island in the Torres Strait north of Australia and proceeding from there by boat to Thursday Island, and on, by boat, to Cowall Creek. In this reservation thirty-five individuals were studied and found to be in a very pathetic condition. We were told that deaths occurred frequently. Of the 976 teeth examined, 24.6 per cent had been attacked by tooth decay. For the women, this amounted to 60.7 per cent; for the men, 30.4 per cent; and for the children, 8.9 per cent. Forty-nine and six-tenths per cent of the individuals studied had abnormal dental arches. Of the children 66.6 per cent had deformed dental arches, and 9 per cent of the adults. Many of these adults had been raised in the bush. Of the individuals studied, 68.6 per cent had had dental caries. One can scarcely visualize, without observing it, the distress of a group of primitive people situated as these people are, compelled to live in a very restricted area, forced to live on food provided by the government, while they are conscious that if they could return to their normal habits of life they would regain their health and again enjoy life. Many individuals were seen with abscessing teeth. One girl with a fistula exuding pus on the outside of her face is shown in Fig. 58 (upper right). In their native life where they could get the foods that keep them well and preserve their teeth, they had no need for dentists. Now they have need, but have no dentists. It is easy to chide and blame the officials who provide them with the modernized foods under which they are breaking, but it must be remembered that practically all modern civilizations are more or less in the same plight themselves.7/29/13 Nutrition and Physical Degeneration gutenberg.net.au/ebooks02/0200251h.html#toc 111/250FIG. 58. Aborigines in Australia living on a reservation. The boy at the upper left has suppurating tubercular axillary glands. The girl at the upper right has pus running to the outside of her face from an abscessed tooth. The boy whose legs are shown at the lower left has a badly deformed body from malnutrition. The girl at the lower right has tubercular glands of the neck. An opportunity was provided for examining a group of the native Aborigines of Australia who made up the crew of eighteen for a pearl-fishing boat. Of this group, 5.7 per cent of their 554 teeth had been attacked by tooth decay. These individuals could be readily divided into two groups; namely, those who had been raised in the Bush and those who had been raised in missions. For the thirteen raised in the Bush, not a single tooth of their 364 teeth had ever been attacked by tooth decay and not a single individual had deformed dental arches. In contrast with this, of the five raised in the mission, 19.3 per cent of their 140 teeth had been attacked by tooth decay and 40 per cent of these individuals had abnormal dental arches. The cook on the government boat was an aboriginal Australian from Northern Australia. He had been trained on a military craft as a dietitian. Nearly all his teeth were lost. It is of interest that
[ 72294, 315, 198, 755, 5499, 15657, 2274, 304, 4689, 279, 1890, 28900, 323, 29106, 198, 1132, 79212, 1385, 323, 69397, 42655, 13, 7181, 279, 29683, 198, 77, 6172, 287, 315, 279, 29106, 5438, 288, 323, 9460, 7113, 315, 279, 18311, 315, 198, 576, 6617, 1534, 9659, 315, 3765, 4775, 1572, 323, 872, 38723, 198, 998, 279, 28900, 12912, 315, 6617, 22632, 627, 6507, 13, 220, 3487, 13, 578, 65858, 304, 28900, 6650, 374, 3629, 779, 6129, 198, 300, 311, 1304, 4725, 27027, 1555, 279, 19689, 1633, 5107, 627, 2028, 374, 15871, 4245, 311, 58671, 4500, 315, 279, 1973, 35605, 198, 82091, 627, 22, 14, 1682, 14, 1032, 39700, 323, 28479, 58337, 17699, 198, 70, 45533, 5181, 31877, 16954, 12383, 2437, 14, 11139, 18070, 16, 71, 2628, 2, 55880, 220, 7743, 14, 5154, 6507, 13, 220, 3226, 13, 1611, 630, 488, 12912, 9124, 304, 279, 6617, 1534, 198, 5953, 4775, 1572, 315, 8494, 555, 4251, 3026, 596, 3691, 13, 7181, 279, 198, 32109, 10847, 11837, 1260, 11, 8582, 2163, 11, 279, 9160, 2454, 57426, 8839, 323, 198, 22974, 532, 79212, 488, 315, 682, 3116, 627, 262, 578, 828, 12457, 505, 264, 4007, 315, 279, 10068, 56937, 889, 527, 7559, 304, 264, 28767, 3221, 198, 35767, 19316, 11, 520, 2009, 4368, 1559, 11, 10675, 430, 4315, 279, 3765, 4775, 1572, 220, 2618, 13, 20, 824, 2960, 315, 279, 18311, 1047, 1027, 198, 1617, 11440, 555, 29106, 1841, 552, 11, 323, 220, 1272, 824, 2960, 315, 279, 7931, 1047, 35663, 29106, 5438, 288, 13, 1789, 279, 198, 65762, 315, 420, 1912, 11, 220, 5932, 13, 18, 824, 2960, 315, 682, 279, 18311, 1047, 1027, 18855, 555, 29106, 1841, 552, 11, 323, 369, 279, 198, 5794, 11, 220, 1399, 13, 19, 824, 2960, 11, 323, 369, 279, 2911, 11, 220, 845, 13, 20, 824, 2960, 13, 763, 420, 1912, 220, 1041, 824, 2960, 315, 279, 198, 55977, 82, 1051, 11754, 555, 29106, 1841, 552, 627, 262, 33578, 10951, 374, 264, 3109, 28767, 31183, 304, 279, 18435, 922, 33517, 8931, 505, 279, 198, 3902, 1974, 11, 1022, 279, 11226, 13962, 315, 8494, 11, 922, 1403, 45726, 315, 279, 1648, 709, 279, 13962, 13, 1102, 574, 8813, 198, 1729, 264, 3109, 7195, 13, 47064, 304, 279, 7187, 315, 420, 28767, 527, 264, 3544, 1396, 315, 12884, 198, 14965, 617, 1027, 7882, 505, 5370, 27536, 389, 279, 51115, 315, 10913, 323, 18516, 8494, 323, 198, 35676, 2911, 889, 1051, 9405, 3060, 1603, 477, 1306, 872, 6699, 1051, 7882, 311, 420, 28767, 627, 791, 3691, 2561, 389, 279, 10951, 374, 4661, 11622, 430, 3984, 555, 279, 3109, 13, 5046, 78976, 70815, 198, 55977, 82, 25078, 323, 17303, 11, 220, 4331, 13, 16, 824, 2960, 315, 1124, 1047, 29106, 1841, 552, 13, 1789, 279, 1912, 439, 264, 198, 67733, 11, 220, 23, 13, 24, 824, 2960, 315, 682, 315, 279, 18311, 1051, 11754, 26, 369, 279, 3278, 11, 220, 1691, 13, 17, 824, 2960, 26, 369, 279, 3026, 345, 975, 13, 17, 824, 2960, 26, 323, 369, 279, 2911, 11, 220, 20, 13, 23, 824, 2960, 13, 76020, 824, 2960, 315, 279, 2911, 1047, 409, 10365, 29106, 198, 1132, 288, 11, 902, 10222, 304, 1193, 220, 806, 824, 2960, 315, 279, 12884, 627, 262, 29715, 73768, 374, 31183, 922, 2380, 42117, 17323, 315, 279, 1648, 709, 279, 11226, 13962, 323, 374, 779, 25181, 430, 198, 275, 574, 5995, 369, 603, 311, 1005, 264, 3361, 34548, 454, 38947, 311, 5662, 433, 13, 47524, 574, 1903, 389, 279, 11573, 627, 2028, 1912, 315, 1274, 374, 1234, 279, 6373, 315, 264, 6063, 83081, 73998, 13, 2435, 527, 198, 38655, 4661, 11622, 389, 279, 3691, 3984, 555, 279, 9131, 323, 279, 3109, 13, 578, 4033, 304, 198, 14215, 1047, 7543, 33517, 1667, 304, 29329, 2532, 311, 1521, 10068, 1274, 13, 1226, 1766, 1461, 76821, 198, 83214, 1606, 315, 279, 1633, 11295, 31085, 430, 574, 304, 5208, 4315, 279, 68473, 304, 813, 2512, 13, 578, 198, 67, 6430, 1841, 552, 369, 279, 1912, 315, 80679, 49493, 7931, 20041, 574, 220, 717, 13, 19, 824, 2960, 315, 872, 220, 17, 11, 10967, 198, 668, 774, 25078, 13, 1789, 279, 3278, 11, 420, 74319, 311, 220, 1806, 13, 17, 824, 2960, 315, 279, 18311, 26, 369, 279, 3026, 11, 220, 23, 13, 19, 824, 198, 1189, 26, 323, 369, 279, 2911, 11, 220, 21, 13, 16, 824, 2960, 13, 5046, 279, 80679, 49493, 7931, 11, 220, 2166, 13, 16, 824, 2960, 1047, 1027, 198, 32157, 555, 29106, 1841, 552, 13, 9176, 315, 279, 12884, 304, 420, 1912, 1047, 1027, 9405, 389, 6136, 811, 1234, 279, 198, 258, 41116, 315, 279, 6617, 26677, 11, 323, 1690, 315, 279, 2911, 1047, 1027, 9405, 304, 279, 9131, 13, 1789, 279, 198, 68956, 82, 11, 220, 2790, 824, 2960, 1047, 671, 86336, 14454, 29106, 5438, 288, 11, 323, 369, 279, 2911, 11, 220, 3174, 13, 21, 824, 2960, 13, 1226, 198, 52898, 26160, 430, 16779, 10222, 1633, 14134, 505, 88234, 13, 1115, 28767, 1587, 539, 198, 62556, 279, 68473, 449, 5933, 23330, 21319, 13171, 315, 8405, 279, 1274, 449, 10065, 2324, 369, 22, 14, 1682, 14, 1032, 39700, 323, 28479, 58337, 17699, 198, 70, 45533, 5181, 31877, 16954, 12383, 2437, 14, 11139, 18070, 16, 71, 2628, 2, 55880, 220, 5120, 14, 5154, 14239, 13, 578, 13962, 369, 1063, 6138, 77289, 374, 264, 4101, 315, 9462, 294, 8699, 902, 527, 14297, 1694, 198, 1485, 5671, 927, 279, 54832, 555, 10160, 11, 6724, 1554, 1605, 287, 433, 13, 6104, 279, 13962, 374, 1664, 17665, 198, 4291, 264, 8205, 315, 5655, 55051, 7795, 279, 68473, 617, 32367, 912, 7241, 369, 19546, 1124, 11, 264, 198, 9233, 902, 9067, 82, 1124, 1633, 14090, 311, 279, 1005, 315, 279, 25973, 15657, 17665, 555, 279, 198, 33912, 82, 627, 262, 5751, 1828, 3009, 11, 1701, 279, 3361, 34548, 454, 38947, 11, 574, 520, 16076, 47489, 11188, 11, 902, 374, 922, 3116, 2269, 333, 17323, 315, 198, 1820, 1648, 709, 279, 11226, 13962, 315, 8494, 13, 5810, 1578, 584, 1051, 3025, 311, 4363, 389, 279, 11573, 3221, 264, 3544, 198, 4166, 315, 28694, 3765, 4775, 1572, 13, 578, 31398, 1618, 374, 779, 7154, 4686, 430, 814, 527, 18222, 198, 59723, 279, 9581, 323, 279, 4363, 369, 872, 15657, 13, 1115, 961, 315, 8494, 11, 32125, 11, 279, 4356, 50714, 11, 374, 2103, 198, 708, 28694, 430, 1070, 706, 1027, 1633, 2697, 3289, 299, 9064, 555, 279, 4251, 7187, 13, 1102, 690, 387, 198, 30380, 291, 430, 304, 420, 3158, 1070, 527, 912, 19795, 11, 279, 3224, 1694, 264, 28694, 49362, 13, 5046, 33517, 7058, 68632, 7931, 25078, 11, 872, 220, 16, 11, 22148, 18311, 10675, 430, 1193, 220, 19, 13, 18, 824, 2960, 1047, 1027, 18855, 555, 198, 67, 6430, 1841, 552, 13, 1789, 279, 3278, 11, 420, 74319, 311, 220, 18, 13, 19, 824, 2960, 26, 369, 279, 3026, 11, 220, 21, 13, 16, 824, 2960, 26, 323, 369, 279, 198, 5988, 11, 220, 18, 13, 17, 824, 2960, 13, 4427, 315, 1521, 3026, 1047, 520, 1063, 892, 6575, 389, 36952, 39161, 288, 369, 279, 4251, 198, 5794, 13, 5046, 279, 2911, 11, 1193, 220, 21, 13, 18, 824, 2960, 1047, 35663, 29106, 5438, 288, 11, 323, 315, 279, 12884, 11, 220, 23, 13, 22, 824, 198, 1189, 13, 763, 420, 1912, 11, 9093, 11, 220, 5925, 13, 19, 824, 2960, 315, 682, 17051, 1047, 55717, 279, 14595, 19739, 5497, 439, 198, 5807, 1636, 449, 220, 3487, 824, 2960, 315, 279, 1912, 520, 29715, 73768, 11, 220, 5538, 824, 2960, 315, 279, 1912, 520, 33578, 198, 3957, 1974, 11, 323, 220, 1399, 824, 2960, 520, 2009, 4368, 1559, 13, 2468, 16076, 47489, 11188, 11, 220, 843, 13, 22, 824, 2960, 315, 279, 7931, 1047, 198, 67, 6430, 1841, 552, 627, 262, 362, 28767, 2663, 22607, 543, 24076, 389, 279, 9909, 3185, 315, 4356, 50714, 31183, 389, 279, 27945, 315, 198, 34, 8035, 1992, 689, 11, 574, 8813, 555, 16706, 1057, 3361, 11277, 311, 27206, 10951, 304, 279, 55507, 83163, 10411, 315, 198, 49137, 323, 39547, 505, 1070, 555, 15688, 311, 7950, 10951, 11, 323, 389, 11, 555, 15688, 11, 311, 22607, 543, 198, 34, 10957, 13, 763, 420, 28767, 27219, 36399, 7931, 1051, 20041, 323, 1766, 311, 387, 304, 264, 1633, 67163, 198, 9233, 13, 1226, 1051, 3309, 430, 16779, 10222, 14134, 13, 5046, 279, 220, 25208, 18311, 25078, 11, 220, 1187, 13, 21, 824, 198, 1189, 1047, 1027, 18855, 555, 26588, 31815, 13, 1789, 279, 3278, 11, 420, 74319, 311, 220, 1399, 13, 22, 824, 2960, 26, 369, 279, 198, 5794, 11, 220, 966, 13, 19, 824, 2960, 26, 323, 369, 279, 2911, 11, 220, 23, 13, 24, 824, 2960, 13, 86043, 86703, 323, 4848, 2442, 306, 5104, 824, 2960, 315, 279, 198, 55977, 82, 20041, 1047, 35663, 29106, 5438, 288, 13, 5046, 279, 2911, 220, 2287, 13, 21, 824, 2960, 1047, 409, 10365, 29106, 198, 1132, 288, 11, 323, 220, 24, 824, 2960, 315, 279, 12884, 13, 9176, 315, 1521, 12884, 1047, 1027, 9408, 304, 279, 30773, 13, 5046, 279, 198, 55977, 82, 20041, 11, 220, 2614, 13, 21, 824, 2960, 1047, 1047, 29106, 1841, 552, 13, 3861, 649, 80987, 51187, 11, 2085, 198, 5598, 20073, 433, 11, 279, 35104, 315, 264, 1912, 315, 28694, 1274, 31183, 439, 1521, 1274, 527, 11, 48984, 311, 198, 25859, 304, 264, 1633, 22486, 3158, 11, 9770, 311, 3974, 389, 3691, 3984, 555, 279, 3109, 11, 1418, 814, 527, 198, 64589, 430, 422, 814, 1436, 471, 311, 872, 4725, 26870, 315, 2324, 814, 1053, 49655, 872, 2890, 323, 198, 33871, 4774, 2324, 13, 9176, 7931, 1051, 3970, 449, 3731, 1140, 287, 18311, 13, 3861, 3828, 449, 264, 40902, 5724, 506, 51867, 198, 18299, 389, 279, 4994, 315, 1077, 3663, 374, 6982, 304, 23966, 13, 220, 2970, 320, 13886, 1314, 570, 763, 872, 10068, 2324, 1405, 814, 1436, 198, 456, 279, 15657, 430, 2567, 1124, 1664, 323, 21813, 872, 18311, 11, 814, 1047, 912, 1205, 369, 18653, 1705, 13, 4800, 198, 20670, 617, 1205, 11, 719, 617, 912, 18653, 1705, 13, 1102, 374, 4228, 311, 523, 579, 323, 19065, 279, 7510, 889, 3493, 1124, 198, 4291, 279, 6617, 1534, 15657, 1234, 902, 814, 527, 15061, 11, 719, 433, 2011, 387, 27569, 430, 198, 652, 533, 2740, 682, 6617, 86569, 527, 810, 477, 2753, 304, 279, 1890, 71075, 5694, 13, 22, 14, 1682, 14, 1032, 39700, 323, 28479, 58337, 17699, 198, 70, 45533, 5181, 31877, 16954, 12383, 2437, 14, 11139, 18070, 16, 71, 2628, 2, 55880, 220, 5037, 14, 5154, 6507, 13, 220, 2970, 13, 3765, 4775, 1572, 304, 8494, 5496, 389, 264, 28767, 13, 578, 198, 17627, 520, 279, 8582, 2163, 706, 1043, 26047, 1113, 15286, 3035, 1299, 3944, 35605, 198, 70, 8329, 13, 578, 3828, 520, 279, 8582, 1314, 706, 75676, 4401, 311, 279, 198, 68090, 315, 1077, 3663, 505, 459, 3731, 1140, 291, 26588, 13, 578, 8334, 6832, 198, 73336, 527, 6982, 520, 279, 4827, 2163, 706, 264, 25587, 409, 10365, 2547, 198, 1527, 8811, 83664, 13, 578, 3828, 520, 279, 4827, 1314, 706, 15286, 3035, 1299, 198, 70, 8329, 315, 279, 13272, 627, 262, 1556, 6776, 574, 3984, 369, 38936, 264, 1912, 315, 279, 10068, 3765, 4775, 1572, 315, 8494, 889, 198, 28010, 709, 279, 13941, 315, 63134, 369, 264, 70723, 2269, 11218, 15688, 13, 5046, 420, 1912, 11, 220, 20, 13, 22, 824, 2960, 315, 872, 220, 22303, 18311, 198, 32345, 1027, 18855, 555, 26588, 31815, 13, 4314, 7931, 1436, 387, 31368, 18255, 1139, 1403, 5315, 280, 12682, 989, 11, 1884, 889, 1047, 1027, 9408, 304, 279, 14409, 323, 1884, 889, 1047, 1027, 9408, 304, 25664, 13, 1789, 279, 198, 339, 46004, 9408, 304, 279, 14409, 11, 539, 264, 3254, 26588, 315, 872, 220, 15951, 18311, 1047, 3596, 1027, 18855, 555, 26588, 198, 85599, 323, 539, 264, 3254, 3927, 1047, 409, 10365, 29106, 5438, 288, 13, 763, 13168, 449, 420, 11, 315, 279, 4330, 198, 93613, 304, 279, 9131, 11, 220, 777, 13, 18, 824, 2960, 315, 872, 220, 6860, 18311, 1047, 1027, 18855, 555, 26588, 31815, 323, 220, 1272, 198, 716, 2960, 315, 1521, 7931, 1047, 35663, 29106, 5438, 288, 627, 262, 578, 4394, 389, 279, 3109, 15688, 574, 459, 671, 10090, 13673, 505, 17355, 8494, 13, 1283, 1047, 198, 82850, 16572, 389, 264, 6411, 11003, 439, 264, 10173, 79544, 13, 49669, 682, 813, 18311, 1051, 5675, 13, 1102, 374, 315, 2802, 430 ]
0xBreath/holistic-books
apha. Kapha dosha is slow. Slow eaters, who usually have slow digestion, are generally Kapha types, as are slow speakers, particularly if their speaking manner is deliberate. Being calm and self-contained, Kapha types are slow to anger and want to maintain peace around themselves. Their natural response to the world is through taste and smell—Kaphas tend to place agreat deal of importance on food; in a more general way, they rely on bodily feelings, being essentially earthy people. Kaphas have steady energy. Their stamina exceeds that of other types, as does their willingness to perform physical labor. They are rarely drained by physical fatigue. It is very Kapha to store and save almost everything— money, possessions, energy, words, food, and fat. The fat is usually stored lower down, in the thighs and buttocks. Because this dosha controls the moist tissues of the body, a Kapha imbalance will tend to show up in the mucous membranes. Kaphas complain of sinus congestion, chest colds, allergies, asthma, and painful joints (although arthritis is typically Vata-related). These symptoms are worst in late winter and spring. By nature Kaphas are affectionate, tolerant, and forgiving; to be motherly is to express Kapha. Kaphas are not easily shaken in a crisis, and they anchor others around them. There is a tendency to be complacent, however, and even the most balanced Kapha will procrastinate if he feels stressed. The typical Kapha negative emotion is greed or overattachment. Anyone who cannot bear to throw out old things is expressing an excess of Kapha. When out of balance, Kapha types become stubborn, dull, lethar gic, and lazy. Along with Vata, Kapha is a cold dosha, but it differs from Vata in not being dry. Since their circulation is generally good, Kapha types do not complain of cold hands and feet. They dislike cold, damp weather and respond to it mentally by becoming slower or outright depressed. Kapha sleep is long and heavy. Typical Kaphas often sleep more than eight hours a night; their common sleep disorder is not insomnia but oversleep. After taking a long time to get started in the morning, they feel energetic until late at night. Of the three doshas, Kaphas are the slowest learners, but, in compensation, they have good retention and in time acquire a solid command of their subject. They absorb new information slowly and take amethodical approach to it. Out of balance, they become dull and thickheaded. The basic caution for Kapha types is to progress. Any stagnant situation turns Kapha stability into inertia—Kapha types need to make sure that they do not hold on to the past, cling to people and possessions, or balk at change. Making sure that they have a good deal of stimulation, though not natural to many Kaphas, brings out their vitality; heavy, cold food, lack of exercise, overeating, and repeti tive work do not. Kapha dosha gives us a sense of inner security and steadiness, an essential aspect of a healthy person. UNDERST ANDING A TWO-DOSHA TYPE Everyone is endowed at birth with some of each dosha. What makes it possible to describe “pure” Vatas, Pittas, or Kaphas is that they have so much of one dosha—they are extremes. This is not true of most people, however. Most people are two-dosha types, with one dosha predominant but not extreme. The minority who are single-dosha types are fortunate in a sense, because they have to pay attention to only one dominant factor in their lives. However, this advantage is minor. Everyone needs to balance all three doshas. Although you will naturally pay closest attention to your own body type, being familiar with all the doshas makes a lot of sense. The best way to think of any body type is that all three doshas are expressing themselves, but one or two get the lion’ s share of attention. In brief, the telltale signs of the three pure body types are: Vata: Thin body, quick, changeable mind, vivacious manner. These people strike others as unpredictable. Under pressur e they grow excited and anxious.Pitta: Medium body, orderly and decisive mind, forceful manner. These people strike others as intense. Under pressur e they become angry and abrupt. Kapha: Heavyset body, calm, steady mind, easygoing manner. These people strike others as r elaxed. Under pr essur e they balk and gr ow silent. You can couple these sets of characteristics and arrive at a good approximation of what a two-dosha person is like. A Vata-Kapha, for instance, can be both excitable and calm, a seemingly unlikely combination that is quite obvious in these people. The dominant dosha gives a person his primary reaction s to the world, both physical and mental. The second dosha exerts its influence in various ways—but as a rule the two do not blend like colors of paint. If you combin e Vata, which produces a thin build, with Kapha, which produces a heavy build, you do not generally get a medium build (a medium build is distin ctly Pitta). What actually happens is that a Vata-Kapha type shows one trait or the other. Even so, there are times when a person is clearly alternating from one dosha to the other (a Pitta-V ata may tend toward both fear and anger under stress, either together or at different times). In Ayurvedic practice, we have observed the following things about two- dosha types, which may help you to gain a better understanding of how the three doshas combine. VATA-PITT A Generally these people are thin in build like the pure Vata type. Like their Vata counterpar ts, they are quick-moving, friendly, and talkative, but they tend to be more enterprising and sharper of intellect (both Pitta traits). They are less likely to approach the extremes of Vatas—they are not as high- strung or physically fragile and/or irregular. Their constitution gains overall stability from the influence of Pitta. Generally they also have stronger digestion than Vata types and greater tolerance for cold, since Pitta improves the circulation. Pure Vata types, who are extremely sensitive totheir environment, often become prey to their intolerance of noise, cold drafts, and physical discomfort, but this is less true of Vata-Pittas. PITT A-VATA People with this body type tend to have a medium build; they are stronger and more muscular than Vata-Pittas, who come closer to the sinewy, bony physique of pure Vatas. Pitta-V atas are quick in their movements, have good stamina, and are often assertive. Pitta intensity is obvious in them. Vata’s lightnes s is present, but less so. They have stronger digestion and more regular elimination than Vata-Pittas or Vatas. They welcome challenge and tackle problems enthusiastically and often aggressively. Vata-Pitta and Pitta-V ata types may experience a tendency toward both fear and anger, the negative emotions of the two doshas. If they are out of balance and under stress, this combination makes them tense, hard-driven, and insecure. If there is an Ayurvedic type who exhibits the Type A behavior that cardiologists warn against, it would be the imbalanced Pitta-V ata, with Vata-Pitta a hair ’s-breadth behind. PITT A-KAPHA Kapha is such a strong structural element that it lends its thick, heavier physique to two-dosha types, even when it does not come first. Pitta- Kaphas are generally recognizable because they have Pitta intensity in their manner and a solid Kapha body. They are more muscular than Pitta-V atas and may even be quite bulky. Their personalities may demons trate Kapha stability but Pitta force, complete with a tendency toward anger and criticism, is usually far more evident than anything like Kapha serenity. This is a partic ularly good body type for athletes since it gives Pitta’ s energy and drive to Kapha’ s endurance. This type finds it hard to miss a meal. The combination of strong Pitta digestion and Kapha resistance generally gives excellent physical health.KAPHA-PITT A The structural solidity of Kapha will come out even more in this type. Kapha-Pittas tend to have good musculature but with a higher ratio of fat than Pitta-Kapha s or Pittas. They tend to look rounder in face and body as a result. They tend to move slower and be more relaxed than Pitta-Kaphas; their added Kapha gives even more stamina and steady energy. They feel good if they exercise regularly, offsetting Kapha’ s tendency toward inertia and dullness, but they are less motivated to be active than are Pitta-Kaphas. VATA-KAPHA This type often has quite a hard time identifying itself
[ 1366, 64, 627, 42, 1366, 64, 8924, 4317, 374, 6435, 13, 39247, 8343, 388, 11, 889, 6118, 617, 6435, 74502, 11, 527, 198, 7642, 750, 735, 1366, 64, 220, 4595, 11, 439, 527, 6435, 22032, 11, 8104, 422, 872, 12365, 198, 76, 4992, 374, 46072, 13, 21347, 19858, 323, 659, 96324, 11, 735, 1366, 64, 4595, 527, 6435, 198, 998, 19788, 220, 323, 1390, 311, 10519, 220, 9096, 2212, 5694, 13, 11205, 5933, 198, 2376, 311, 279, 1917, 374, 1555, 12945, 323, 22843, 2345, 42, 1366, 300, 8541, 311, 2035, 945, 1244, 3568, 315, 12939, 389, 3691, 26, 304, 264, 810, 4689, 1648, 11, 814, 17631, 389, 48131, 198, 57676, 826, 11, 1694, 16168, 9578, 88, 1274, 627, 42, 1366, 300, 617, 24981, 4907, 13, 11205, 61784, 36375, 430, 315, 1023, 220, 4595, 11, 439, 198, 28156, 872, 39375, 311, 2804, 7106, 9511, 662, 2435, 527, 19029, 220, 61508, 555, 198, 47692, 36709, 13, 1102, 374, 1633, 735, 1366, 64, 311, 3637, 323, 3665, 4661, 4395, 2345, 198, 29359, 1174, 53635, 11, 4907, 11, 4339, 11, 3691, 11, 323, 8834, 13, 578, 8834, 374, 6118, 9967, 198, 15115, 1523, 11, 304, 279, 60611, 323, 98035, 14895, 627, 18433, 420, 8924, 4317, 11835, 279, 21147, 39881, 315, 279, 2547, 1174, 264, 735, 1366, 64, 198, 21495, 5085, 690, 8541, 311, 1501, 709, 304, 279, 65104, 788, 79348, 13, 735, 1366, 300, 198, 884, 21435, 315, 76914, 55146, 11, 15489, 9439, 82, 11, 58742, 11, 51643, 11, 323, 26175, 198, 73, 14737, 320, 37241, 55652, 374, 11383, 650, 460, 14228, 570, 4314, 13803, 527, 198, 50810, 267, 304, 3389, 12688, 323, 10683, 627, 1383, 7138, 735, 1366, 300, 527, 37805, 349, 11, 74582, 11, 323, 93441, 26, 311, 387, 6691, 398, 198, 285, 311, 3237, 735, 1366, 64, 13, 735, 1366, 300, 527, 539, 6847, 66900, 304, 264, 11501, 11, 323, 814, 198, 17547, 3885, 2212, 1124, 13, 2684, 374, 264, 31954, 311, 387, 4684, 18680, 11, 4869, 13801, 438, 1524, 279, 1455, 24770, 735, 1366, 64, 690, 97544, 3357, 422, 568, 11321, 32647, 627, 791, 14595, 735, 1366, 64, 8389, 20356, 374, 56926, 477, 927, 22751, 13, 33634, 198, 14965, 4250, 11984, 311, 2571, 704, 2362, 2574, 374, 37810, 459, 13937, 315, 735, 1366, 64, 627, 4599, 704, 315, 8335, 11, 735, 1366, 64, 4595, 3719, 52496, 11, 41630, 11, 98522, 277, 342, 292, 11, 323, 198, 50113, 627, 50909, 449, 650, 460, 11, 735, 1366, 64, 374, 264, 9439, 8924, 4317, 11, 719, 433, 44642, 505, 650, 460, 304, 539, 198, 35214, 9235, 13, 8876, 872, 35855, 374, 8965, 1695, 11, 735, 1366, 64, 4595, 656, 539, 198, 884, 21435, 315, 9439, 6206, 323, 7693, 13, 2435, 48969, 9439, 11, 41369, 9282, 323, 198, 6961, 311, 433, 34325, 555, 10671, 29493, 477, 40228, 42642, 13, 735, 1366, 64, 198, 26894, 374, 1317, 323, 8987, 662, 74025, 220, 735, 1366, 300, 3629, 6212, 810, 1109, 8223, 4207, 264, 198, 9471, 26, 872, 4279, 6212, 19823, 374, 539, 83511, 719, 17918, 3583, 13, 4740, 198, 89894, 264, 1317, 892, 311, 636, 3940, 304, 279, 6693, 11, 814, 2733, 45955, 3156, 3389, 198, 266, 3814, 627, 2173, 279, 2380, 8924, 4752, 11, 735, 1366, 300, 527, 279, 6435, 478, 53243, 11, 719, 11, 304, 198, 5807, 42725, 11, 814, 617, 1695, 220, 38231, 323, 304, 892, 21953, 264, 6573, 198, 5749, 315, 872, 3917, 13, 2435, 35406, 502, 2038, 14297, 323, 1935, 1097, 1086, 950, 5603, 311, 433, 13, 4470, 315, 8335, 11, 814, 3719, 41630, 323, 198, 339, 875, 63600, 627, 791, 6913, 28930, 369, 735, 1366, 64, 4595, 374, 311, 5208, 13, 5884, 97043, 6671, 198, 413, 82, 735, 1366, 64, 20334, 1139, 78552, 2345, 42, 1366, 64, 4595, 1205, 311, 1304, 2771, 430, 814, 198, 3055, 539, 3412, 389, 311, 279, 3347, 11, 78264, 311, 1274, 323, 53635, 1174, 477, 93082, 520, 198, 3455, 13, 25274, 220, 2771, 430, 814, 617, 264, 1695, 3568, 315, 41959, 11, 3582, 539, 198, 53980, 311, 1690, 735, 1366, 300, 11, 12716, 704, 872, 75716, 26, 8987, 1174, 9439, 3691, 11, 6996, 315, 198, 64562, 11, 927, 91955, 11, 323, 27427, 72, 259, 535, 990, 656, 539, 13, 735, 1366, 64, 8924, 4317, 220, 6835, 603, 264, 198, 98935, 315, 9358, 4868, 323, 17269, 1918, 11, 459, 7718, 13189, 315, 264, 9498, 198, 9164, 627, 82491, 790, 3651, 1753, 362, 47358, 9607, 3204, 17455, 220, 12736, 198, 34124, 374, 98728, 520, 7342, 449, 1063, 315, 1855, 8924, 4317, 13, 3639, 3727, 433, 198, 10236, 311, 7664, 1054, 52833, 863, 650, 19907, 11, 21823, 300, 11, 477, 735, 1366, 300, 374, 430, 814, 617, 779, 198, 59178, 315, 832, 8924, 4317, 71201, 527, 69971, 13, 1115, 374, 539, 837, 315, 1455, 1274, 345, 98936, 662, 7648, 1274, 527, 1403, 1773, 437, 4317, 4595, 11, 449, 832, 8924, 4317, 96531, 719, 198, 1962, 14560, 627, 791, 23413, 889, 527, 3254, 1773, 437, 4317, 4595, 527, 40510, 304, 264, 5647, 11, 1606, 198, 20670, 617, 311, 2343, 6666, 311, 1193, 832, 25462, 8331, 304, 872, 6439, 627, 11458, 1174, 420, 9610, 374, 9099, 13, 22172, 3966, 220, 311, 8335, 682, 2380, 198, 41625, 4752, 13, 10541, 499, 690, 18182, 2343, 18585, 6666, 311, 701, 1866, 2547, 198, 1337, 11, 1694, 11537, 449, 682, 279, 8924, 4752, 3727, 264, 2763, 315, 5647, 13, 578, 1888, 1648, 198, 998, 1781, 315, 904, 2547, 955, 374, 430, 682, 2380, 8924, 4752, 527, 37810, 5694, 345, 8248, 832, 477, 1403, 636, 279, 40132, 529, 274, 4430, 315, 6666, 627, 644, 10015, 11, 279, 3371, 83, 1604, 12195, 315, 279, 2380, 10748, 2547, 4595, 527, 512, 53, 460, 25, 70722, 2547, 1174, 4062, 11, 2349, 481, 4059, 11, 18434, 19995, 11827, 662, 4314, 1274, 198, 74104, 3885, 439, 50235, 13, 9636, 3577, 324, 384, 814, 3139, 12304, 323, 198, 276, 30351, 1087, 46124, 25, 25352, 2547, 1174, 85869, 323, 51391, 4059, 11, 5457, 1285, 11827, 662, 4314, 198, 16455, 13471, 3885, 439, 19428, 13, 9636, 3577, 324, 384, 814, 3719, 19021, 323, 198, 370, 6722, 627, 42, 1366, 64, 25, 29201, 751, 2547, 1174, 19858, 11, 24981, 4059, 11, 4228, 9738, 11827, 662, 4314, 1274, 198, 74104, 3885, 439, 436, 658, 52551, 13, 9636, 550, 4043, 324, 384, 814, 93082, 323, 1099, 15941, 21737, 627, 2675, 649, 5743, 1521, 7437, 315, 17910, 323, 17782, 520, 264, 1695, 198, 49153, 5582, 315, 1148, 264, 1403, 1773, 437, 4317, 1732, 374, 1093, 13, 362, 650, 460, 16222, 1366, 64, 11, 369, 198, 4956, 11, 649, 387, 2225, 3521, 15729, 323, 19858, 11, 264, 23490, 17821, 10824, 198, 9210, 374, 5115, 8196, 304, 1521, 1274, 13, 578, 25462, 8924, 4317, 6835, 264, 1732, 813, 198, 6682, 13010, 274, 311, 279, 1917, 11, 2225, 7106, 323, 10723, 13, 578, 2132, 8924, 4317, 198, 327, 15916, 1202, 10383, 304, 5370, 5627, 38542, 439, 264, 6037, 279, 1403, 656, 539, 20955, 1093, 198, 21712, 315, 6308, 13, 220, 1442, 499, 68225, 384, 650, 460, 11, 902, 19159, 264, 15792, 1977, 11, 449, 198, 42, 1366, 64, 11, 902, 19159, 264, 8987, 1977, 11, 499, 656, 539, 8965, 636, 264, 11298, 198, 5957, 320, 64, 11298, 220, 1977, 374, 1612, 258, 20864, 398, 21823, 64, 570, 3639, 3604, 8741, 374, 430, 264, 198, 53, 460, 16222, 1366, 64, 955, 5039, 832, 18027, 477, 279, 1023, 662, 7570, 779, 11, 1070, 527, 3115, 994, 198, 64, 1732, 374, 9539, 73462, 505, 832, 8924, 4317, 311, 279, 1023, 320, 64, 21823, 64, 20198, 74576, 1253, 198, 83, 408, 9017, 2225, 8850, 323, 19788, 220, 1234, 8631, 11, 3060, 3871, 477, 520, 2204, 198, 15487, 4390, 644, 24852, 80627, 292, 6725, 11, 584, 617, 13468, 279, 2768, 2574, 922, 1403, 7058, 41625, 4317, 4595, 11, 902, 1253, 1520, 499, 311, 8895, 264, 2731, 8830, 315, 1268, 279, 198, 28956, 8924, 4752, 16343, 627, 53, 4586, 9483, 44206, 362, 198, 77641, 1521, 1274, 527, 15792, 304, 1977, 1093, 279, 10748, 650, 460, 955, 13, 9086, 872, 198, 53, 460, 5663, 1768, 10814, 11, 814, 527, 4062, 86572, 11, 11919, 1174, 323, 3137, 1413, 11, 719, 814, 198, 83, 408, 311, 387, 810, 3810, 34754, 323, 96569, 315, 17108, 320, 21704, 21823, 64, 25022, 570, 2435, 198, 548, 2753, 4461, 311, 5603, 279, 69971, 315, 650, 19907, 71201, 527, 539, 439, 1579, 7058, 496, 2234, 477, 22655, 45350, 323, 5255, 42408, 662, 11205, 16812, 20192, 8244, 198, 267, 2968, 505, 279, 10383, 315, 21823, 64, 13, 44493, 814, 1101, 617, 16643, 198, 37439, 290, 1109, 650, 460, 4595, 323, 7191, 25065, 369, 9439, 11, 2533, 21823, 64, 198, 318, 782, 2396, 279, 35855, 13, 30688, 650, 460, 4595, 11, 889, 527, 9193, 16614, 311, 50828, 4676, 11, 3629, 3719, 37693, 311, 872, 75431, 315, 12248, 11, 9439, 198, 46097, 82, 11, 323, 7106, 44776, 11, 719, 420, 374, 2753, 837, 315, 650, 460, 9483, 1468, 300, 627, 47, 44206, 362, 20198, 4586, 198, 16298, 449, 420, 2547, 955, 8541, 311, 617, 264, 11298, 1977, 26, 814, 527, 198, 4620, 261, 323, 810, 52192, 1109, 650, 460, 9483, 1468, 300, 11, 889, 2586, 12401, 311, 279, 198, 16319, 365, 88, 1174, 293, 3633, 64441, 315, 10748, 650, 19907, 13, 21823, 64, 20198, 88518, 527, 4062, 304, 872, 198, 31061, 3808, 11, 617, 1695, 61784, 1174, 323, 527, 3629, 2105, 535, 13, 21823, 64, 21261, 374, 198, 677, 2528, 304, 1124, 13, 650, 460, 753, 3177, 4978, 274, 374, 3118, 11, 719, 2753, 779, 13, 2435, 617, 16643, 198, 37439, 290, 323, 810, 5912, 44032, 1109, 650, 460, 9483, 1468, 300, 477, 650, 19907, 13, 2435, 198, 35184, 8815, 323, 22118, 5435, 99325, 323, 3629, 198, 351, 2542, 3210, 16853, 53, 460, 9483, 46124, 323, 21823, 64, 20198, 74576, 4595, 1253, 3217, 264, 31954, 9017, 2225, 198, 69, 686, 323, 19788, 1174, 279, 8389, 21958, 315, 279, 1403, 8924, 4752, 13, 1442, 814, 527, 704, 315, 198, 22298, 323, 1234, 8631, 11, 420, 10824, 3727, 1124, 43787, 11, 2653, 32505, 345, 438, 62945, 13, 1442, 1070, 374, 459, 24852, 80627, 292, 955, 889, 50829, 279, 4078, 362, 7865, 198, 9210, 73151, 22012, 8985, 2403, 11, 433, 1053, 387, 279, 737, 59502, 21823, 64, 20198, 74576, 11, 449, 198, 53, 460, 9483, 46124, 264, 7013, 18217, 82, 1481, 888, 339, 4920, 627, 47, 44206, 362, 16222, 2599, 17455, 198, 42, 1366, 64, 374, 1778, 264, 3831, 24693, 2449, 430, 433, 79018, 1202, 12314, 1174, 44922, 198, 42305, 2428, 311, 1403, 1773, 437, 4317, 4595, 11, 1524, 994, 433, 1587, 539, 2586, 1176, 13, 21823, 64, 7058, 42, 1366, 300, 527, 8965, 66352, 1606, 814, 617, 21823, 64, 21261, 304, 872, 198, 76, 4992, 323, 264, 6573, 735, 1366, 64, 2547, 662, 2435, 527, 810, 52192, 1109, 21823, 64, 20198, 88518, 198, 438, 1253, 1524, 387, 5115, 78921, 662, 11205, 44908, 1253, 45075, 490, 349, 735, 1366, 64, 198, 267, 2968, 719, 21823, 64, 5457, 11, 4686, 449, 264, 31954, 9017, 19788, 323, 198, 38096, 42914, 11, 374, 6118, 3117, 810, 30576, 1109, 4205, 1093, 735, 1366, 64, 1446, 56685, 16853, 2028, 374, 264, 2598, 220, 1299, 398, 1695, 2547, 955, 369, 23579, 2533, 433, 6835, 21823, 64, 529, 274, 198, 17947, 323, 6678, 311, 735, 1366, 64, 529, 274, 49286, 13, 1115, 955, 14035, 433, 2653, 311, 3194, 264, 198, 42880, 13, 578, 10824, 315, 3831, 21823, 64, 74502, 323, 735, 1366, 64, 13957, 198, 7642, 750, 6835, 9250, 7106, 2890, 11606, 2599, 17455, 9483, 44206, 362, 198, 791, 24693, 73263, 315, 735, 1366, 64, 690, 2586, 704, 1524, 810, 304, 420, 955, 627, 42, 1366, 64, 9483, 1468, 300, 8541, 311, 617, 1695, 3167, 3395, 1598, 719, 449, 264, 5190, 11595, 315, 8834, 198, 54895, 21823, 64, 16222, 1366, 64, 274, 477, 21823, 300, 13, 2435, 8541, 311, 1427, 4883, 261, 304, 3663, 323, 2547, 439, 264, 198, 1407, 13, 2435, 8541, 311, 3351, 29493, 323, 387, 810, 31467, 1109, 21823, 64, 16222, 1366, 300, 280, 50828, 3779, 735, 1366, 64, 6835, 1524, 810, 61784, 323, 24981, 4907, 13, 2435, 2733, 198, 19045, 422, 814, 10368, 15870, 1174, 4445, 1303, 735, 1366, 64, 529, 274, 31954, 9017, 78552, 198, 438, 41630, 2136, 11, 719, 814, 527, 2753, 27762, 311, 387, 4642, 1109, 527, 21823, 64, 16222, 1366, 300, 627, 53, 4586, 16222, 2599, 17455, 198, 2028, 955, 3629, 706, 5115, 264, 2653, 892, 25607, 5196 ]
0xBreath/holistic-books
Once they arrived in Location 1, people usually kept progres sing—the highest state Martin calls Location 4—and they rarely slipped back or jumped ahead. Everything happened internally, and for many the shift wasn’t spiritual. It was just the way they experienced themselves. “If you sat in a roomful of people and a small percentage belong to this altered sense of self,” says Martin, “you wouldn’t be able to spot them. To all outer appearances they are just like you and me.” At the outset, before Martin’s research began to expand to many other universities and countries, his typical subject was a white male from the United States or Europe, because women, for unknown reasons, were not eager to volunteer as enlightened or to discuss what their experiences were. Religious backgrounds were diverse, spanning Eastern and Western faiths, yet most of the subjects had done some kind of spiritual pract ice—they wanted to be in a higher state of consciousness. Curiously, around 14 percent had done nothing of this kind. They hadspontaneously popped into higher consciousness or, more typically, drifted into it. They reporte d being in their new state anywhere from forty years to as little as two or three. Martin’s research base has expanded to more than a thousand subjects, which means we must ask ourselves if “normal” isn’t a fixed state but a spectrum, with consciousness evolving much further than anyone has previously predicted. At the very least, higher consciousness has become much less exotic. It’s no longer the province of sadhus and yogis in the Himalayas. Martin’s study focused on body, emotions, sense of self, and thoughts, which are value neutral, making his work acceptable in the academy. But he found that the spiritual dimension had also opene d up. Some subjects reported the kind of open, clear, silent awareness associated with Buddhism; others experienced the bliss I discuss in this chapter. Still others had no idea what to make of their state of awareness. But they were amazed at the amount of wellbeing they were experiencing, and this grew as they moved furth er along the spectrum. (Paradoxically, in Location 4, all emotion fell away, even love, and the richness of bliss was replaced by what Martin calls complete freedom. Yet his subje cts report that they don’t miss the experience of emotions and bliss, because in freedom they have found the very highest state of wellbeing.) If it is startlin g to realize that enlightenment is all around us, and that it’s a natural progression, even more intriguing is the prospect that enlightenment is personal. The way that you create your own reality doesn’t suddenly come to an end; enlightenment isn’t like jumping off a divin g board. There are as many kinds of enlightenment as there are people, one might suppose. In a word, evolution itself is evolving, like everything else.“Normal” won’t be valid until it broadens to include everyone on the spectrum of consciousness. We will also need to revise the old definitions of enlightenment, in fact, to conform to the present age. The West has almost no formal institutions, outside monasteries and convents, geared for people who want to pursue higher states of consciousness or who have already arrived there. Here’s what “normal” should encompass. Feeling unbounded Being at peace Having a loose attachment to your personal history Living in the present Becoming free of negative thought forms and emotions Breaking away from traumas and wounds from the past Accepting that higher consciousness is natural, part of the human continuum Experiencing more and more self-awareness as you evolve Living in a state of wellbeing that continues to grow and deepen A venerated spiritual teacher was once asked, “What does it take to be enlightened?” His reply: “You no longer have a personal stake in the world.” If you identify with the boundaries erected by “I, me, and mine,” this sounds like a death sentence. Having a personal stake in the world is what life is all about, isn’t it? But with a longer view, across the entire spectrum of consciousness, the opposite is true. When you no longer identify with “I, me, and mine,” you are ushered into a new world of experience that transcends the individual. This is the second birth that the Vedas extol as the true beginning of life.Finally, I find it very touching that Martin’s enlightened subjects, as amazed as they were by their new state, thought that nothing could be better. “This is as real as it gets” was a common reaction. But they were wrong. Reality is infinite, and what makes it infinite isn’t the edge of the universe racing away faster than the speed of light. The universe matches human aspirations, and its infinity reflects the infinity inside us once we wake up and realize that it exists. * Adapted from Robert K eith W allace’s The Physiology of Consciousness (M.I.U. Press, 1993). OceanofPDF.comIf asked for an exact definition of quantum healing, I would say this: quantum healin g is the ability of one mode of consciousness (the mind) to spontaneously correct the mistakes in another mode of consciousness (the body). It is a completely self-enclosed process. If pressed for a shorter definition, I would say simply that quantum healing makes peace. When consciousness is fragmented, it starts a war in the mind-body system. This war lies behind many diseases, giving rise to what modern medicine calls their psychosomatic component. The rishis might call it “the fear born of duality,” and they would consider it not a component but the chief cause of all illness. The body will send many signals to indicate that a war is going on. Recently a young French-Canadian woman came to see me suffering from Crohn’s disease, a severe intestinal disorder characterized by chronic and uncontrollable diarrhea, accompanied by painful inflammation. Although the cause of Crohn’s disease is unknown, it strikes mostl y among young adults and may be connected to a deficiency in the immune system. What iswell known is that the intestinal tract is highly sensitive to emotional states; in this patient’s case, it was not surprising to hear that she worked long hours under the high pressure of a downtown Boston advertising firm. After talking to her for a while, I discovered that she had learned to meditate several years before. I asked her if she still kept it up. No, she answ ered, there wasn’t much time for it; when she did sit down to meditate, it didn’t do much good, because she usually fell asleep in a few minutes. I then asked if she had adjusted her diet to help her condition, slowed down the pace of her life, or considered moving on to a job with less stress. Looking somewhat impatient, she said no again—she wasn’t going to allow her disease, which caused her many difficulties, to rule her life. “Look,” I said, “you have a very serious condition. If this inflammation persists, you may have to have parts of your intestine surgically remo ved. What are you going to do about that?” She was quite knowled geable about her disease, and I didn’t have to tell her that some grim choices lay ahead. The surgery in question involves considerable disfiguration, since with part of the intestine removed, a tube has to be extended out of the abdomen to handle elimination. Even then, the disease is not cured and tends to recur in other parts of the intestine. “That’s why I’m here,” she answered. “I want a mental technique to help me continue to lead a normal life.” I was seeing the result of what the rishis called Pragya aparadh, the mistake of the intellect. This woman’s body was crying out for healin g, and it was telling her so every time she had an attack. She couldn’t even close her eyes to meditate without her body desperately grabbing some relief in the form of sleep. Yet, her mind interpreted these attempts at healing as either irrelevant or troublesome. She insisted on leading a “normal life” of high stress that her system wasn’t equipped to cope with.“This is not the kind of disease you can fight,” I said, “because there’s no one on the other side but you.” I explained that the same neuropeptides that registered stress in her brain were produced in her intestines. When she felt fear, frustration, and worry, the identical emotions were being experienced in her abdomen. I told her that in my opinion she didn’t need any new mental techn ique—she needed to let her body do what it wanted to do, which was to get well. The best way to cooperate with that was to give her body the rest it was demanding, continue to meditate, change her diet
[ 9843, 814, 198, 1138, 2270, 304, 10067, 220, 16, 11, 1274, 6118, 8774, 463, 18297, 7936, 22416, 198, 75254, 1614, 11826, 6880, 10067, 220, 19, 17223, 814, 19029, 198, 3306, 6586, 1203, 220, 477, 27096, 8469, 13, 20696, 7077, 198, 56544, 750, 1174, 323, 369, 1690, 279, 6541, 5828, 1431, 18330, 13, 1102, 574, 198, 4345, 279, 1648, 814, 10534, 5694, 627, 38684, 499, 7731, 304, 264, 3130, 1285, 315, 1274, 323, 264, 2678, 11668, 198, 9978, 647, 311, 420, 29852, 5647, 315, 659, 2476, 2795, 11826, 11, 1054, 9514, 198, 41450, 77, 1431, 387, 3025, 311, 7858, 1124, 13, 2057, 682, 16335, 27351, 198, 20670, 527, 1120, 1093, 499, 323, 757, 49216, 1688, 279, 68864, 11, 1603, 11826, 753, 3495, 6137, 311, 9407, 198, 998, 1690, 1023, 23978, 323, 5961, 11, 813, 14595, 3917, 198, 16514, 264, 4251, 8762, 505, 279, 3723, 4273, 477, 4606, 345, 28753, 3278, 11, 369, 9987, 8125, 11, 1051, 539, 24450, 311, 198, 12821, 42005, 439, 82315, 477, 311, 4358, 1148, 872, 198, 327, 69597, 1051, 13, 53176, 36576, 1051, 17226, 345, 1508, 1251, 18516, 323, 11104, 10082, 82, 11, 3686, 1455, 315, 279, 198, 65882, 1047, 2884, 1063, 3169, 315, 18330, 3856, 10054, 71201, 198, 87692, 311, 387, 304, 264, 5190, 1614, 315, 25917, 13, 13182, 13610, 13801, 20019, 220, 975, 3346, 1047, 2884, 4400, 315, 420, 3169, 13, 2435, 1047, 2203, 546, 20933, 43333, 1139, 5190, 25917, 477, 11, 810, 198, 87184, 1174, 92662, 1139, 433, 13, 2435, 1934, 68, 294, 1694, 304, 872, 502, 198, 2513, 12660, 505, 36498, 1667, 311, 439, 2697, 439, 1403, 477, 2380, 627, 50219, 753, 3495, 2385, 706, 17626, 311, 810, 1109, 264, 198, 339, 52949, 15223, 11, 902, 3445, 584, 2011, 2610, 13520, 422, 198, 2118, 8416, 863, 4536, 1431, 264, 33595, 71831, 52419, 1614, 719, 264, 20326, 11, 449, 198, 64589, 2136, 42028, 1790, 4726, 1109, 5606, 706, 198, 1762, 18785, 19698, 13, 2468, 279, 1633, 3325, 11, 5190, 198, 64589, 2136, 706, 3719, 1790, 2753, 39418, 13, 1102, 753, 912, 5129, 198, 1820, 17271, 315, 12703, 13092, 323, 42453, 285, 304, 279, 76438, 98440, 13, 11826, 753, 198, 56065, 10968, 389, 2547, 11, 21958, 11, 5647, 315, 659, 11, 323, 198, 61665, 82, 11, 902, 527, 907, 21277, 11, 3339, 813, 990, 198, 38116, 304, 279, 44445, 662, 2030, 568, 1766, 430, 279, 18330, 198, 43639, 1047, 1101, 1825, 68, 294, 709, 13, 4427, 15223, 5068, 279, 198, 15674, 315, 1825, 11, 2867, 1174, 21737, 17985, 5938, 449, 198, 33, 8512, 71, 2191, 26, 3885, 10534, 279, 59045, 358, 4358, 304, 420, 198, 41326, 662, 16782, 3885, 1047, 912, 4623, 1148, 311, 1304, 315, 872, 1614, 198, 1073, 17985, 13, 2030, 814, 1051, 46304, 520, 279, 3392, 315, 198, 9336, 35214, 814, 1051, 25051, 11, 323, 420, 14264, 439, 814, 198, 95918, 18742, 339, 2781, 3235, 279, 20326, 13, 320, 4368, 40197, 2740, 1174, 304, 198, 4812, 220, 19, 11, 682, 20356, 220, 11299, 3201, 1174, 1524, 3021, 11, 323, 279, 198, 14172, 2136, 315, 59045, 574, 12860, 555, 1148, 11826, 6880, 198, 15079, 11542, 13, 14968, 813, 1207, 3841, 272, 2641, 1934, 430, 814, 1541, 1431, 198, 1869, 279, 3217, 315, 21958, 323, 59045, 11, 1606, 304, 198, 25746, 8944, 814, 617, 1766, 279, 1633, 8592, 1614, 315, 198, 9336, 35214, 29275, 2746, 433, 374, 1212, 3817, 342, 311, 13383, 430, 81869, 374, 682, 2212, 198, 355, 11, 323, 430, 433, 753, 264, 5933, 33824, 11, 1524, 810, 41765, 198, 285, 279, 22199, 430, 81869, 374, 4443, 13, 578, 1648, 198, 9210, 499, 1893, 701, 1866, 8903, 3250, 1431, 15187, 220, 2586, 311, 198, 276, 842, 26, 81869, 4536, 1431, 1093, 30102, 297, 171, 105, 222, 264, 3512, 258, 342, 4580, 627, 3947, 527, 439, 1690, 13124, 315, 81869, 439, 1070, 527, 198, 16455, 11, 832, 2643, 23289, 13, 763, 264, 3492, 11, 15740, 5196, 374, 198, 5230, 20222, 11, 1093, 4395, 775, 35147, 12484, 863, 2834, 1431, 387, 2764, 3156, 433, 7353, 729, 311, 2997, 198, 93057, 389, 279, 20326, 315, 25917, 13, 1226, 690, 1101, 198, 17483, 311, 65836, 279, 2362, 409, 171, 71831, 77, 6055, 315, 81869, 11, 304, 2144, 345, 998, 26965, 311, 279, 3118, 4325, 13, 578, 4410, 706, 4661, 912, 198, 630, 278, 14673, 11, 4994, 1647, 2352, 552, 323, 17120, 82, 345, 713, 1636, 369, 1274, 889, 1390, 311, 23564, 5190, 5415, 315, 198, 64589, 2136, 477, 889, 617, 2736, 11721, 1070, 13, 5810, 753, 198, 12840, 1054, 8416, 863, 1288, 38632, 627, 6251, 20659, 653, 66786, 198, 34242, 520, 9096, 198, 29132, 264, 20784, 20581, 311, 701, 4443, 3925, 198, 45605, 304, 279, 3118, 198, 33, 762, 18238, 1949, 315, 8389, 3463, 7739, 323, 21958, 198, 61279, 3201, 505, 9781, 55024, 323, 34254, 505, 279, 3347, 198, 17059, 287, 430, 5190, 25917, 374, 5933, 11, 961, 315, 198, 1820, 3823, 86901, 198, 849, 32836, 11627, 810, 323, 810, 659, 66104, 2136, 439, 499, 198, 5230, 4035, 198, 45605, 304, 264, 1614, 315, 57930, 430, 9731, 311, 3139, 323, 198, 33980, 268, 198, 32, 348, 10766, 220, 18330, 11326, 574, 3131, 4691, 11, 220, 1054, 3923, 198, 28156, 433, 1935, 311, 387, 82315, 12671, 5414, 10052, 25, 1054, 2675, 912, 5129, 198, 19553, 264, 4443, 18783, 304, 279, 1917, 2029, 1442, 499, 10765, 449, 279, 198, 11130, 5548, 66906, 555, 1054, 40, 11, 757, 11, 323, 10705, 2476, 420, 10578, 1093, 264, 198, 63007, 11914, 13, 20636, 264, 4443, 18783, 304, 279, 1917, 374, 198, 12840, 2324, 374, 682, 922, 11, 4536, 1431, 433, 30, 2030, 449, 264, 5129, 1684, 11, 4028, 198, 1820, 4553, 20326, 315, 25917, 11, 279, 14329, 374, 837, 627, 4599, 499, 912, 5129, 10765, 449, 1054, 40, 11, 757, 11, 323, 10705, 2476, 499, 198, 548, 64260, 291, 1139, 264, 502, 1917, 315, 3217, 430, 42590, 1438, 198, 1820, 3927, 13, 1115, 374, 279, 2132, 7342, 430, 279, 75887, 300, 1327, 337, 198, 300, 279, 837, 7314, 315, 2324, 1006, 38745, 1174, 358, 33595, 71831, 303, 433, 1633, 31687, 430, 11826, 753, 82315, 198, 65882, 11, 439, 46304, 439, 814, 1051, 555, 872, 502, 1614, 345, 61665, 430, 4400, 1436, 387, 2731, 662, 1054, 2028, 374, 439, 1972, 439, 433, 198, 19209, 863, 574, 264, 4279, 13010, 13, 2030, 814, 1051, 5076, 13, 44874, 198, 285, 304, 171, 71831, 62664, 11, 323, 1148, 3727, 433, 304, 171, 71831, 62664, 4536, 1431, 279, 6964, 315, 279, 198, 359, 8194, 22019, 3201, 10819, 1109, 279, 4732, 315, 3177, 13, 578, 198, 359, 8194, 9248, 3823, 58522, 11, 323, 1202, 304, 171, 71831, 77, 488, 198, 265, 171, 120912, 115192, 279, 304, 171, 71831, 77, 488, 4871, 220, 603, 3131, 584, 15508, 709, 323, 13383, 198, 9210, 433, 6866, 627, 9, 59531, 291, 505, 8563, 735, 384, 411, 468, 682, 580, 753, 578, 95946, 315, 92752, 2136, 220, 320, 44, 2506, 5368, 16853, 6010, 11, 220, 2550, 18, 4390, 97283, 1073, 24317, 662, 884, 2746, 4691, 369, 459, 4839, 409, 171, 71831, 77, 684, 315, 31228, 21730, 1174, 358, 1053, 198, 37890, 420, 25, 31228, 27661, 258, 342, 374, 279, 5845, 315, 832, 3941, 315, 198, 64589, 2136, 320, 1820, 4059, 8, 311, 88558, 4495, 279, 198, 80024, 2094, 304, 2500, 3941, 315, 25917, 320, 1820, 2547, 570, 1102, 374, 198, 64, 6724, 659, 12, 967, 9443, 1920, 13, 1442, 17770, 369, 264, 24210, 198, 451, 171, 71831, 77, 684, 11, 358, 1053, 2019, 5042, 430, 31228, 21730, 3727, 198, 55225, 13, 3277, 25917, 374, 87195, 11, 433, 8638, 264, 4208, 304, 198, 1820, 4059, 9534, 1887, 13, 1115, 4208, 15812, 4920, 1690, 19338, 345, 70, 2299, 10205, 311, 1148, 6617, 16088, 6880, 872, 198, 92109, 437, 13795, 3777, 13, 578, 436, 819, 285, 2643, 1650, 433, 1054, 1820, 8850, 198, 16381, 315, 294, 10965, 1174, 863, 323, 814, 1053, 2980, 433, 539, 264, 198, 8739, 719, 279, 10388, 5353, 315, 682, 17563, 627, 791, 2547, 690, 3708, 1690, 220, 17738, 311, 13519, 430, 264, 4208, 374, 198, 9738, 389, 13, 42096, 264, 3995, 8753, 12, 60674, 5333, 3782, 198, 998, 1518, 757, 924, 171, 105, 222, 4776, 505, 25611, 25105, 753, 8624, 11, 264, 15748, 198, 71558, 19823, 32971, 555, 21249, 323, 198, 359, 778, 69855, 69393, 11, 24895, 555, 26175, 198, 258, 171, 120912, 8836, 367, 13, 10541, 279, 5353, 315, 25611, 25105, 753, 8624, 374, 198, 16476, 11, 433, 23170, 1455, 75, 379, 4315, 3995, 12884, 323, 1253, 387, 198, 15647, 311, 264, 409, 171, 71831, 5979, 2301, 304, 279, 22852, 1887, 13, 3639, 374, 9336, 3967, 374, 430, 279, 63900, 42929, 374, 7701, 16614, 311, 198, 336, 41964, 5415, 26, 304, 420, 8893, 753, 1162, 11, 433, 574, 539, 198, 20370, 34754, 311, 6865, 430, 1364, 6575, 1317, 4207, 1234, 279, 198, 12156, 7410, 315, 264, 19441, 10406, 13172, 33595, 71831, 8892, 627, 6153, 7556, 311, 1077, 369, 264, 1418, 11, 358, 11352, 430, 1364, 1047, 198, 12964, 291, 311, 1812, 20227, 3892, 1667, 1603, 13, 358, 4691, 1077, 422, 1364, 198, 44466, 8774, 433, 709, 13, 2360, 11, 1364, 459, 2332, 2781, 291, 11, 1070, 5828, 1431, 1790, 892, 198, 2000, 433, 26, 994, 1364, 1550, 2503, 1523, 311, 1812, 20227, 11, 433, 3287, 1431, 656, 1790, 198, 19045, 11, 1606, 1364, 6118, 11299, 33173, 304, 264, 2478, 4520, 627, 40, 1243, 4691, 422, 1364, 1047, 24257, 1077, 10173, 311, 1520, 1077, 198, 9233, 11, 48946, 1523, 279, 18338, 315, 1077, 2324, 11, 477, 6646, 198, 66215, 389, 311, 264, 2683, 449, 2753, 8631, 13, 21815, 14738, 198, 318, 23557, 11, 1364, 1071, 912, 1578, 2345, 32158, 5828, 1431, 2133, 311, 2187, 1077, 198, 67, 56407, 11, 902, 9057, 1077, 1690, 1891, 171, 105, 222, 3951, 552, 11, 311, 6037, 1077, 2324, 627, 2118, 10596, 2476, 358, 1071, 11, 1054, 9514, 617, 220, 264, 1633, 6129, 3044, 13, 1442, 420, 198, 258, 171, 120912, 8836, 367, 67145, 11, 499, 1253, 617, 311, 617, 5596, 315, 701, 198, 396, 478, 483, 12274, 2740, 1323, 78, 29033, 13, 3639, 527, 499, 2133, 311, 656, 198, 9274, 430, 12671, 3005, 574, 5115, 1440, 839, 3980, 481, 922, 1077, 198, 67, 56407, 11, 323, 358, 3287, 1431, 617, 311, 3371, 1077, 430, 1063, 44517, 11709, 198, 6789, 8469, 13, 578, 15173, 304, 3488, 220, 18065, 24779, 198, 4338, 171, 71831, 70, 2060, 11, 2533, 449, 961, 315, 279, 92234, 7108, 11, 264, 198, 74838, 706, 311, 387, 11838, 220, 704, 315, 279, 64772, 311, 3790, 198, 40895, 2617, 13, 7570, 1243, 11, 279, 8624, 374, 539, 64688, 323, 28335, 198, 998, 64648, 304, 1023, 5596, 315, 279, 92234, 627, 49977, 753, 3249, 358, 4344, 1618, 2476, 1364, 19089, 13, 1054, 40, 1390, 264, 10723, 198, 26522, 2428, 311, 1520, 757, 3136, 311, 3063, 264, 4725, 2324, 49216, 40, 574, 9298, 220, 279, 1121, 315, 1148, 279, 436, 819, 285, 2663, 2394, 351, 7911, 198, 391, 277, 52687, 11, 220, 279, 16930, 315, 279, 17108, 13, 1115, 5333, 753, 2547, 198, 16514, 31299, 704, 369, 27661, 258, 342, 11, 323, 433, 574, 11890, 1077, 779, 1475, 198, 1712, 1364, 1047, 459, 3440, 13, 3005, 7846, 1431, 1524, 3345, 1077, 6548, 311, 198, 2106, 20227, 2085, 1077, 2547, 38643, 50030, 1063, 198, 3833, 4843, 304, 279, 1376, 315, 6212, 13, 14968, 11, 1077, 4059, 33398, 1521, 198, 266, 34372, 520, 21730, 439, 3060, 40815, 477, 78518, 627, 8100, 29676, 389, 6522, 264, 1054, 8416, 2324, 863, 315, 1579, 8631, 430, 198, 1964, 1887, 5828, 1431, 19167, 311, 37586, 449, 35147, 2028, 374, 539, 279, 3169, 315, 8624, 499, 649, 33595, 71831, 2121, 2476, 358, 1071, 345, 2118, 28753, 1070, 753, 912, 832, 389, 279, 1023, 3185, 719, 499, 2029, 358, 198, 81950, 430, 279, 1890, 841, 4176, 74489, 430, 9879, 198, 95290, 304, 1077, 8271, 1051, 9124, 304, 1077, 39408, 1572, 13, 3277, 198, 32158, 6612, 8850, 11, 33086, 11, 323, 11196, 1174, 279, 20086, 21958, 198, 52898, 1694, 10534, 304, 1077, 64772, 627, 40, 3309, 1077, 430, 304, 856, 9647, 1364, 3287, 1431, 1205, 904, 502, 198, 93221, 2869, 602, 593, 2345, 32158, 4460, 311, 1095, 1077, 2547, 656, 1148, 433, 198, 87692, 311, 656, 11, 902, 574, 311, 636, 1664, 13, 578, 1888, 1648, 311, 198, 1030, 86299, 449, 430, 574, 311, 3041, 1077, 2547, 279, 2800, 433, 574, 198, 84031, 287, 11, 3136, 311, 1812, 20227, 11, 2349, 1077, 10173 ]
0xBreath/holistic-books
tissue breakdown under exercise, so do we gradually need less and less food to maintain life. The higher the percentage of raw food one lives on, the slower the rate of tissue deterioration which one evolves into. A sick body requires a gradual carefully worked-out entry into this stage - where one is able to live on a 100% unfired (raw) diet. Returning to the symptoms which occur on a superior nutritional program - people who have had tendencies in the past to recurring skin rashes or eruptions will frequently tend to eliminate poisons and harmful drugs through the skin with new rashes or eruptions. If they go to a physician now who is not familiar with this aspect of nutrition, he will diagnose it as an allergy. They ask. "How come I'm eating better now than I ever did before, and instead I'm getting worse?" They don't understand that the body is “retracing”. The skin is getting more alive and active. It's throwing out more poisons more rapidly now that the body is building more power which is saved from those hard-to-ingest meals which have been discontinued. These toxins being discarded are saving you from more serious disease which will result if you keep them in your body too much longer - possibly hepatitis, kidney disorders, blood disease, heart disease, arthritis, nerve degenerations or even cancer - depending upon your structural weaknesses. Be happy you're paying your bills now on an easy-payment plan. With some, colds which haven't appeared for a long time may occur, or even fevers. This is nature's way of housecleaning. Understand that these actions are constructive, even though unpleasant at the moment. Don't, but don't, try to stop these symptoms by the use of certain drugs, or even massive doses of vitamins, which will act as drugs in huge concentration. These symptoms are part of a remedial process. Don't try to “cure” the remedial process! These are not deficiency conditions or allergic manifestations - not if you're eating properly in quality, quantity, combination and sequence. Here is where experienced advice is of great value. Unfortunately, there are few books present today which give full guidance to the average reader. Try to find guidance through a doctor or teacher who has the requisite experience in this most confusing of all subjects - Nutrition in relation to health and disease. BODY PURIFICATION CAN BE A LONG DRAWN OUT PROCESS You may he eating perfectly in regard to quantity, quality and observing all the correct rules, and still symptoms will occur. Those who have lived better lives in the past - who have eaten better foods and who have abused their bodies less with overeating will have reactions ranging from almost none at all or very mild symptoms which may be uncomfortable or acute. Those who have lived worse lives and poisoned themselves more will experience more severe symptoms - if their liver, kidneys, or other important eliminating organs have been damaged. When they have been renovated to the point of fair working order, they will no longer produce symptoms. Headaches may occur at the beginning. Fever, colds, the skin may break out, a short interval of bowel sluggishness, occasional diarrhea, feelings of tiredness and weakness, disinclination to exercise, nervousness, irritability, negativity or mental depression, frequent urination, also may occur. However, the great majority of people find their reactions tolerable and are encouraged to bear with them, because of the many improvements which have already occurred and are becoming more evident with each day. This acts as an inspirational force to them. copyright © Dr. Stanley S. Bass (718) 648-1500 www.drbass.com 12The symptoms will vary according to the materials being discarded, the condition of the organs involved in the elimination and the amount of energy you have available. The more you rest and sleep when symptoms are present, the milder they are and the more quickly they are terminated. Be happy you are having symptoms. Realize deeply that your body is becoming younger and healthier every day, because you are throwing off more and more wastes which would eventually have brought pain, disease and much suffering. Those who have the worst symptom-reactions and follow through to their successful termination are thus avoiding some of the worst diseases which would eventually have developed had they continued their careless eating habits. BLISSFUL STATE OF HEALTH COMES EVENTUALLY Don't expect to go on an ascending scale of quality, that improving your diet will make you feel better and better each day until you reach perfection. The body is cyclical in nature. and health returns in a series of gradually diminishing cycles. For example - you start a better diet and for a while you feel much better. After some time, a symptom occurs - you feel nauseous for a day and have diarrhea with a foul-smelling stool. After one day you feel even better than before and it goes fine for awhile. Then you suddenly develop a cold, feel chills and lose your appetite. After about two or three days (assuming you don't take drugs or do anything else about it), you suddenly recover and feel better than you did for years. Let us say this wellbeing continues for two months, when you suddenly develop an itch or rash. You don't take anything special for it. This rash flares up, gets worse and continues for ten days, and suddenly subsides. Immediately after this you find that your hepatitis is gone and your energy has increased more than ever before. The rash became an outlet for the poisons in the liver which produced the hepatitis. This is how recovery occurs - like the cycles in the Dow-Jones Average at the beginning of a bull market recovery. You feel better, a reaction occurs and you don't feel as well for a short while. You recover and go even higher. And so it goes, each reaction milder than the last as the body becomes purer, each becoming shorter in duration, feeling better than ever before, until you reach a level plateau of vibrant health. Here you become relatively disease-free and are filled with ever-increasing joy, life and the happiness which comes from sheer well-being. The mind opens up and expands to ever-higher horizons and your soul will shout for joy. You begin to love the world, the universe and everything in it. This is the natural state of the mind - blissful, joyful and at peace with the universe - and it can only be attained by alignment with biological laws. The first laws we must learn to obey are the laws of Nature. We must learn to eat simple pure and natural foods, properly prepared and combined, and our bodies in return will cast off all the evil we have taken in during our lives. Nowhere is the principle of forgiveness of sins more manifest than here - in our own bodies - when we forsake our evil and destructive ways of eating (the defiling of the temple of the soul). God (or Nature, if you please) gives us a whole new chance for a new glorious life. All repentance must begin here in the body, through pure diet and natural foods. Then, just have faith, sit back and watch what happens. Before your own eyes, you will daily see signs that will cause you to wonder at this vast intelligence in operation that staggers the comprehension. The mysteries of the body, the operations of Nature, the vital forces working in Nature and the Cosmos are far beyond what our minds are prepared to understand at present. Every great physician or scientist who ever lived marveled in awe and humility at the wonders of nature. Yes - we are "Fearfully and Wonderfully Made." Let us give ourselves a chance to experience what it means to be really healthy and fully ALIVE - to feel the joy of living by aligning ourselves to (God’s) Nature’s laws as intended for man, through the eating of natural (normal) foods. This indeed is the prime prerequisite in man’s physical, mental and spiritual unfoldment. Stanley S. Bass, 1973 Published in Dr. Shelton’s Hygienic Review, January 1973 (NOTE: The above article is written to explain the process of body regeneration, thanks to improved diet using natural foods, and is not to be associated with the recommendation of any specific product offered for sale. ) Finally, I would like to include a brief case-history of a most impressive recovery from “How I Overcame Inoperable Cancer” by a Naturopath, Wong Hon Sun, N.D. It is also included as Appendix B in “Discovery of the Ultimate Diet.” A MOST INTERESTING CASE OF RECOVERY FROM CANCER ON ONE MEAL A DAY ON A RAW FOOD REGIMEN by Wong Hon Sun The following is from the book How I Overcame Inoperable Cancer by Wong Hon Sun, ND, with a forward by Dr. Ralph Bircher (Exposition Press, Hicksville, N.Y. 1975). copyright © Dr. Stanley S. Bass (718) 648-1500 www.drbass.com 13 At the age of 32, Wong Hon Sun found himself to be a victim of a critical form ( anaplastic epidermoid carcinoma) of nose and throat cancer, large and inoperable, in 1960, and by employing principles of natural healing on his own initiative, made an unexpected complete recovery (as confirmed by medical checkups), with no recurrence of any symptoms of the disease for the past 14 years. Before he began his self-care, he had a lump at the back of his throat which began to interfere with both his speech and swallowing. He was constitutionally anemic, had chronic nasal catarrh with intermittent nose bleeds, was extremely emaciated
[ 20438, 31085, 1234, 10368, 11, 779, 656, 584, 27115, 198, 17483, 2753, 323, 2753, 3691, 311, 10519, 2324, 16853, 791, 5190, 279, 11668, 315, 7257, 3691, 832, 6439, 389, 11, 279, 29493, 279, 4478, 315, 20438, 82189, 902, 832, 93054, 1139, 13, 362, 198, 82, 875, 2547, 7612, 264, 53722, 15884, 6575, 9994, 4441, 1139, 420, 6566, 482, 1405, 832, 374, 3025, 311, 3974, 389, 264, 220, 1041, 4, 9662, 2757, 320, 1059, 340, 94942, 627, 85914, 311, 279, 13803, 902, 12446, 389, 264, 16757, 43226, 2068, 482, 1274, 889, 617, 1047, 61555, 304, 279, 3347, 311, 198, 265, 46839, 6930, 436, 14380, 477, 61354, 1324, 690, 14134, 8541, 311, 22472, 3273, 19941, 323, 28856, 11217, 1555, 279, 6930, 449, 502, 198, 81, 14380, 477, 61354, 1324, 13, 1442, 814, 733, 311, 264, 28378, 1457, 889, 374, 539, 11537, 449, 420, 13189, 315, 26677, 11, 568, 690, 58681, 433, 439, 459, 198, 543, 43043, 627, 7009, 2610, 13, 330, 4438, 2586, 358, 2846, 12459, 2731, 1457, 1109, 358, 3596, 1550, 1603, 11, 323, 4619, 358, 2846, 3794, 11201, 7673, 2435, 1541, 956, 3619, 198, 9210, 279, 2547, 374, 1054, 265, 376, 4628, 113068, 791, 6930, 374, 3794, 810, 13989, 323, 4642, 13, 1102, 596, 21939, 704, 810, 3273, 19941, 810, 19019, 1457, 430, 279, 2547, 374, 4857, 810, 198, 13477, 902, 374, 6924, 505, 1884, 2653, 4791, 85005, 478, 21644, 902, 617, 1027, 65259, 627, 9673, 62186, 1694, 44310, 527, 14324, 499, 505, 810, 6129, 8624, 902, 690, 1121, 422, 499, 2567, 1124, 304, 701, 2547, 2288, 198, 59178, 5129, 482, 11000, 73975, 11, 39042, 24673, 11, 6680, 8624, 11, 4851, 8624, 11, 55652, 11, 32015, 5367, 804, 811, 477, 1524, 198, 66, 11967, 482, 11911, 5304, 701, 24693, 44667, 13, 2893, 6380, 499, 2351, 12798, 701, 19123, 1457, 389, 459, 4228, 73543, 3197, 627, 2409, 1063, 11, 9439, 82, 902, 9167, 956, 9922, 369, 264, 1317, 892, 1253, 12446, 11, 477, 1524, 1172, 3078, 13, 1115, 374, 7138, 596, 1648, 315, 3838, 18883, 287, 627, 16648, 2752, 430, 1521, 6299, 527, 54584, 1174, 1524, 3582, 47989, 520, 279, 4545, 13, 4418, 956, 1174, 719, 1541, 956, 1174, 1456, 311, 3009, 1521, 198, 24738, 52273, 555, 279, 1005, 315, 3738, 11217, 11, 477, 1524, 11191, 35130, 315, 46192, 11, 902, 690, 1180, 439, 11217, 304, 6908, 20545, 627, 9673, 13803, 527, 961, 315, 264, 34630, 532, 1920, 13, 4418, 956, 1456, 311, 1054, 66, 554, 863, 279, 34630, 532, 1920, 0, 4314, 527, 539, 48294, 198, 16902, 477, 57596, 78167, 482, 539, 422, 499, 2351, 12459, 10489, 304, 4367, 11, 12472, 11, 10824, 323, 8668, 627, 8586, 374, 1405, 10534, 9650, 374, 315, 2294, 907, 13, 19173, 11, 1070, 527, 2478, 6603, 3118, 3432, 902, 3041, 2539, 198, 24343, 685, 311, 279, 5578, 6742, 13, 9934, 311, 1505, 19351, 1555, 264, 10896, 477, 11326, 889, 706, 279, 82780, 3217, 304, 420, 198, 3646, 31715, 315, 682, 15223, 482, 39700, 304, 12976, 311, 2890, 323, 8624, 627, 42917, 7480, 23721, 20076, 7354, 362, 35042, 72752, 45, 10009, 52537, 198, 2675, 1253, 568, 12459, 14268, 304, 5363, 311, 12472, 11, 4367, 323, 46071, 682, 279, 4495, 5718, 11, 323, 2103, 13803, 690, 12446, 627, 23025, 889, 617, 12439, 2731, 6439, 304, 279, 3347, 482, 889, 617, 35661, 2731, 15657, 323, 889, 617, 36665, 872, 13162, 2753, 449, 198, 70030, 1113, 690, 617, 25481, 24950, 505, 4661, 7000, 520, 682, 477, 1633, 23900, 13803, 902, 1253, 387, 29213, 477, 30883, 627, 23025, 889, 617, 12439, 11201, 6439, 323, 71598, 5694, 810, 690, 3217, 810, 15748, 13803, 482, 422, 872, 26587, 345, 64381, 36371, 11, 477, 1023, 3062, 40599, 36853, 617, 1027, 20727, 13, 3277, 814, 617, 1027, 57934, 311, 279, 1486, 315, 6762, 198, 21837, 2015, 11, 814, 690, 912, 5129, 8356, 13803, 627, 12626, 14576, 1253, 12446, 520, 279, 7314, 13, 85001, 11, 9439, 82, 11, 279, 6930, 1253, 1464, 704, 11, 264, 2875, 10074, 315, 66358, 88046, 2136, 345, 14310, 300, 4001, 69393, 11, 16024, 315, 19781, 2136, 323, 23948, 11, 64842, 566, 2617, 311, 10368, 11, 23418, 2136, 11, 30118, 2968, 11, 93795, 477, 198, 93221, 18710, 11, 21420, 4433, 2617, 11, 1101, 1253, 12446, 627, 11458, 11, 279, 2294, 8857, 315, 1274, 1505, 872, 25481, 15230, 481, 323, 527, 21190, 311, 11984, 449, 1124, 11, 1606, 315, 279, 198, 35676, 18637, 902, 617, 2736, 10222, 323, 527, 10671, 810, 30576, 449, 1855, 1938, 13, 1115, 14385, 439, 459, 198, 1354, 5682, 1697, 5457, 311, 1124, 627, 15859, 7388, 2999, 13, 31552, 328, 13, 37053, 256, 320, 21982, 8, 220, 23802, 12, 3965, 15, 262, 8604, 962, 10910, 395, 916, 220, 717, 791, 13803, 690, 13592, 4184, 311, 279, 7384, 1694, 44310, 11, 279, 3044, 315, 279, 36853, 6532, 304, 279, 44032, 198, 438, 279, 3392, 315, 4907, 499, 617, 2561, 13, 578, 810, 499, 2800, 323, 6212, 994, 13803, 527, 3118, 11, 279, 296, 21439, 814, 198, 548, 323, 279, 810, 6288, 814, 527, 32372, 13, 2893, 6380, 499, 527, 3515, 13803, 627, 13058, 553, 17693, 220, 430, 701, 2547, 374, 10671, 14992, 323, 39345, 1475, 1938, 11, 1606, 499, 527, 21939, 1022, 810, 323, 810, 198, 86, 28006, 902, 1053, 9778, 617, 7263, 6784, 11, 8624, 323, 1790, 16066, 627, 23025, 889, 617, 279, 12047, 49648, 5621, 4109, 323, 1833, 1555, 311, 872, 6992, 35508, 527, 8617, 31526, 1063, 315, 198, 1820, 12047, 19338, 902, 1053, 9778, 617, 8040, 1047, 814, 8738, 872, 84834, 12459, 26870, 627, 9574, 31949, 50736, 23233, 3083, 73725, 7837, 1600, 13032, 52, 29555, 198, 8161, 956, 1755, 311, 733, 389, 459, 36488, 5569, 315, 4367, 11, 430, 18899, 701, 10173, 690, 1304, 499, 2733, 2731, 323, 2731, 1855, 1938, 198, 39830, 499, 5662, 39143, 13, 578, 2547, 374, 44448, 32348, 304, 7138, 13, 323, 2890, 4780, 304, 264, 4101, 315, 27115, 84153, 25492, 627, 2520, 3187, 482, 499, 1212, 264, 2731, 10173, 323, 369, 264, 1418, 499, 2733, 1790, 2731, 13, 4740, 1063, 892, 11, 264, 49648, 13980, 482, 499, 2733, 198, 3458, 817, 788, 369, 264, 1938, 323, 617, 69393, 449, 264, 40884, 4773, 6427, 64172, 13, 4740, 832, 1938, 499, 2733, 1524, 2731, 1109, 1603, 323, 433, 5900, 198, 63157, 369, 51569, 13, 5112, 499, 15187, 2274, 264, 9439, 1174, 2733, 523, 3385, 323, 9229, 701, 38575, 13, 4740, 922, 1403, 477, 2380, 2919, 198, 7, 66463, 499, 1541, 956, 1935, 11217, 477, 656, 4205, 775, 922, 433, 705, 499, 15187, 11993, 323, 2733, 2731, 1109, 499, 1550, 369, 1667, 627, 10267, 603, 2019, 420, 57930, 9731, 369, 1403, 4038, 11, 994, 499, 15187, 2274, 459, 95856, 477, 57342, 13, 1472, 1541, 956, 1935, 4205, 198, 15495, 369, 433, 13, 1115, 57342, 1344, 5518, 709, 11, 5334, 11201, 323, 9731, 369, 5899, 2919, 11, 323, 15187, 5258, 3422, 13, 69352, 1306, 420, 499, 198, 3990, 430, 701, 73975, 374, 8208, 323, 701, 4907, 706, 7319, 810, 1109, 3596, 1603, 13, 578, 57342, 6244, 459, 27487, 369, 279, 198, 5481, 19941, 304, 279, 26587, 902, 9124, 279, 73975, 627, 2028, 374, 1268, 13654, 13980, 482, 1093, 279, 25492, 304, 279, 43532, 12278, 3233, 24478, 520, 279, 7314, 315, 264, 17231, 3157, 13654, 627, 2675, 2733, 2731, 11, 264, 13010, 13980, 323, 499, 1541, 956, 2733, 439, 1664, 369, 264, 2875, 1418, 13, 1472, 11993, 323, 733, 1524, 5190, 627, 3112, 779, 433, 5900, 11, 1855, 13010, 296, 21439, 1109, 279, 1566, 439, 279, 2547, 9221, 4087, 261, 11, 1855, 10671, 24210, 304, 8250, 11, 8430, 198, 58234, 1109, 3596, 1603, 11, 3156, 499, 5662, 264, 2237, 65388, 315, 34076, 2890, 627, 8586, 499, 3719, 12309, 8624, 12862, 323, 527, 10409, 449, 3596, 3502, 76562, 16267, 11, 2324, 323, 279, 23871, 902, 4131, 505, 198, 32158, 261, 1664, 33851, 13, 578, 4059, 16264, 709, 323, 52956, 311, 3596, 28661, 261, 4917, 64947, 323, 701, 13836, 690, 42223, 369, 16267, 13, 1472, 3240, 311, 198, 31153, 279, 1917, 11, 279, 15861, 323, 4395, 304, 433, 13, 1115, 374, 279, 5933, 1614, 315, 279, 4059, 482, 59045, 1285, 11, 83212, 323, 520, 9096, 449, 279, 198, 359, 8194, 482, 323, 433, 649, 1193, 387, 63260, 555, 17632, 449, 24156, 7016, 627, 791, 1176, 7016, 584, 2011, 4048, 311, 41701, 527, 279, 7016, 315, 22037, 13, 1226, 2011, 4048, 311, 8343, 4382, 10748, 323, 5933, 15657, 11, 10489, 198, 61212, 323, 11093, 11, 323, 1057, 13162, 304, 471, 690, 6445, 1022, 682, 279, 14289, 584, 617, 4529, 304, 2391, 1057, 6439, 13, 4800, 6881, 374, 279, 198, 652, 16379, 315, 53150, 315, 40444, 810, 14794, 1109, 1618, 482, 304, 1057, 1866, 13162, 482, 994, 584, 75751, 731, 1057, 14289, 323, 40652, 198, 2336, 315, 12459, 320, 1820, 711, 8138, 315, 279, 27850, 315, 279, 13836, 570, 4359, 320, 269, 22037, 11, 422, 499, 4587, 8, 6835, 603, 264, 4459, 502, 6140, 369, 264, 502, 198, 6200, 22766, 2324, 627, 2460, 63278, 685, 2011, 3240, 1618, 304, 279, 2547, 11, 1555, 10748, 10173, 323, 5933, 15657, 13, 5112, 11, 1120, 617, 10082, 11, 2503, 1203, 323, 3821, 198, 12840, 8741, 13, 13538, 701, 1866, 6548, 11, 499, 690, 7446, 1518, 12195, 430, 690, 5353, 499, 311, 5895, 520, 420, 13057, 11478, 304, 198, 9446, 430, 77536, 10863, 279, 62194, 627, 791, 57700, 315, 279, 2547, 11, 279, 7677, 315, 22037, 11, 279, 16595, 8603, 3318, 304, 22037, 323, 279, 84524, 527, 3117, 7953, 1148, 198, 414, 20663, 527, 10235, 311, 3619, 520, 3118, 627, 11769, 2294, 28378, 477, 28568, 889, 3596, 12439, 3678, 95064, 304, 51517, 323, 75372, 520, 279, 40164, 315, 7138, 13, 7566, 482, 584, 527, 198, 87655, 686, 3725, 323, 27205, 3725, 19332, 10246, 10267, 603, 3041, 13520, 264, 6140, 311, 3217, 1148, 433, 3445, 311, 387, 2216, 9498, 323, 7373, 8927, 6674, 482, 311, 2733, 279, 16267, 315, 5496, 555, 198, 6750, 287, 13520, 311, 320, 28622, 753, 8, 22037, 753, 7016, 439, 10825, 369, 893, 11, 1555, 279, 12459, 315, 5933, 320, 8416, 8, 15657, 13, 1115, 13118, 374, 198, 1820, 10461, 80884, 304, 893, 753, 7106, 11, 10723, 323, 18330, 28572, 479, 627, 52059, 3258, 328, 13, 37053, 11, 220, 4468, 18, 198, 29986, 304, 2999, 13, 37940, 783, 753, 10320, 88364, 292, 10506, 11, 6186, 220, 4468, 18, 198, 8368, 19707, 25, 578, 3485, 4652, 374, 5439, 311, 10552, 279, 1920, 315, 2547, 60517, 11, 9523, 311, 13241, 10173, 1701, 5933, 15657, 11, 323, 374, 539, 311, 387, 5938, 198, 4291, 279, 28782, 315, 904, 3230, 2027, 9076, 369, 6412, 662, 1763, 24901, 11, 358, 1053, 1093, 311, 2997, 264, 10015, 1162, 62474, 315, 264, 1455, 16358, 13654, 505, 1054, 4438, 358, 6193, 6142, 763, 3376, 481, 26211, 89874, 1729, 264, 24772, 84, 897, 589, 11, 56728, 16958, 8219, 11, 452, 920, 13, 1102, 374, 1101, 5343, 439, 65814, 426, 304, 1054, 68500, 315, 279, 29950, 27304, 49216, 32, 80199, 30442, 5288, 1753, 39419, 3083, 3680, 72076, 4393, 20076, 34, 643, 6328, 25002, 198, 7614, 984, 362, 38788, 6328, 362, 53951, 88227, 13990, 1829, 965, 198, 1729, 56728, 16958, 8219, 198, 791, 2768, 374, 505, 279, 2363, 2650, 358, 6193, 6142, 763, 3376, 481, 26211, 555, 56728, 16958, 8219, 11, 39544, 345, 4291, 264, 4741, 555, 2999, 13, 40904, 37919, 9211, 320, 849, 3571, 8612, 11, 79028, 51028, 11, 452, 7659, 13, 220, 4468, 20, 4390, 15859, 7388, 2999, 13, 31552, 328, 13, 37053, 256, 320, 21982, 8, 220, 23802, 12, 3965, 15, 262, 8604, 962, 10910, 395, 916, 220, 1032, 2468, 279, 4325, 315, 220, 843, 11, 56728, 16958, 8219, 1766, 5678, 311, 387, 264, 11996, 315, 264, 9200, 1376, 320, 459, 391, 52279, 220, 4248, 1814, 46159, 220, 89468, 8, 315, 19689, 198, 438, 28691, 9572, 11, 3544, 323, 304, 3376, 481, 11, 304, 220, 5162, 15, 11, 323, 555, 51297, 16565, 315, 5933, 21730, 389, 813, 1866, 20770, 11, 1903, 198, 276, 16907, 4686, 13654, 320, 300, 11007, 555, 6593, 1817, 8772, 705, 449, 912, 76293, 315, 904, 13803, 315, 279, 8624, 198, 2000, 279, 3347, 220, 975, 1667, 627, 13538, 568, 6137, 813, 659, 41206, 11, 568, 1047, 264, 49629, 520, 279, 1203, 315, 813, 28691, 902, 6137, 311, 40978, 449, 2225, 813, 8982, 323, 198, 2332, 7331, 287, 13, 1283, 574, 16812, 750, 459, 8274, 11, 1047, 21249, 72188, 8415, 1138, 71, 449, 75568, 19689, 12704, 6910, 11, 574, 9193, 198, 336, 582, 10234 ]
0xBreath/holistic-books
one usually becomes hypersensitive to that food for a period lasting from a few weeks to several months. After this, the sensitivity to the offending food gradually declines. If during the hypersensitive period you are occasionally exposed to the allergenic food, then an immediate strong reaction may be triggered resulting in pain, weakness, a rash or whatever its characteristic effect is on your body. If this is done repeatedly but separated by at least f our days between exposures, this may delay the complete recovery but is not likely to result in serious internal damage. However, if you use this food again daily then after a while you do not get any more reaction, but a chronic condition may gradually dev elop. Generally, it is essential to avoid the offending food as much as possible for an extended period in order to heal yourself completely. Depending on the severity of your initial symptoms or degenerative disease this may be from a few months up to sev eral years. Elimination Testing For five days or longer you abstain from all commonly eaten food. Best to combine elimination testing with a cleanse as recommended in chapter 6. Otherwise, you may just eat low -allergy foods such as cooked vegetables and preferably varieties that you have not recently eaten. Flavour with olive oil and salt. During this time, try to minimize other potential allergic influences such as solvents, or car exhaust fumes, house dust, moulds, gas, or cigarette smoke, basically anything with strong or unusual smells. Starting on the second day there may be more or less troublesome withdrawal symptoms with cravings for the food or stimulant to which one is addicted, be it alcohol, nicotine or other drugs. There may be headaches, dizziness, weakness and other problems. On the fourth day these symptoms usually subside, and one begins to feel much better. Often symptoms of long -standing ailments such as 45 arthritis, heart disease or schizophrenia may disappear o r improve as well. If you do not feel right by the fifth day, it may be better to extend the fast until you improve. Chemicals and drugs, whether medical or recreational, take much longer to clear from the body. It may lessen discomfort if you take a stron g laxative on the first morning of the fast. In addition, drink a lot of water or diluted herb tea. After the Cleanse or on the morning of day six, have a small amount of test food. Check your pulse for a full minute before, and 30 and 60 minutes after th e meal. Always test sitting in the same position, and when the pulse rate is not increased from any previous activity. Then have several smaller test meals of different foods during the day. In the beginning, test mainly foods that you expect to be safe. Test suspected allergenic foods at the last meal of the day so that you can sleep off any prolonged reactions. Use suspect foods only individually or with previously tested non -reactive foods. Before and after each test meal make the pulse tests and any ot her relevant tests. If the pulse rate increases by more than 10% after the meal, then this indicates a potential allergy. The greater the increase - the stronger the allergy. If there is a reaction involving a combination of newly tested foods, repeat test ing the individual foods at a later date. In addition, make other tests relevant to your condition. W ith weak eyesight check your reading ability using a wall chart; school children may be tested for clarity of writing and speech. Check the range and pain level of impaired joints or muscles and watch out for sign of bodily or emotional discomfort. Keep a detailed diary of the pulse rates, measurements and any unusual happenings, feelings, discomfort and so on. Usually, urine and saliva become more acid after a reaction. You may stop a strong reaction by taking 1 level teaspoon of sodium bicarbonate (bakin g soda) and, if available, potassium as citrate, carbonate or bicarbonate. Test offending foods again after three to six months. 46 Commonly small infrequent amounts are then tolerated. Eat suspect or problem foods not more than once a week. If conditions det eriorate again, test again or adopt a safe low -allergy diet. The body is less sensitive to allergic reactions when using alkalizers and digestive enzymes. THE ACID - ALKALINE BALANCE Our blood is slightly alkaline, and the body makes every effort to maintain this alkalinity at a constant level. For this purpose, we normally have an ample reserve of alkaline minerals. Most of our food supplies minerals. The total balance of minerals in a particular food may be either acid or alkaline. In plants strongly alkaline metal ions such as sodium, potassium, calcium and magnesium, are combined with weak organic acids. A surplus of organic acids will make the food taste acidic, as in f ruits. However, in the body organic acids are metabolized, and this leaves an alkaline mineral residue. This makes vegetables and fruits alkalizing, but individuals who are overacid because of Candida and allergies often cannot oxidize all organic acids and need to neutralize acidic food to avoid becoming even more acidic. Animal tissue, on the other hand, contains a high percentage of strongly acid phosphoric acid bound to mildly alkaline proteins. The proteins will be metabolized, and a strongly acid resi due remains. Accordingly, we may classify our food as either alkaline -forming or as acid -forming. • Alkaline -forming Foods are sprouted seeds, vegetables and their juices, fruits, almonds, most legumes, the outer parts of potatoes, bananas, millet, buckwhe at and brown rice. • Acid -forming Foods are meat, fish, eggs, cheese, most grains and nuts (being high in phosphoric acid), and the core of potatoes. • Neutral Foods are refined starches and sugar, fats and oils. In order to maintain an ample alkaline body reserve, we may eat about 80% alkalizing to 20% acidifying food. There are food tables to show the acid or alkaline equivalents. However, these are practically useless as 47 some foods change their values in the bod y due to metabolic problems. Sugar, which is chemically neutral and even alkalizing fruits, can become acid-forming in sensitive individuals due to the formation of lactic acid. The same applies to any food to which you are allergic. On the other hand, he avy meat eating can eventually lead to an over -alkaline condition by slowing the metabolism and creating a deficiency of metabolic acids. Alkaline -forming food may also become acid -forming if it is incorrectly combined with other foods, or when you are emotionally upset. While seeds are commonly alkalizing if sprouted or fermented, when cooked, minerals may not be available as they remain bo und to phytates, and then may be acid -forming. All of this is contrary to what you would expect by using acid -alkaline food tables. Furthermore, the mineral content of foods varies greatly depending on soil and storage conditions, production methods and co oking. Therefore, the only reliable method is to observe your body, skin sensitivity, tendency towards inflammations, allergic reactions, and test the acidity of your urine and saliva. Alkalizing the Body When our body is too acid it is also more sensitive - emotionally as well as physically. Skin and mucous membranes become very sensitive to irritants, any allergic reactions are greatly intensified, and inflammations may be intense and widespread. With Candida and leaky gut syndrome the body generally is t oo acid. The strongest alkalizing foods are spirulina, barley grass and wheatgrass powder, fresh green vegetable juices and vegetable broth. Those who are overacid and sensitive may become even more so with cider vinegar, kefir and fruit acids. However, dissolving dolomite or magnesium oxide in vinegar or lemon juice until nearly neutral makes it a highly alkalizing remedy. Sodium bicarbonate is most com monly used to alkalize the body. On the other hand, for those with raised blood pressure, high blood fat or cholesterol levels and insensitive skin, acid fruits and their juices are excellent without neutralization. In this case potassium bicarbonate may 48 be used to alkalize. With muscle weakness try malic acid neutralized with magnesium oxide or carbonate. Take so much alkalizer that your urine is mostly above pH 7 or slightly alkaline (pH 7 is neutral). To check your urine, you may buy pH paper with a range from 4 or 5 to 8 or 9 or you may use turmeric powder: dissolve a teaspoonful in half a litre of methylated spirits (methanol), shake and allow to settle, producing a yellow solution. For a test pour some of this solution into a test tube or small drinking glass. Add a few drops of urine or saliva. If it turns ruby red, then what was added had a pH greater than 6.8 (neutral or alkaline). If it stays yellow, then the pH is less than 6.8 (acid). With digestive problems also c heck the saliva acidity. Before a meal the normal acidity of the saliva is 6.
[ 832, 720, 44066, 9221, 87752, 19245, 311, 430, 3691, 369, 264, 4261, 29869, 505, 264, 720, 71830, 5672, 311, 3892, 4038, 13, 4740, 420, 11, 279, 27541, 311, 279, 70669, 720, 14239, 27115, 58054, 13, 2355, 2746, 2391, 279, 87752, 19245, 4261, 499, 527, 23781, 15246, 311, 279, 720, 543, 2431, 56989, 3691, 11, 1243, 459, 14247, 3831, 13010, 1253, 387, 22900, 720, 1407, 287, 304, 6784, 11, 23948, 11, 264, 57342, 477, 8996, 1202, 29683, 2515, 374, 720, 263, 701, 2547, 13, 1442, 420, 374, 2884, 19352, 719, 19180, 555, 520, 3325, 282, 1057, 720, 14097, 1990, 70530, 11, 420, 1253, 7781, 279, 4686, 13654, 719, 374, 720, 1962, 4461, 311, 1121, 304, 6129, 5419, 5674, 13, 4452, 11, 422, 499, 1005, 420, 720, 14239, 1578, 7446, 1243, 1306, 264, 1418, 499, 656, 539, 636, 904, 810, 13010, 11, 220, 719, 720, 64, 21249, 3044, 1253, 27115, 3567, 658, 454, 13, 2355, 77641, 1174, 433, 374, 7718, 311, 5766, 279, 70669, 3691, 439, 1790, 439, 3284, 720, 2000, 459, 11838, 4261, 304, 2015, 311, 27661, 6261, 6724, 13, 40730, 720, 263, 279, 31020, 315, 701, 2926, 13803, 477, 5367, 75989, 8624, 420, 1253, 720, 1395, 505, 264, 2478, 4038, 709, 311, 102878, 2781, 278, 1667, 13, 2355, 42113, 2617, 27866, 2355, 2520, 4330, 2919, 477, 5129, 499, 63944, 467, 505, 682, 17037, 35661, 3691, 13, 7252, 720, 998, 16343, 44032, 7649, 449, 264, 81155, 439, 11349, 304, 720, 41326, 220, 21, 13, 18715, 11, 220, 499, 1253, 1120, 8343, 3428, 482, 543, 43043, 15657, 1778, 439, 30205, 720, 83571, 4893, 323, 52754, 36680, 430, 499, 617, 539, 6051, 35661, 13, 720, 3968, 27089, 449, 33213, 5707, 323, 12290, 13, 12220, 420, 892, 11, 1456, 311, 30437, 1023, 720, 93036, 57596, 34453, 1778, 439, 2092, 48764, 11, 477, 1841, 17960, 282, 19131, 11, 720, 7830, 16174, 11, 51370, 82, 11, 6962, 11, 477, 36213, 16603, 1174, 13524, 4205, 449, 720, 4620, 477, 19018, 50737, 13, 2355, 25639, 389, 279, 2132, 1938, 1070, 1253, 387, 810, 477, 2753, 78518, 720, 63546, 278, 13803, 449, 89928, 369, 279, 3691, 477, 12936, 69733, 311, 902, 832, 720, 285, 57727, 11, 387, 433, 13200, 11, 50011, 477, 1023, 11217, 13, 5996, 3947, 1253, 387, 55403, 11, 294, 97745, 11, 23948, 323, 1023, 5435, 13, 2355, 1966, 279, 11999, 1938, 1521, 13803, 6118, 1207, 3002, 11, 220, 323, 832, 12302, 311, 720, 57676, 1790, 2731, 13, 36016, 13803, 315, 1317, 482, 10276, 82907, 1778, 439, 220, 1774, 720, 55652, 11, 4851, 8624, 477, 58533, 1253, 32153, 297, 436, 7417, 439, 720, 9336, 13, 720, 2746, 499, 656, 539, 2733, 1314, 555, 279, 18172, 1938, 11, 433, 1253, 387, 2731, 311, 13334, 279, 5043, 720, 39830, 499, 7417, 13, 36424, 82, 323, 11217, 11, 3508, 6593, 477, 37100, 11, 720, 23609, 1790, 5129, 311, 2867, 505, 279, 2547, 13, 1102, 1253, 76970, 44776, 422, 499, 720, 23609, 264, 78161, 342, 74830, 1413, 389, 279, 1176, 6693, 315, 279, 5043, 13, 763, 5369, 11, 220, 7172, 264, 720, 9363, 315, 3090, 477, 80703, 39999, 15600, 13, 2355, 6153, 279, 9785, 325, 477, 389, 279, 6693, 315, 1938, 4848, 11, 617, 264, 2678, 3392, 315, 720, 1985, 3691, 13, 4343, 701, 28334, 369, 264, 2539, 9568, 1603, 11, 323, 220, 966, 323, 220, 1399, 720, 38137, 1306, 270, 384, 15496, 13, 24119, 1296, 11961, 304, 279, 1890, 2361, 11, 323, 994, 720, 1820, 28334, 4478, 374, 539, 7319, 505, 904, 3766, 5820, 13, 2355, 12487, 617, 3892, 9333, 1296, 21644, 315, 2204, 15657, 2391, 279, 1938, 13, 720, 644, 279, 7314, 11, 1296, 14918, 15657, 430, 499, 1755, 311, 387, 6220, 13, 3475, 720, 86521, 4136, 25405, 56989, 15657, 520, 279, 1566, 15496, 315, 279, 1938, 779, 430, 499, 649, 720, 26894, 1022, 904, 44387, 25481, 13, 5560, 15562, 15657, 1193, 32399, 477, 720, 4291, 8767, 12793, 2536, 482, 3007, 535, 15657, 13, 13538, 323, 1306, 1855, 1296, 720, 42880, 1304, 279, 28334, 7177, 323, 904, 14479, 1077, 9959, 7177, 13, 1442, 279, 28334, 4478, 720, 43842, 2315, 555, 810, 1109, 220, 605, 4, 1306, 279, 15496, 11, 1243, 420, 15151, 264, 4754, 720, 543, 43043, 13, 578, 7191, 279, 5376, 482, 279, 16643, 279, 60754, 13, 1442, 1070, 374, 264, 720, 60307, 16239, 264, 10824, 315, 13945, 12793, 15657, 11, 13454, 1296, 6892, 279, 720, 55977, 15657, 520, 264, 3010, 2457, 662, 720, 644, 5369, 11, 220, 1304, 1023, 7177, 9959, 311, 701, 3044, 13, 468, 78942, 7621, 720, 58331, 492, 1817, 701, 5403, 5845, 1701, 264, 7147, 9676, 26, 2978, 2911, 720, 18864, 387, 12793, 369, 32373, 315, 4477, 323, 8982, 13, 4343, 279, 2134, 323, 6784, 720, 3374, 315, 50160, 35358, 477, 24569, 323, 220, 3821, 704, 369, 1879, 315, 48131, 477, 720, 336, 41964, 44776, 13, 13969, 264, 220, 11944, 47242, 315, 279, 28334, 7969, 11, 720, 48899, 1392, 323, 904, 19018, 3621, 826, 11, 16024, 11, 44776, 323, 779, 720, 263, 13, 2355, 71744, 11, 220, 40335, 323, 85657, 3719, 810, 13935, 1306, 264, 13010, 13, 1472, 1253, 720, 9684, 264, 3831, 13010, 555, 4737, 220, 16, 2237, 42384, 315, 39695, 60831, 97342, 720, 1921, 43330, 342, 39962, 8, 323, 11, 422, 2561, 11, 62275, 439, 6681, 7853, 11, 84443, 477, 2355, 94598, 97342, 13, 3475, 70669, 15657, 1578, 1306, 2380, 311, 4848, 4038, 13, 220, 2790, 720, 7874, 398, 2678, 4225, 70791, 15055, 527, 1243, 66441, 13, 45614, 15562, 477, 720, 35686, 15657, 539, 810, 1109, 3131, 264, 2046, 13, 1442, 4787, 3474, 2781, 2521, 349, 720, 33871, 11, 1296, 1578, 477, 11142, 264, 6220, 3428, 482, 543, 43043, 10173, 13, 578, 2547, 374, 2753, 720, 82, 19245, 311, 57596, 25481, 994, 1701, 66787, 12509, 323, 60071, 720, 17007, 79809, 13, 2355, 17673, 10807, 926, 482, 8927, 42, 984, 4069, 70245, 8606, 2355, 8140, 6680, 374, 10284, 66787, 483, 11, 323, 279, 2547, 3727, 1475, 5149, 311, 10519, 720, 576, 66787, 13797, 520, 264, 6926, 2237, 13, 1789, 420, 7580, 11, 220, 584, 14614, 617, 459, 720, 1545, 21137, 315, 66787, 483, 34072, 13, 2355, 13622, 315, 1057, 3691, 17135, 34072, 13, 578, 2860, 8335, 315, 34072, 304, 264, 720, 4581, 24553, 3691, 1253, 387, 3060, 13935, 477, 66787, 483, 13, 763, 11012, 16917, 66787, 483, 720, 55108, 65125, 1778, 439, 39695, 11, 62275, 11, 35719, 323, 61933, 11, 527, 720, 67407, 449, 7621, 17808, 33969, 13, 362, 41548, 315, 17808, 33969, 690, 1304, 720, 1820, 3691, 12945, 84903, 11, 439, 304, 282, 11369, 1220, 13, 4452, 11, 304, 279, 2547, 17808, 33969, 527, 720, 4150, 53904, 1534, 11, 323, 420, 11141, 459, 66787, 483, 25107, 49232, 13, 1115, 3727, 720, 83571, 4893, 323, 26390, 66787, 4954, 11, 719, 7931, 889, 527, 927, 58156, 720, 28753, 315, 94916, 64, 323, 58742, 3629, 4250, 36172, 553, 682, 17808, 33969, 720, 438, 1205, 311, 21277, 553, 84903, 3691, 311, 5766, 10671, 1524, 810, 84903, 13, 2355, 42515, 20438, 11, 389, 279, 1023, 1450, 11, 5727, 264, 1579, 11668, 315, 16917, 720, 58156, 33088, 27456, 13935, 6965, 311, 76949, 66787, 483, 28896, 13, 578, 28896, 690, 720, 1395, 28168, 1534, 11, 220, 323, 264, 16917, 13935, 594, 72, 4245, 8625, 13, 63909, 11, 584, 720, 18864, 49229, 1057, 3691, 439, 3060, 66787, 483, 482, 55857, 477, 439, 13935, 482, 55857, 13, 2355, 6806, 1708, 36641, 483, 482, 55857, 40160, 220, 527, 8314, 19042, 19595, 11, 24822, 323, 872, 720, 65959, 11, 26390, 11, 88922, 11, 1455, 2531, 19131, 11, 279, 16335, 5596, 315, 720, 35267, 11, 68442, 11, 112455, 11, 22786, 86, 383, 520, 323, 14198, 20228, 13, 2355, 6806, 50234, 482, 55857, 40160, 220, 527, 13339, 11, 7795, 11, 19335, 11, 17604, 11, 1455, 41936, 720, 323, 31049, 320, 35214, 1579, 304, 33088, 27456, 13935, 705, 323, 279, 6332, 315, 35267, 13, 2355, 6806, 59794, 40160, 527, 38291, 70181, 288, 323, 13465, 11, 50127, 323, 32462, 13, 2355, 644, 2015, 311, 10519, 459, 42853, 66787, 483, 2547, 21137, 11, 584, 1253, 8343, 922, 720, 1490, 4, 66787, 4954, 311, 220, 508, 4, 13935, 7922, 3691, 13, 2684, 527, 3691, 12920, 311, 1501, 279, 720, 58156, 477, 66787, 483, 86106, 13, 4452, 11, 1521, 527, 32367, 29948, 439, 220, 2618, 720, 1063, 15657, 2349, 872, 2819, 304, 279, 30111, 379, 4245, 311, 41861, 5435, 13, 2355, 84514, 11, 902, 374, 8590, 2740, 21277, 220, 323, 1524, 66787, 4954, 26390, 11, 649, 3719, 720, 58156, 8627, 287, 304, 16614, 7931, 4245, 311, 279, 18488, 315, 326, 24045, 13935, 13, 720, 791, 1890, 17208, 311, 904, 3691, 311, 902, 499, 527, 57596, 13, 1952, 279, 1023, 720, 10888, 11, 568, 1860, 88, 13339, 12459, 649, 9778, 3063, 311, 459, 927, 482, 1727, 278, 483, 720, 9233, 555, 48408, 279, 39097, 323, 6968, 264, 48294, 315, 720, 4150, 57565, 33969, 13, 2355, 2149, 36641, 483, 482, 55857, 3691, 1253, 1101, 3719, 13935, 482, 55857, 422, 433, 374, 44447, 720, 67407, 449, 1023, 15657, 11, 477, 994, 499, 527, 38683, 23268, 13, 6104, 720, 325, 6910, 527, 17037, 66787, 4954, 422, 8314, 19042, 477, 96080, 11, 994, 30205, 11, 720, 1083, 17822, 1253, 539, 387, 2561, 439, 814, 7293, 712, 2073, 311, 1343, 16820, 988, 11, 323, 720, 3473, 1253, 387, 13935, 482, 55857, 13, 2052, 315, 420, 374, 26102, 311, 1148, 499, 1053, 1755, 720, 1729, 1701, 13935, 482, 1727, 278, 483, 3691, 12920, 13, 24296, 11, 279, 25107, 2262, 315, 720, 96420, 35327, 19407, 11911, 389, 17614, 323, 5942, 4787, 11, 5788, 720, 36842, 323, 1080, 5509, 287, 13, 15636, 11, 279, 1193, 15062, 1749, 374, 311, 23846, 720, 22479, 2547, 11, 6930, 27541, 11, 31954, 7119, 26288, 811, 11, 57596, 720, 265, 4109, 11, 323, 1296, 279, 98026, 315, 701, 40335, 323, 85657, 13, 2355, 2149, 36641, 4954, 279, 14285, 2355, 4599, 1057, 2547, 374, 2288, 13935, 433, 374, 1101, 810, 16614, 220, 482, 38683, 439, 1664, 720, 300, 22655, 13, 28049, 323, 65104, 788, 79348, 3719, 1633, 16614, 311, 720, 404, 1018, 1821, 11, 904, 57596, 25481, 527, 19407, 79849, 11, 323, 26288, 811, 720, 18864, 387, 19428, 323, 24716, 13, 3161, 94916, 64, 323, 24237, 88, 18340, 28439, 720, 1820, 2547, 8965, 374, 259, 57009, 13935, 13, 2355, 791, 31005, 66787, 4954, 15657, 527, 18823, 360, 2259, 11, 81817, 16763, 323, 34153, 54454, 720, 22491, 1126, 11, 7878, 6307, 36581, 65959, 323, 36581, 45993, 13, 13266, 889, 527, 720, 2017, 58156, 323, 16614, 1253, 3719, 1524, 810, 779, 449, 66155, 47205, 11, 2004, 92736, 720, 438, 14098, 33969, 13, 4452, 11, 14091, 20222, 21968, 86903, 477, 61933, 51180, 304, 720, 62301, 12440, 477, 30564, 23661, 3156, 7154, 21277, 3727, 433, 264, 7701, 66787, 4954, 720, 1864, 9497, 13, 83541, 220, 60831, 97342, 374, 1455, 470, 1647, 398, 1511, 311, 66787, 553, 279, 2547, 662, 2355, 1966, 279, 1023, 1450, 11, 220, 369, 1884, 449, 9408, 6680, 7410, 11, 1579, 6680, 8834, 720, 269, 39086, 5990, 323, 71580, 6930, 11, 13935, 26390, 323, 872, 65959, 527, 720, 327, 25777, 2085, 21277, 2065, 13, 763, 420, 1162, 220, 62275, 60831, 97342, 220, 1253, 220, 2166, 720, 387, 1511, 311, 66787, 553, 662, 3161, 16124, 23948, 1456, 8811, 292, 13935, 21277, 1534, 449, 720, 76, 3326, 41930, 51180, 477, 84443, 13, 5996, 18293, 779, 1790, 66787, 3213, 430, 701, 40335, 374, 10213, 3485, 37143, 220, 22, 477, 10284, 720, 1727, 278, 483, 320, 79, 39, 220, 22, 374, 21277, 570, 2057, 1817, 701, 40335, 11, 220, 499, 1253, 3780, 37143, 5684, 720, 4291, 264, 2134, 505, 220, 19, 477, 220, 20, 311, 220, 23, 477, 220, 24, 477, 499, 1253, 1005, 13535, 2165, 17138, 25, 720, 67, 1056, 4035, 264, 42384, 1285, 304, 4376, 264, 92469, 315, 79574, 660, 31739, 320, 69991, 39710, 705, 720, 30761, 323, 2187, 311, 25760, 11, 17843, 264, 14071, 6425, 13, 1789, 264, 1296, 5019, 720, 15031, 315, 420, 6425, 1139, 264, 1296, 14019, 477, 2678, 16558, 9168, 13, 2758, 264, 2478, 720, 91612, 315, 40335, 477, 85657, 13, 1442, 433, 10800, 46307, 2579, 11, 1243, 1148, 574, 3779, 1047, 264, 720, 79, 39, 7191, 1109, 220, 21, 13, 23, 320, 60668, 477, 66787, 483, 570, 1442, 433, 27656, 14071, 11, 1243, 279, 37143, 374, 720, 1752, 1109, 220, 21, 13, 23, 320, 58156, 570, 2355, 2409, 60071, 5435, 1101, 272, 47781, 279, 85657, 98026, 13, 220, 13538, 264, 15496, 720, 1820, 4725, 98026, 315, 279, 85657, 374, 220, 21, 13 ]
0xBreath/holistic-books
:Calendulahelpsthelayersoftheskin(the epithelium)to'knit'backtogetherandwillmenda cleanwoundinamatterofhours.Ithealssorapidly thatitcansealdirtintothebody,soalwayscleanthe woundverycarefullybeforeapplyingCalendula. Burns/scalds(seconddegree) UseCalendulacreamorlotionforthelaterstagesofa burnoncethepainhaspassed.Calendulawillpromote newskingrowthandisespeciallyusefulwhere blistershavebroken. Childbirth MassageCalendulaoilintotheperineumduringlabour tosoftentheareaandtohelpmakeanepisiotomy unnecessary. Crackednipples IfPhytolaccahasfailedtohelp,applyCalendulaoint- ment,orcreamifsensitivetolanolin,tohealcracked, painfulnipples. Cuts/wounds Applyointmentorcreamtominorcuts,andbandage ifnecessary.Forseriouswoundsapplylotionona pieceoflintorgauzeandkeepinplace.Useaplant sprayfilledwithlotiontokeepthedressingdampbut donotremovethedressinguntilthebleedinghas stoppedandhealingiswellunderway. Eczema/rashes Calendulalotionorcreamisespeciallyusefulforsooth- ingeczemaorrasheswheretheskinhascrackedor beenscratchedraw.Itwillnottreattheunderlying causeoftheeczema;youshouldseekprofessional helpforthis. Handcream Calendulacreammakesamarvelloushandcreamafter gardeningorworkingonthecarwhentheremaybe littlecutsintheskin. Mouthwash Useastronglotionaftertoothextractionsorafterany sortofdentalworkwherethegumshavebeencut. Nappyrash Useointmentorcreamseveraltimesdaily,making surethatthewholeareaiscleananddryfirst(wash withwaterandamild,unscentedsoap).Seealso Symphytum. Sunburn Usethelotionorcream(seeBurnsabove). EXTERNALMATERIAMEDICA Hypercal •33 Thrush Forvaginalthrushdouchewiththefollowingmixture torelievesorenessanditching:makeonepintof chamomiletea(onepintofboilingwatertoonetable- spoonofdriedchamomileleavesoronechamomile teabag).Leavetocool,strain,add40dropsofCalen- dulatinctureanddouchetwicedailyforuptoaweek only.Youcanbuyare-usabledouchefromlarger chemists(notthedisposabletypewhichcomeswith itsownsolution).Douchingwillnotcurethecom- plaint;itwillonlyhelpduringtheacutephase(see page225),andyoushouldseekprofessionalhelp. Euphrasia(Euphr.) Eyeinfections/inflammations/injuries UseEuphrasiawhenevertheeyeneedsbathing- whether itissoreaftertheremovalofdirtorgrit,after swimminginachlorinatedpool,whenirritatedby hayfeverorwhenactuallyinfectedorinflamed. IfEuphrasiadoesn'thelp,useHypercaltincture (seeopposite).Somepeoplefinditmoreeffective, especiallyinthecaseofinfection. Itisessentialtousecooled,boiledwaterinan eyebath,andtocleantheeyebathitselfwithboiling wateraftereacheyeisbathedtopreventthespreadof infection. HAMAMELIS(Ham.) Hamamelis,orwitchhazel,iswidelysoldinchemistsas distilledwitchhazel,butitisneitherasastringentnor aseffectiveasthetinctureavailablefromhomeopathic pharmacies.Usethedistilledformifthisisallyoucan find. Bruises Hamamelisisusefulforbruiseswheretheskinhasbeen broken(Arnicaisforuseonunbrokenskinandis thereforeinappropriate).UseHamamelisinthesame wayasArnica,asanointment,creamorlotion. Piles Applyacompressofthelotion(youcanuseasmall sanitarytowelorastripofcottonwool)toprovide instantrelieffrompain.Keepinplaceforawhile(upto anhour,twicedaily)toreduceinflammation. Alternatively,AesculusandHamamelisointmentor creammaybeappliedasoftenasnecessary. Itis essentialthatthecorrectinternalhomeopathicremedy isgivensothatthepilesaretreatedfromtheinsideand realhealingcantakeplace.Varicoseveins Applythelotiontovaricoseveins,especiallypainful ones,bywrappingtheleginlotion-soakedbandages. Leaveinplaceforaslongaspossible,untilthediscom- forteasesandthenuseonlywhenneeded.Anelastic (tube)bandageoverthetopwillkeepbandagesin place. HYPERCAL® ThisisamixtureofCalendulaandHypericum;the combinedhealingqualitiesofthetwoplantsmakeit especiallyeffectiveinsoothingandhealingwounds. Childbirth AfterchildbirthHypercal9willhelptohealacutortorn perineum.Applyastronglotiononasmallpador compresstotheaffectedarea,keeping itinplaceforup toanhouratatime,andrepeatingeveryfourhoursfor severaldays. Coldsores Diluteoneparttincturetothreepartscooled,boiled waterandapplythisstronglotionfrequentlyto coldsoresassoonastheyappear,oruseointment. Taketheappropriateinternalremedyatthesame time. Cuts/wounds Useointment,creamorlotiontohealwoundsjust asyouwoulduseCalendulaorHypericumontheir own. Soakcutfingers,toesorelbowsinabasinofwater intowhichateaspoonofHypercal9tincturehasbeen addedandgentlyremoveanybitsofdirt.Theclean woundcanthenbedressedwithasmearofthecream orointment. Eyeinfections/inflammations/injuries AsanalternativetoEuphrasia,use2dropsinan eyebathtohelpclearinflammationcausedbydust, foreignbodies,infectionorinjury.Seekprofessional helpifthesorenesspersists. Mouthulcers Usethemouthwashbelowfrequently,aswellas takingtheappropriateinternalremedy. Mouthwash Thismouthwash isgoodformouthulcers,inflamed, soreorspongygums.Makeastronglotionbydiluting 40dropsoftinctureinVspintandswooshitwell aroundthemouthafterbrushingyourteeth,then massageitintothegumswithyourfingers. 34•Hypericum(Hyp.) EXTERNALMATERIAMEDICA Sorethroat DissolveoneteaspoonofseasaltinV\pintofhot water.Add40dropsofHypercaltinctureandgargleas frequentlyasnecessary. Hypericum(Hyp.) Hypericumsoothesandhealswounds,especially wherenerveshavebeendamagedandtheinjuryis painful.Thepainsofa'Hypericumwound'aretypically shootingand/orsevere. Boils Applythelotionexternallyasacompress(onlintor gauze)andrenewiteveryfourtosixhourstorelieve painandencouragehealing.Itisimportanttotreata tendencytoboilsfromtheinsidesoseekprofessional helpifyouhavearecurringproblem. Burns(seconddegree,withblistering) SoakgauzestripsorlintinHypericumlotion,wringout andlayovertheburnedarea.Keepthebandages dampbysprayingtheareawiththelotion.Donot removetheclothuntilthepainhasceased.Hypericum isalsousefulinthefirststageofaburnonanerve-rich andthereforeverypainfulpart.Givetheappropriate internalremedy. Cuts/wounds Uselotiontobatheandcleandirtycuts/wounds, andapplyointmentbeforebandaging.Hypericum is especiallygoodwherethereareshootingpainsinor aroundthewoundandforinjuriestonerve-richparts (crushedfingersandtoes).Ifacompressisappliedtoa crushedfingerortoeandkeptdampforafewdays,a damagednailcanbepreventedfromtakinganodd shapeoncehealed. Insectbites UseneatHypericumtinctureonanyinsectbite.If swellingpersists,applythelotionasacompress,and keepinplaceforaslongasittakesfortheswellingto diminish. Piles UseacompressofHypericumlotion(orointment if preferred)forbleedingpile
[ 25, 9027, 408, 360, 1494, 1290, 31177, 301, 5184, 1073, 6509, 8148, 31524, 198, 752, 411, 301, 2411, 8, 998, 6, 19639, 275, 6, 1445, 998, 3522, 438, 14724, 76, 9895, 198, 18883, 86, 801, 258, 309, 1683, 1073, 31482, 2506, 1820, 278, 784, 269, 44221, 398, 198, 9210, 275, 4919, 325, 4852, 2154, 18614, 1820, 2664, 11, 708, 33222, 18883, 1820, 198, 86, 801, 1225, 10727, 3725, 15145, 680, 6852, 9027, 408, 5724, 627, 67313, 82, 34574, 4852, 82, 46958, 42127, 340, 10464, 9027, 408, 360, 582, 1259, 269, 75, 6082, 71627, 301, 977, 267, 1154, 1073, 64, 198, 22464, 263, 66, 19030, 92724, 4752, 36522, 732, 278, 408, 360, 675, 484, 25475, 1295, 198, 943, 4991, 287, 19632, 438, 5014, 4899, 817, 1285, 2940, 198, 65, 1638, 388, 19553, 50009, 627, 3736, 28813, 198, 88155, 9027, 408, 360, 3524, 321, 18614, 1820, 716, 483, 61345, 1711, 14717, 414, 198, 43681, 14450, 306, 383, 4903, 438, 998, 8823, 7072, 276, 752, 285, 11345, 5650, 198, 15278, 20726, 627, 16384, 11440, 77, 51660, 198, 2746, 3438, 16820, 337, 582, 936, 4752, 16479, 998, 8823, 11, 10492, 9027, 408, 5724, 787, 7058, 479, 11, 269, 47100, 22589, 729, 275, 99754, 38872, 37737, 77347, 383, 278, 5192, 11440, 345, 92724, 1285, 77, 51660, 627, 34, 6256, 6458, 3171, 198, 29597, 29019, 269, 846, 36325, 8129, 269, 23312, 51526, 7198, 425, 198, 333, 95317, 27774, 94427, 86, 3171, 10492, 75, 6082, 6863, 198, 23164, 1073, 15306, 1813, 2933, 3059, 438, 13397, 258, 2050, 9223, 73389, 519, 198, 52773, 352, 28611, 4291, 75, 6082, 998, 13397, 79371, 57881, 67, 1141, 8248, 198, 15357, 354, 1864, 869, 774, 291, 57881, 39830, 1820, 901, 16490, 4752, 198, 90963, 438, 383, 6260, 285, 9336, 8154, 3195, 627, 36, 14088, 9355, 7534, 14380, 198, 9027, 408, 360, 278, 6082, 269, 47100, 5014, 4899, 817, 1285, 2000, 708, 8942, 7058, 287, 69768, 9355, 17847, 14380, 1336, 261, 774, 288, 8148, 4752, 5192, 11440, 269, 198, 1395, 729, 5192, 35344, 1059, 28628, 14724, 77, 1751, 1244, 1820, 8154, 6852, 198, 1593, 1073, 1820, 69768, 9355, 71963, 788, 71, 619, 26797, 66886, 198, 8823, 2000, 576, 627, 2367, 47100, 198, 9027, 408, 360, 582, 1259, 80785, 15924, 73312, 788, 10888, 846, 3105, 1064, 198, 54592, 6147, 269, 21837, 6167, 762, 277, 1336, 306, 1964, 336, 50891, 198, 56492, 23312, 258, 6509, 8148, 627, 44, 2969, 70545, 198, 10464, 64, 4620, 75, 6082, 10924, 998, 8942, 39749, 4109, 6347, 1064, 3852, 198, 7003, 1073, 67, 6430, 1816, 1336, 261, 19030, 70, 372, 939, 525, 1395, 967, 332, 627, 45, 680, 11160, 1003, 198, 10464, 29019, 269, 47100, 325, 424, 3223, 1769, 49174, 13387, 1802, 198, 19643, 9210, 16142, 31520, 548, 2852, 18883, 438, 54310, 3983, 3706, 1003, 198, 4291, 13284, 438, 309, 699, 11, 11099, 1189, 291, 36112, 570, 10031, 19171, 198, 29012, 12989, 83, 372, 627, 31192, 22464, 198, 52, 751, 50222, 6082, 269, 47100, 7, 4151, 67313, 82, 49532, 4390, 96376, 44, 19706, 40, 70622, 32101, 33832, 5531, 7436, 1644, 198, 1016, 78277, 198, 2520, 85, 351, 992, 61124, 1136, 67, 3102, 98909, 339, 830, 1573, 287, 76, 13025, 198, 83, 461, 11828, 2396, 461, 2136, 438, 1641, 287, 25, 7072, 606, 79, 396, 1073, 198, 331, 309, 316, 458, 82694, 52167, 79, 396, 1073, 754, 8138, 59147, 531, 9186, 36164, 7058, 2203, 9186, 1073, 67, 4588, 331, 309, 316, 458, 273, 4798, 269, 606, 331, 309, 316, 458, 198, 668, 370, 351, 570, 2356, 402, 295, 511, 1786, 43421, 467, 11, 723, 1272, 6861, 708, 69, 9027, 268, 7058, 67, 360, 266, 7956, 554, 438, 67, 3102, 295, 86, 7725, 5179, 2000, 7717, 78, 85277, 1247, 198, 3323, 39537, 4919, 20369, 548, 26766, 2364, 3102, 830, 442, 27995, 261, 198, 2464, 1705, 25804, 339, 42925, 17877, 3737, 365, 71, 718, 6716, 4291, 198, 1220, 43456, 3294, 570, 35, 3102, 287, 14724, 1962, 66, 554, 339, 66274, 7058, 32397, 26, 275, 14724, 3323, 8823, 82977, 1820, 582, 332, 24453, 521, 7, 4151, 198, 2964, 11057, 705, 13634, 788, 71, 619, 26797, 66886, 8823, 627, 36, 455, 4171, 36259, 10953, 455, 4171, 29275, 51158, 258, 25384, 18480, 45864, 811, 18480, 90927, 198, 10464, 36, 455, 4171, 10426, 675, 71, 31845, 1820, 1216, 1994, 6910, 65, 44661, 7058, 49864, 433, 1056, 461, 10924, 700, 6868, 838, 1073, 67, 2154, 269, 911, 275, 11, 10924, 198, 2332, 41133, 258, 613, 9761, 15846, 10497, 11, 9493, 404, 1018, 660, 1729, 198, 68412, 1897, 424, 269, 9493, 74128, 13885, 1599, 269, 258, 1517, 3690, 627, 2746, 36, 455, 4171, 10426, 2172, 288, 77, 956, 8823, 11, 817, 31916, 49235, 3223, 7956, 554, 198, 7, 4151, 454, 13921, 570, 8538, 16455, 3990, 275, 6518, 78995, 345, 36046, 48121, 762, 521, 1073, 258, 13421, 627, 2181, 285, 49582, 83, 1559, 1030, 42831, 11, 754, 2230, 13284, 74276, 198, 1216, 3141, 589, 51526, 55880, 2742, 1820, 1216, 3141, 589, 275, 726, 4291, 754, 8138, 198, 13284, 10924, 9739, 19494, 285, 65, 70737, 3565, 265, 688, 6509, 21376, 1073, 198, 258, 13421, 627, 74593, 2797, 43, 1669, 11135, 309, 29275, 41041, 36662, 285, 11, 269, 5656, 71, 69426, 62510, 44715, 989, 63578, 258, 2464, 1705, 300, 198, 12489, 4473, 5656, 71, 69426, 100004, 20000, 818, 2544, 15790, 928, 306, 45807, 198, 521, 40784, 561, 14122, 7956, 554, 10547, 1527, 5227, 62209, 198, 764, 2227, 27121, 5368, 751, 42109, 380, 4473, 630, 333, 576, 285, 750, 283, 4919, 198, 3990, 627, 68977, 5014, 198, 41041, 36662, 9667, 817, 1285, 2000, 33713, 5014, 1336, 261, 774, 288, 8148, 4752, 82850, 198, 50009, 4444, 81, 11851, 2852, 2000, 817, 263, 359, 15222, 74, 729, 8148, 438, 285, 198, 19041, 1348, 258, 29228, 570, 10464, 41041, 36662, 58504, 6509, 373, 198, 3195, 300, 59431, 3074, 11, 46488, 29019, 11, 47100, 269, 75, 6082, 627, 47, 3742, 198, 29597, 45670, 1911, 1073, 339, 301, 6082, 7166, 283, 4919, 817, 10753, 543, 198, 34182, 45906, 83, 68157, 269, 561, 4664, 1073, 66, 17307, 1146, 337, 8, 3565, 299, 20013, 198, 86258, 3833, 648, 544, 442, 92724, 662, 19999, 258, 2050, 2000, 675, 71, 458, 7, 7717, 78, 198, 276, 25704, 14287, 86, 7725, 5179, 79205, 461, 13677, 258, 45864, 367, 627, 93114, 15381, 3380, 19990, 438, 41041, 36662, 285, 29019, 269, 198, 846, 8836, 50891, 391, 3523, 300, 14450, 28043, 95317, 13, 1102, 285, 198, 49582, 9210, 339, 762, 28132, 10701, 5227, 62209, 1864, 9497, 198, 285, 43068, 708, 9210, 339, 752, 3742, 11554, 2920, 1527, 1820, 42450, 438, 198, 8110, 383, 6260, 66363, 731, 2050, 89068, 292, 974, 588, 1354, 198, 29597, 339, 301, 6082, 83, 869, 277, 292, 974, 588, 1354, 11, 36046, 92724, 1285, 198, 3233, 11, 1729, 19239, 3713, 1820, 1978, 258, 75, 6082, 34119, 7897, 7198, 1154, 627, 22586, 258, 2050, 2000, 300, 4930, 300, 10236, 11, 39830, 339, 42925, 884, 7058, 4057, 68, 2315, 438, 3473, 817, 3323, 9493, 41917, 885, 8301, 5174, 198, 1175, 3845, 8, 7198, 425, 2017, 339, 295, 454, 14724, 13397, 7198, 1154, 258, 198, 2050, 627, 49952, 9851, 50633, 12175, 198, 2028, 285, 309, 13025, 1073, 9027, 408, 5724, 438, 75046, 86231, 26, 1820, 198, 67407, 383, 6260, 83465, 1073, 339, 295, 86, 56178, 1821, 7072, 275, 198, 36046, 78995, 258, 708, 78, 1626, 438, 383, 6260, 86, 3171, 627, 3736, 28813, 198, 6153, 3124, 28813, 75046, 5531, 24, 14724, 50222, 59091, 383, 278, 582, 332, 371, 1540, 198, 716, 483, 372, 37151, 64, 4620, 75, 6082, 263, 10753, 543, 79, 5477, 198, 5807, 417, 34152, 1820, 32157, 4903, 11, 33494, 433, 258, 2050, 2000, 455, 198, 998, 276, 25704, 93584, 547, 51526, 265, 65977, 30115, 35124, 31482, 2000, 198, 325, 424, 4852, 954, 627, 77518, 708, 417, 198, 35, 321, 1088, 606, 4581, 83, 7956, 554, 998, 339, 265, 752, 7183, 1030, 42831, 11, 754, 2230, 198, 13284, 438, 10492, 576, 4620, 75, 6082, 69, 70941, 998, 198, 88172, 708, 417, 395, 9186, 561, 36661, 41866, 11, 269, 817, 29019, 627, 109848, 19030, 29228, 10701, 1864, 9497, 266, 6509, 373, 198, 1712, 627, 34, 6256, 6458, 3171, 198, 10464, 29019, 11, 47100, 269, 75, 6082, 998, 383, 278, 86, 3171, 4345, 198, 6539, 283, 41450, 817, 9027, 408, 5724, 269, 75046, 86231, 263, 50828, 198, 785, 627, 4516, 587, 66, 4867, 14437, 77347, 288, 461, 21807, 4336, 258, 370, 51410, 1073, 13284, 198, 396, 363, 71, 718, 349, 300, 33076, 1073, 75046, 5531, 24, 83, 7956, 554, 4752, 82850, 198, 17249, 438, 70, 4501, 5514, 3852, 4590, 708, 7047, 2154, 11829, 18883, 198, 86, 801, 4919, 3473, 2788, 14715, 4291, 10753, 686, 1073, 339, 762, 1259, 198, 269, 29019, 627, 51158, 258, 25384, 18480, 45864, 811, 18480, 90927, 198, 2170, 276, 41512, 20053, 11269, 36, 455, 4171, 36259, 11, 817, 17, 91612, 74276, 198, 1216, 3141, 266, 427, 2319, 1290, 7574, 258, 45864, 367, 936, 2656, 1729, 109732, 345, 29543, 65, 10233, 54788, 13421, 269, 258, 42861, 77565, 66886, 198, 8823, 333, 6509, 461, 2136, 32390, 1705, 627, 44, 2969, 360, 17254, 198, 52, 751, 30132, 2969, 70545, 54277, 69, 70941, 11, 300, 9336, 300, 198, 89894, 1820, 29228, 10701, 1864, 9497, 627, 44, 2969, 70545, 198, 2028, 33780, 70545, 374, 19045, 630, 2969, 360, 17254, 54788, 1517, 3690, 345, 82, 461, 1105, 621, 4680, 70, 6370, 51233, 64, 4620, 75, 6082, 1729, 67, 321, 10831, 198, 1272, 6861, 3594, 7956, 554, 258, 53, 2203, 396, 2914, 1146, 9451, 275, 9336, 198, 20019, 49818, 2969, 10924, 37161, 287, 22479, 668, 774, 11, 3473, 198, 79685, 275, 396, 8942, 797, 372, 22966, 22479, 69, 14437, 627, 1958, 6806, 75046, 86231, 11135, 1100, 6266, 4154, 18871, 44, 19706, 40, 70622, 32101, 198, 50, 461, 87164, 198, 35, 1056, 4035, 263, 7870, 300, 33076, 1073, 325, 300, 3223, 258, 53, 59, 79, 396, 1073, 10847, 198, 13284, 1943, 1272, 6861, 708, 69, 31916, 49235, 3223, 7956, 554, 438, 70, 867, 273, 300, 198, 69, 70941, 66636, 20726, 627, 75046, 86231, 11135, 1100, 29275, 75046, 86231, 708, 78, 6509, 438, 383, 1147, 86, 3171, 11, 36046, 198, 1336, 17848, 651, 4385, 525, 1395, 408, 92920, 438, 1820, 258, 42861, 285, 198, 92724, 1285, 11829, 92724, 708, 3716, 6, 75046, 86231, 86, 801, 6, 548, 87184, 198, 939, 28562, 438, 5255, 325, 19846, 627, 1255, 8839, 198, 29597, 339, 301, 6082, 4399, 750, 300, 45670, 1911, 30455, 15306, 269, 198, 70, 2933, 3059, 8, 80281, 943, 635, 1225, 69, 29686, 437, 953, 25704, 4412, 11828, 588, 198, 92724, 438, 967, 61140, 383, 6260, 28628, 285, 15693, 28879, 265, 460, 198, 83, 21906, 83, 39619, 8839, 1527, 1820, 1354, 3422, 974, 1247, 66886, 198, 8823, 1463, 283, 19553, 548, 46839, 35686, 627, 67313, 82, 46958, 42127, 11, 4291, 2067, 1601, 287, 340, 4516, 587, 70, 2933, 89, 478, 76816, 269, 15306, 258, 75046, 292, 43331, 6082, 25576, 12928, 412, 198, 438, 6789, 2017, 1820, 22464, 291, 4903, 13, 19999, 1820, 7198, 1154, 198, 67, 1141, 65, 1065, 652, 17718, 1820, 548, 675, 411, 339, 301, 6082, 920, 263, 354, 198, 1864, 869, 19030, 89054, 39830, 339, 752, 467, 4752, 95304, 3924, 40352, 86231, 198, 285, 1147, 1559, 1285, 48121, 830, 874, 21406, 1073, 370, 399, 263, 276, 5976, 41947, 198, 438, 19041, 1348, 424, 1100, 467, 1285, 4581, 1246, 344, 19030, 29228, 198, 10701, 1864, 9497, 627, 34, 6256, 6458, 3171, 198, 3642, 301, 6082, 83, 677, 70036, 438, 9326, 438, 16938, 23312, 6458, 3171, 345, 438, 10492, 29019, 15145, 7198, 4210, 3924, 40352, 86231, 374, 198, 36046, 19045, 1336, 261, 774, 68209, 2548, 28562, 79, 1771, 258, 269, 198, 20019, 16142, 801, 438, 2000, 258, 73, 6198, 478, 263, 5976, 41947, 18753, 198, 40062, 53078, 69, 14437, 438, 998, 288, 8, 662, 2746, 45670, 1911, 285, 391, 3523, 50195, 198, 5192, 53078, 80216, 371, 4748, 438, 99020, 67, 1141, 2000, 2642, 365, 14097, 15362, 198, 15770, 3359, 77, 607, 4919, 65, 752, 265, 74228, 1527, 89894, 276, 14898, 198, 12510, 13486, 383, 5962, 627, 644, 9885, 65, 3695, 198, 3642, 1994, 266, 75046, 86231, 83, 7956, 554, 263, 3852, 258, 9885, 91035, 34001, 198, 2332, 6427, 32390, 1705, 11, 10492, 339, 301, 6082, 300, 45670, 1911, 51526, 198, 13397, 258, 2050, 2000, 300, 4930, 300, 1468, 2094, 2000, 6509, 86, 6427, 998, 198, 13223, 18675, 627, 47, 3742, 198, 10464, 45670, 1911, 1073, 75046, 292, 43331, 6082, 81020, 29019, 422, 198, 74586, 8, 2000, 901, 16490, 12470 ]
0xBreath/holistic-books
/G10/G05/G01/G06/G03/G01/G06/G0E/G07 /G20/G01/G01 /G21/G01/G0B/G12/G14/G04/G01/G22/G04/G04/G03/G01/G12/G22/G0C/G04/G01/G10/G07/G01/G22/G05/G02/G03/G0E/G01/G16/G07/G0F/G04/G01/G07/G0A/G01/G10/G0B/G04/G01/G0C/G12/G05/G0E/G04/G05/G01/G0C/G04/G16/G16/G07/G03/G16/G01/G10/G0B/G12/G10/G01/G21/G01gleaned from that expansive journey into the pages of /G01/G02/G03/G04/G06book. Cosmic Wealth 94 But they are all that I take with me now, from that previous karmic drama and debt - into the allowance of my new life adventure of a conscious inner life and my abundant cosmic wealth. My life is much lighter and free-er now, with clearer sight and greater truth. There are times in our lives when we are ready to review our current experiential “story,” the one we tell ourselves (and others) on a daily basis – and th us the one we are living, to decide if it matches the vibration of what we want or what we don’t want. It is a kind of inner housekeeping. And when we invest the time to gently look at our current story and its experience, it is very liberating to see that we truly are the authors of our lives. We write the script. We listen to our own cues. And we choose our thoughts, beliefs, dreams, and life experiences. I released that story, with the help and grace of hawk in my heart. And I chose to writ e a new one, when my inner guidance called me to do so. And in this journey, I deliberately transformed my karmic debt into cosmic wealth. That is the opportunity for us all, in our present and future creations. We are continuously writing the script for what we wish to experience. Wherever you are, and however you feel right now, remember that life is a story that is yet to be written. Dream your dreams and live your heart’s magic that is the truth of your infinite nature. I close my hawk medicine story with this aerial view of how every day can be elevated to the miraculous, simply with our willingness to open, to see, to listen, to choose, and to allow it. Every part of this enchanted forest is our friend. The natural world adds tremendous depth to our life experiences, when we allow our heart-felt experience of our oneness with all things. If we follow Hawk, and we honor the divine guidance and messages that come from Spirit in all of their forms (that feel good to us), we can soar into the sun-filled sky in beautiful celestial flight. Thank you Hawk friend. I am grateful. 95 /G14/G15/G0B/G16/G0F/G09/G08/G01/G22/G13/G0A/G0F/G09/G09/G0E/G21 Living the Prosperity of a Rich Inner Life /G25/G07/G12/G06/G0F/G09/G05/G06/G18/G05/G03/G0C/G0E/G06/G0D/G0F/G10/G10/G05/G11/G06/G01/G07/G06/G1A/G07/G12/G09/G06/G03/G0C/G0C/G05/G09/G06/G0C/G0F/G01/G12/G09/G05/G0A/G06/G06/G25/G07/G12/G06/G0F/G09/G05 being called to your inner worl d that is the true world, as compared to the world aro und you. You have all the abundance that you need in th is inner world – fruit of the finest trees, sunlight of a pure and rich variety, silver moons that warm and nourish your spirit in dream times. You have all the material elements you could ever want and need. Heal th is your “always” state of being. Confidence and gaie ty are your fabric and essence, each and every day. You smell of sweet joy. You smile at your bliss and comfort. An d you live love-fully. This is the inner world in which I invite you now. /G28 Spirit 1/5/09 It continually amazes me, upon reflection, that no matter how many channelings I receive, books from conscious teachers that I read, or life experiences that I have – the core messages within them are always the deriva tive of Source. That is the root message in the “already is” application of the Law of Attraction; that the ultimate essence of anything that you desire is the essence of Source, and that the ultimate essence of who you really are is the true essence of Source. In this way, we are always the potential vibrational match of anything we can ever need, want, or desire. We sim ply need to relax into the easy feeling essence, within ourselves and our desires, to bring the vibrations into harmonic alignmen t. This is the grand Source- ful string that connects us all, and expands our non-physical essence toward greater understanding and light-filled expansion. There is a new consciousness, a new energy, coming to our earth experiences. It rests within the mystical world of the non-physical. And yet it is mo re real than anything we can physically see. I have transcrib ed two Spirit messages in this Cosmic Wealth 96 final chapter, that speak to these expansive energetic shifts and our ultimate experience of cosmic wealth. They seem to summarize the essence of the vastness of our earth experiences and our non-physical truths. I offer them to you now, for your own reflection. We believe the time has come for all beings to awaken to their inner, dormant light. It is a light so bright, so full, so rich - it would astound even the most skeptic of you. Because you cannot see it, with your out er eyes, does not mean it does not live within you. Inner eyes, inner vision, is a way to see, feel, and perceive that vastn ess of all that you really are. Energies surrounding the earth, and within the Earth herself, are flowing toward the greatness of the illuminating light. As these non-physical energies fill more of the spaces within the earth’s atmosphere, the vibrationa l essence within all of you - will turn toward that which burn s as bright, in its likeness. Where is that? They will turn inward – for within is where the same eternal light exists. And they will begin to see it – with a new lens, an old lens rea lly, but to them - a new one, of inner vision. Of energetic vision. Creative vision. Believing vision. There is nothing to fear. Some, who would say they prefer the darkness, then have lost their contrast. Darkn ess can only be desirable to those removed so fa r from their light that they would deny the sun. Yet, they cannot separate themselves from their “already is” truth and brilliant light. While some may continue to deny, or resist, the approaching new energetic realities, it is the same as deny ing the presence of air on your planet. Unseen, but very much in existence. There you see that the shift in energies brings a new age of expansively supportive and lovi ng energy. We want you to know that this energy already burn s bright in all of you – it is only a matter of allowing it in your field of consciousness. We understand your desire to live in the familiar. The world of what, you believe, appears to be “known.” Yet expansion requires an expectation and a llowance of change. The Living the Prosperity of a Rich Inner Life 97 “known” qualities of change often are believed to mean the “not good” or the “not wa nted.” But truthfully, if we understood “change” as an ever expansive richer Source-full flow, we would allow it instantly, and all of its feeling good- ness. You are doing your pa rt beautifully and rem arkably. We love seeing you relax and expand, relax and expand. Some will expand with ease, and some with willful fight. But expansion always comes. It is your natu re to expand. The earth itself naturally expands. Fighting e xpansion does not stop change. It simply creates resistance, and thus challenges, in finding ways to feel good. We suggest beginning to believe in your inner power, your inner light, as the flow of change shifts the world perspective. It is in allowing, that you can a ll receive the greater truth that exists in all that is, of wh ich you are an essential part. Be the person you want to be, th rough the allowance of all that
[ 611, 38, 605, 16169, 2304, 16169, 1721, 16169, 2705, 16169, 2839, 16169, 1721, 16169, 2705, 16169, 15, 36, 16169, 2589, 611, 38, 508, 16169, 1721, 16169, 1721, 198, 16169, 1691, 16169, 1721, 16169, 15, 33, 16169, 717, 16169, 975, 16169, 2371, 16169, 1721, 16169, 1313, 16169, 2371, 16169, 2371, 16169, 2839, 16169, 1721, 16169, 717, 16169, 1313, 16169, 15, 34, 16169, 2371, 16169, 1721, 16169, 605, 16169, 2589, 16169, 1721, 16169, 1313, 16169, 2304, 16169, 2437, 16169, 2839, 16169, 15, 36, 16169, 1721, 16169, 845, 16169, 2589, 16169, 15, 37, 16169, 2371, 16169, 1721, 16169, 2589, 16169, 15, 32, 16169, 1721, 16169, 605, 16169, 15, 33, 16169, 2371, 16169, 1721, 16169, 15, 34, 16169, 717, 16169, 2304, 16169, 15, 36, 16169, 2371, 16169, 2304, 16169, 1721, 16169, 15, 34, 16169, 2371, 16169, 845, 16169, 845, 16169, 2589, 16169, 2839, 16169, 845, 16169, 1721, 16169, 605, 16169, 15, 33, 16169, 717, 16169, 605, 16169, 1721, 16169, 1691, 16169, 1721, 70, 2742, 291, 505, 430, 61838, 11879, 1139, 279, 6959, 315, 611, 38, 1721, 16169, 2437, 16169, 2839, 16169, 2371, 16169, 2705, 2239, 13, 220, 95789, 60841, 720, 220, 6281, 720, 4071, 814, 527, 682, 430, 358, 1935, 449, 757, 1457, 11, 505, 430, 3766, 720, 74, 2227, 292, 20156, 323, 11897, 482, 1139, 279, 41458, 315, 856, 502, 2324, 18427, 315, 264, 17371, 9358, 2324, 323, 856, 44611, 55801, 720, 31633, 13, 220, 3092, 2324, 374, 1790, 30673, 323, 1949, 12, 261, 1457, 11, 449, 49479, 720, 82, 492, 323, 7191, 8206, 13, 2355, 3947, 527, 3115, 304, 1057, 6439, 994, 584, 527, 5644, 311, 3477, 720, 414, 1510, 2183, 1188, 532, 1054, 27583, 2476, 279, 832, 584, 3371, 13520, 320, 438, 3885, 8, 389, 264, 7446, 8197, 1389, 323, 270, 603, 279, 832, 584, 527, 5496, 11, 311, 720, 8332, 579, 422, 433, 9248, 279, 48913, 315, 1148, 584, 1390, 220, 477, 1148, 584, 720, 15357, 1431, 1390, 662, 220, 1102, 374, 264, 3169, 315, 9358, 3838, 33494, 13, 220, 1628, 994, 584, 720, 43114, 279, 892, 311, 30373, 1427, 520, 1057, 1510, 3446, 323, 1202, 3217, 11, 433, 374, 1633, 34929, 1113, 220, 311, 1518, 430, 584, 9615, 527, 279, 720, 48105, 315, 1057, 6439, 13, 220, 1226, 3350, 279, 5429, 13, 220, 1226, 9020, 311, 1057, 1866, 720, 66, 1157, 13, 220, 1628, 584, 5268, 1057, 11555, 11, 21463, 11, 19226, 11, 323, 2324, 11704, 13, 5996, 40, 6004, 430, 3446, 11, 449, 279, 1520, 323, 21507, 315, 76920, 304, 720, 2465, 4851, 13, 220, 1628, 358, 14896, 311, 2155, 384, 264, 502, 832, 11, 994, 856, 9358, 720, 24343, 685, 2663, 757, 311, 656, 779, 13, 220, 1628, 304, 420, 11879, 11, 358, 36192, 720, 4806, 291, 856, 597, 2227, 292, 11897, 1139, 55801, 12205, 13, 220, 3011, 374, 279, 720, 454, 68164, 369, 603, 682, 11, 304, 1057, 3118, 323, 3938, 53862, 13, 5996, 1687, 527, 31978, 4477, 279, 5429, 369, 1148, 584, 6562, 311, 3217, 13, 220, 11208, 424, 499, 527, 11, 220, 323, 4869, 499, 2733, 1314, 2355, 3409, 11, 6227, 430, 2324, 374, 264, 3446, 430, 374, 3686, 311, 387, 5439, 13, 220, 18308, 701, 19226, 323, 3974, 701, 4851, 753, 11204, 430, 374, 279, 220, 8206, 315, 701, 24746, 7138, 13, 220, 358, 3345, 856, 76920, 16088, 3446, 449, 420, 41884, 1684, 315, 1268, 1475, 1938, 649, 387, 32389, 311, 220, 279, 91813, 11, 5042, 449, 720, 414, 39375, 311, 1825, 11, 311, 1518, 11, 311, 9020, 11, 311, 5268, 11, 323, 311, 2187, 720, 275, 13, 220, 7357, 961, 315, 420, 98411, 13952, 374, 1057, 4333, 13, 220, 578, 5933, 720, 14957, 11621, 28040, 8149, 311, 1057, 2324, 11704, 11, 994, 584, 720, 7331, 1057, 4851, 2269, 3903, 3217, 315, 1057, 389, 24639, 449, 682, 2574, 13, 256, 1442, 584, 1833, 56423, 11, 323, 584, 16044, 279, 30467, 19351, 323, 720, 16727, 430, 2586, 505, 17326, 304, 682, 315, 872, 7739, 320, 9210, 2733, 1695, 311, 603, 705, 584, 649, 99565, 1139, 279, 7160, 44518, 13180, 304, 6366, 77480, 11213, 13, 220, 9930, 499, 56423, 4333, 13, 220, 358, 1097, 26259, 662, 11187, 720, 220, 2721, 720, 16169, 975, 16169, 868, 16169, 15, 33, 16169, 845, 16169, 15, 37, 16169, 2545, 16169, 2318, 16169, 1721, 16169, 1313, 16169, 1032, 16169, 15, 32, 16169, 15, 37, 16169, 2545, 16169, 2545, 16169, 15, 36, 16169, 1691, 2355, 45605, 279, 89813, 488, 315, 264, 8269, 37456, 9601, 33006, 16169, 914, 16169, 2589, 16169, 717, 16169, 2705, 16169, 15, 37, 16169, 2545, 16169, 2304, 16169, 2705, 16169, 972, 16169, 2304, 16169, 2839, 16169, 15, 34, 16169, 15, 36, 16169, 2705, 16169, 15, 35, 16169, 15, 37, 16169, 605, 16169, 605, 16169, 2304, 16169, 806, 16169, 2705, 16169, 1721, 16169, 2589, 16169, 2705, 16169, 16, 32, 16169, 2589, 16169, 717, 16169, 2545, 16169, 2705, 16169, 2839, 16169, 15, 34, 16169, 15, 34, 16169, 2304, 16169, 2545, 16169, 2705, 16169, 15, 34, 16169, 15, 37, 16169, 1721, 16169, 717, 16169, 2545, 16169, 2304, 16169, 15, 32, 16169, 2705, 16169, 2705, 16169, 914, 16169, 2589, 16169, 717, 16169, 2705, 16169, 15, 37, 16169, 2545, 16169, 2304, 2355, 35214, 2663, 311, 701, 9358, 4191, 75, 294, 430, 374, 279, 837, 1917, 11, 720, 300, 7863, 311, 279, 1917, 264, 299, 2073, 499, 13, 220, 1472, 617, 682, 279, 720, 370, 98681, 430, 499, 1205, 304, 270, 374, 9358, 1917, 1389, 14098, 315, 2355, 1820, 28807, 12690, 11, 40120, 315, 220, 264, 10748, 323, 9257, 8205, 11, 720, 83014, 81260, 430, 8369, 323, 46798, 819, 701, 9090, 304, 220, 8063, 3115, 13, 220, 1472, 617, 682, 279, 3769, 5540, 499, 2355, 29177, 3596, 1390, 323, 1205, 13, 220, 82130, 270, 374, 701, 1054, 33222, 863, 1614, 2355, 1073, 1694, 13, 220, 87424, 323, 13819, 648, 13892, 527, 701, 13354, 323, 28591, 11, 720, 9739, 323, 1475, 1938, 13, 220, 1472, 22843, 315, 10437, 16267, 13, 220, 1472, 15648, 720, 266, 701, 59045, 323, 6981, 13, 220, 1556, 294, 499, 3974, 3021, 12, 3725, 13, 220, 1115, 720, 285, 279, 9358, 1917, 304, 902, 358, 22114, 499, 1457, 13, 2355, 692, 611, 38, 1591, 17326, 220, 16, 14, 20, 14, 2545, 33006, 2181, 35611, 1097, 74885, 757, 11, 5304, 220, 22599, 11, 430, 912, 5030, 720, 5269, 1690, 5613, 826, 358, 5371, 11, 6603, 505, 17371, 13639, 430, 358, 1373, 11, 477, 2324, 11704, 430, 358, 617, 1389, 279, 6332, 6743, 720, 56950, 1124, 527, 2744, 279, 2761, 10126, 259, 535, 315, 8922, 13, 220, 3011, 374, 279, 720, 2959, 1984, 304, 279, 1054, 46584, 374, 863, 3851, 315, 279, 7658, 315, 720, 13675, 1335, 26, 220, 430, 279, 17139, 28591, 315, 4205, 430, 499, 12876, 374, 279, 28591, 315, 8922, 11, 323, 430, 279, 17139, 28591, 315, 889, 499, 2216, 527, 374, 279, 837, 28591, 315, 8922, 13, 220, 763, 420, 1648, 11, 584, 527, 720, 33222, 279, 4754, 220, 17358, 1697, 2489, 315, 4205, 584, 649, 3596, 720, 17483, 11, 1390, 11, 477, 12876, 13, 220, 1226, 1675, 39673, 1205, 311, 12234, 1139, 279, 4228, 720, 1897, 20659, 28591, 11, 2949, 13520, 323, 1057, 32097, 11, 311, 4546, 279, 78352, 1139, 82341, 5398, 5794, 259, 13, 220, 1115, 374, 279, 6800, 8922, 7058, 1285, 925, 430, 34161, 603, 682, 11, 220, 323, 52956, 1057, 2536, 12, 47692, 720, 434, 768, 9017, 7191, 8830, 323, 3177, 44518, 14800, 13, 262, 2684, 374, 264, 502, 25917, 11, 264, 502, 4907, 11, 5108, 311, 1057, 9578, 11704, 13, 220, 1102, 54331, 2949, 279, 69532, 1917, 315, 279, 2536, 12, 47692, 13, 220, 1628, 3686, 433, 374, 4647, 312, 1972, 1109, 4205, 584, 649, 720, 42305, 2740, 1518, 13, 220, 358, 617, 1380, 745, 65, 1608, 1403, 17326, 6743, 304, 420, 95789, 60841, 720, 220, 4161, 720, 12085, 12735, 11, 430, 6604, 311, 1521, 61838, 45955, 29735, 2355, 438, 1057, 17139, 3217, 315, 55801, 12205, 13, 220, 2435, 2873, 311, 63179, 279, 28591, 315, 279, 13057, 2136, 315, 1057, 9578, 11704, 323, 1057, 2536, 12, 47692, 53219, 13, 220, 358, 3085, 1124, 311, 499, 1457, 11, 369, 701, 2355, 785, 22599, 13, 720, 1226, 4510, 279, 892, 706, 2586, 369, 682, 23837, 311, 42518, 311, 2355, 50828, 9358, 11, 89460, 3177, 13, 220, 1102, 374, 264, 3177, 779, 10107, 11, 779, 2539, 11, 779, 2355, 14172, 482, 433, 1053, 12025, 801, 1524, 279, 1455, 55950, 315, 499, 13, 220, 9393, 720, 9514, 4250, 1518, 433, 11, 449, 701, 704, 2781, 6548, 11, 1587, 539, 3152, 433, 1587, 720, 1962, 3974, 2949, 499, 13, 220, 37456, 6548, 11, 9358, 11376, 11, 374, 264, 1648, 311, 1518, 11, 2355, 57676, 11, 323, 45493, 430, 13057, 77, 4043, 315, 682, 430, 499, 2216, 527, 13, 720, 36, 39624, 552, 14932, 279, 9578, 11, 323, 2949, 279, 9420, 11937, 11, 720, 548, 36612, 9017, 279, 63556, 315, 279, 44087, 1113, 3177, 13, 220, 1666, 1521, 2536, 12, 47692, 49969, 5266, 810, 315, 279, 12908, 2949, 279, 720, 28641, 753, 16975, 11, 279, 48913, 64, 326, 28591, 2949, 682, 315, 499, 482, 2355, 14724, 2543, 9017, 430, 902, 8395, 274, 439, 10107, 11, 304, 1202, 93874, 13, 2355, 9241, 374, 430, 30, 220, 2435, 690, 2543, 63018, 1389, 369, 2949, 374, 1405, 2355, 1820, 1890, 35825, 3177, 6866, 13, 220, 1628, 814, 690, 3240, 311, 1518, 433, 1389, 449, 264, 502, 18848, 11, 459, 2362, 18848, 312, 64, 326, 398, 11, 719, 311, 1124, 482, 264, 502, 832, 11, 2355, 1073, 9358, 11376, 13, 220, 5046, 45955, 11376, 13, 220, 25248, 11376, 13, 5996, 22404, 84446, 11376, 13, 720, 3947, 374, 4400, 311, 8850, 13, 220, 4427, 11, 889, 1053, 2019, 814, 10932, 279, 720, 23449, 2136, 11, 1243, 617, 5675, 872, 13168, 13, 220, 12538, 77, 4043, 649, 1193, 387, 720, 5919, 26014, 311, 1884, 7108, 779, 2267, 436, 505, 872, 3177, 430, 814, 720, 41450, 23973, 279, 7160, 13, 220, 14968, 11, 814, 4250, 8821, 5694, 720, 1527, 872, 1054, 46584, 374, 863, 8206, 323, 20333, 3177, 13, 220, 6104, 1063, 1253, 3136, 311, 23973, 11, 477, 22884, 1174, 279, 31047, 502, 45955, 720, 8110, 1385, 11, 433, 374, 279, 1890, 439, 23973, 6892, 279, 9546, 315, 3805, 389, 701, 2355, 51174, 13, 220, 1252, 29412, 11, 719, 1633, 220, 1790, 304, 14209, 13, 720, 3947, 499, 1518, 430, 279, 6541, 304, 49969, 12716, 264, 502, 4325, 315, 720, 4683, 598, 3210, 33445, 323, 781, 10176, 7933, 4907, 13, 220, 1226, 1390, 499, 311, 720, 33134, 430, 420, 4907, 2736, 8395, 274, 10107, 304, 682, 315, 499, 1389, 433, 2355, 285, 1193, 264, 5030, 315, 10923, 433, 304, 701, 2115, 315, 25917, 13, 720, 1687, 3619, 701, 12876, 311, 3974, 304, 279, 11537, 13, 220, 578, 1917, 2355, 1073, 1148, 11, 499, 4510, 11, 8111, 311, 220, 387, 1054, 5391, 2029, 220, 14968, 14800, 720, 42475, 459, 31293, 323, 264, 9507, 363, 685, 315, 2349, 13, 220, 578, 19048, 279, 89813, 488, 315, 264, 8269, 37456, 9601, 220, 3534, 720, 2118, 5391, 863, 29600, 315, 2349, 3629, 527, 11846, 311, 3152, 2355, 1820, 1054, 1962, 1695, 863, 477, 279, 1054, 1962, 10667, 308, 6702, 2029, 220, 2030, 8206, 3725, 11, 422, 584, 2355, 8154, 52784, 1054, 3455, 863, 439, 459, 3596, 61838, 59774, 8922, 24563, 720, 5072, 11, 584, 1053, 2187, 433, 22571, 11, 323, 682, 315, 1202, 8430, 1695, 12, 720, 2136, 13, 720, 2675, 527, 3815, 701, 7251, 17091, 32719, 323, 1323, 56317, 2915, 13, 220, 1226, 3021, 720, 66154, 499, 12234, 323, 9407, 11, 12234, 323, 9407, 13, 220, 4427, 690, 720, 33417, 449, 14553, 11, 323, 1063, 449, 690, 1285, 4465, 13, 220, 2030, 14800, 720, 33222, 4131, 13, 220, 1102, 374, 701, 18050, 84, 312, 311, 9407, 13, 220, 578, 9578, 5196, 720, 77, 72247, 52956, 13, 220, 50417, 384, 38345, 10722, 1587, 539, 3009, 2349, 13, 2355, 2181, 5042, 11705, 13957, 11, 323, 8617, 11774, 11, 304, 9455, 720, 2336, 311, 2733, 1695, 13, 720, 1687, 4284, 7314, 311, 4510, 304, 701, 9358, 2410, 11, 701, 720, 4481, 3177, 11, 439, 279, 6530, 315, 2349, 29735, 279, 1917, 13356, 13, 2355, 2181, 374, 304, 10923, 11, 430, 499, 649, 264, 9507, 5371, 279, 7191, 8206, 430, 2355, 16703, 304, 682, 430, 374, 11, 315, 421, 10864, 499, 527, 459, 7718, 961, 13, 720, 3513, 279, 1732, 499, 1390, 311, 387, 11, 270, 11413, 279, 41458, 315, 682, 430, 720 ]
0xBreath/holistic-books
either chloroform, benzene, or other fat solvents. Fats are hydrolyzed by the action of acids, alkalies, lipases (fat-splitting enzymes) and superheated steam. Fat-soluble capable of dissolving in the same organic solvents as fats and oils. Not soluble in water. Fatty Acids any one of many organic acids from which fats and oils are made. Febrifuge reduces fever (Fringe Tree, Feverfew, Tansy). Fermentation the oxidative decomposition of complex substances through the action of enzymes or ferments, produced by microorganisms; bacteria, molds, and yeasts are the principal groups of organisms involved in fermentation. Fiber the indigestible portion of plant matter. Fiber is an important component of a healthy diet because it is capable of binding to toxins and carrying them out of the body. Acts as an electrical intestinal broom. Fistula abnormal (tube-like) passage between two internal organs, or from an organ to the surface of the body. Flavin one of a group of natural water-soluble pigments occurring in milk, yeasts, bacteria, and some plants. Flavonoidial and Flavone Glycosides Glycosides have a broad range effecton the body. Each glycoside has its own individual effect as well. Some are antispasmodic, diuretic, increase circulation, and act upon cardiac tissue. Flavonoid complexes known as bioflavonoids are essential to vitamin C absorption and calcium absorption (all occur in nature together). Some flavonoid glycosides (bioflavonoids) include hesperidin, rutin, and vitamin P. Free Radicals a group of atoms that are highly chemically reactive because they have at least one unpaired electron. Because they join so readily with other compounds, free radicals can attack cells and cause a lot of damage in the body. They form in heated fats and oils, and as a result of exposure to atmospheric radiation and environmental pollutants, among other things. (A human ingests over 125 lbs. of chemicals per year. Talk about free radicals!) Fungus one of a class of organisms that include yeasts, mold, and mushrooms. A number of fungal species, such as Candida albicans, are capable of causing severe disease in immuno-compromised hosts. Galactagogue promotes secretion of milk (Anise Seed, Fennel, Vervain). Galactophyga herbs that diminish or arrest the secretion of milk (Bilberry, Cassia Bark, Cranes-bill). Gastralgia pain in the stomach. Gastritis inflammation of the stomach lining. Gastroenteritis inflammation of the mucous lining of the stomach and intestinal tract. Gland an organ or tissue that secretes a substance for use elsewhere in the body rather than for its own functioning. Giardia a genus of flagellate protozoa some of which are parasitic, found in the intestinal tract of humans and domestic animals; transmitted by ingestion of cysts in fecally-contaminated water and food; interferes with the absorption of fats; boiling water inactivates them. Gleet the mucous discharge in the urine from urethra, in cases of chronic gonorrhea. Glucose a simple sugar that is the principal source of energy for the body’s cells. Gluten vegetable albumin, a protein that can be prepared from wheat, rye, barley, and oats. Glycogen a polysaccharide (complex carbohydrate) that is the main form inwhich glucose is stored in the body, mostly in the liver and muscles. It is converted back into glucose as needed to supply the body with energy. Gout inflammation of the joints. Joints affected may be at any location, but gout usually begins in the knee or foot. Hair Analysis a method of determining the levels of minerals, including both toxic metals and essential minerals, in the body by measuring the concentrations of those minerals in the hair. Unlike mineral levels in the blood, those in the hair reflect the person’s status over several preceding months and their utilization at the cellular level. Heavy Metals metallic elements whose specific gravity (a measurement of mass as compared with the mass of water or hydrogen) is greater than 5.0. Some heavy metals, such as arsenic, cadmium, lead, and mercury, are extremely toxic. Hemetics herbs rich in iron and manganese and which augment and enrich the red corpuscles of the blood (blood-builders) (Agrimony, Quassia, Yellow Dock, Dandelion). Hemiplegia paralysis of one half of the body. Hemoglobin the red (iron-containing) pigment in blood that carries oxygen from the lungs to the tissues of the body. Hemoglobin is a conjugated protein consisting of heme (which is an iron carrier) and globin (which is a simple protein carrier). Hemolytic 1. a substance which destroys red blood cells; 2. related to the destruction of red blood cells. Hemostatic stops the flow of blood; type of astringent that stops internal bleeding or hemorrhaging. Hepatics herbs used to strengthen, tone and stimulate the secretive functions of the liver, causing an increased flow of bile (Goldenseal, Dandelion, Milk Thistle, Oregon Grape). Herbal Therapies the use of herbal combinations for healing or cleansing purposes. Herbs can be used in tinctures, tablets, capsules or extract form, as well as in baths, poultices, teas, etc. Herpatics herbs that are healing to skin eruptions and scaling diseases such as ringworm. (Buckthorn Bark, Chickweed, Cleavers, Comfrey). Histamine a chemical released by the immune system that acts on various body tissues. It has the effect of constricting the smooth bronchial tubemuscles, dilating small blood vessels, thus allowing fluid to leak from various tissues, and increasing the secretion of stomach acid. Holistic Medicine a form of therapy aimed at treating the whole person (mind, body and spirit), not just the part or parts in which symptoms occur. Homeostasis equilibrium of internal environment. Hormone chemical messengers released by the glands of the endocrine system. They are released directly into the bloodstream and carried to the tissues they affect. Hormones fall into two categories: proteins and steroids. All hormones are extremely potent. They are effective in very small amounts. Hormonal Agents herbs that contain phytosterols, or hormones used by the plant for its own growth, are compatible with female hormones and appear to work as building blocks to provide ready-made material for hormonal production. Some herbs, like Chaste Tree Berry, are thought to work on the level of the pituitary gland (the “mother of the female hormones”), and can produce either an oestrogenic or progestogenic effect, as the body turns it to its own use. Those known as oestrogenic are used to treat estrogen deficiency problems and are certainly effective (False Unicorn Root). Wild Yam provides the only known natural plant source of progesterone. Hormonal System consists of a series of tissues, glands, and cells. The glands produce chemicals (hormones) that are secreted into the bloodstream. These chemicals are either directly released into the bloodstream (through endocrine glands) or released through tubes called ducts (exocrine glands). The hormones stimulate other cells or organs. They regulate many of the body’s activities, including growth, development, and homeostasis. There may be as many as 100 hormones in the human body, but not all have been determined. The major exocrine glands are all associated with the digestive system. The major hormone-secreting endocrine glands in the body are the thyroid, adrenal, pituitary, pineal, parathyroid, and pancreas (pancreas is both exocrine and endocrine). There are two gender-specific endocrine glands— the ovaries in females, and the testes in males. Hydragogue promotes watery evacuation of bowels. Hydrochloric Acid (HCL) a normal constituent of gastric juice. The amount of HCL concentration in the stomach varies, depending on several factors, including rate of secretion of gastric juice and the type of food eaten. It converts pepsinogen into pepsin and produces an acid medium favorable for the activity of pepsin; dissolves and disintegrates nucleoproteins and collagen; hydrolyzes sucrose; precipitates caseinogen; inhibits multiplication ofbacteria, especially putrefactive organisms that ferment lactic acid and certain pathogenic forms; stimulates secretion by the duodenum; inhibits the action of ptyalin and thus stops salivary digestion in the stomach. Hyperchlorhydria excess of hydrochloric acid in gastric secretion (insufficient gastric acid output). Hyperglycemia an abnormal concentration of sugar in the blood. Hypertension chronic high blood pressure often caused by stress. Hypertensive used to increase blood pressure. Hyperthyroidism (overactive thyroid) a condition caused by excessive secretion of the thyroid glands
[ 3060, 37833, 78, 630, 345, 8123, 89, 1994, 11, 477, 1023, 8834, 2092, 48764, 13, 435, 1900, 527, 17055, 398, 16284, 555, 279, 1957, 315, 33969, 345, 1727, 278, 552, 11, 19588, 2315, 320, 45283, 79512, 1303, 56067, 8, 323, 2307, 383, 660, 20930, 627, 69557, 1355, 337, 41572, 198, 13171, 315, 14091, 20222, 304, 279, 1890, 17808, 2092, 48764, 439, 50127, 323, 198, 78, 8839, 13, 2876, 88045, 304, 3090, 627, 37, 23758, 6515, 3447, 198, 904, 832, 315, 1690, 17808, 33969, 505, 902, 50127, 323, 32462, 527, 198, 28010, 627, 6251, 1347, 333, 4838, 198, 26338, 34653, 320, 37, 85124, 9119, 11, 85001, 71830, 11, 350, 598, 88, 4390, 37, 261, 32199, 198, 279, 79401, 66266, 315, 6485, 33155, 1555, 198, 1820, 1957, 315, 56067, 477, 18728, 1392, 11, 9124, 555, 8162, 76991, 26, 24032, 345, 76, 18938, 11, 323, 20043, 12019, 527, 279, 12717, 5315, 315, 44304, 6532, 304, 198, 809, 32199, 627, 37, 8799, 198, 279, 1280, 15505, 1260, 13651, 315, 6136, 5030, 13, 54727, 374, 459, 3062, 198, 8739, 315, 264, 9498, 10173, 1606, 433, 374, 13171, 315, 11212, 311, 62186, 323, 198, 7063, 28609, 1124, 704, 315, 279, 2547, 13, 49918, 439, 459, 20314, 63900, 2967, 316, 627, 37, 380, 5724, 198, 35663, 320, 74838, 12970, 8, 21765, 1990, 1403, 5419, 36853, 11, 477, 505, 459, 198, 8629, 311, 279, 7479, 315, 279, 2547, 627, 3968, 35716, 198, 832, 315, 264, 1912, 315, 5933, 3090, 1355, 337, 41572, 24623, 1392, 31965, 304, 14403, 345, 9188, 12019, 11, 24032, 11, 323, 1063, 11012, 627, 3968, 402, 263, 590, 532, 323, 3061, 402, 606, 79183, 9594, 3422, 198, 79183, 9594, 3422, 617, 264, 7353, 2134, 2515, 263, 279, 2547, 13, 9062, 37807, 9594, 579, 706, 1202, 1866, 3927, 2515, 439, 1664, 13, 4427, 527, 198, 519, 13391, 300, 2658, 292, 11, 1891, 554, 29150, 11, 5376, 35855, 11, 323, 1180, 5304, 47345, 20438, 627, 3968, 402, 263, 590, 69125, 3967, 439, 17332, 1517, 402, 263, 17390, 527, 7718, 311, 28170, 356, 198, 3518, 66181, 323, 35719, 44225, 320, 543, 12446, 304, 7138, 3871, 570, 4427, 198, 1517, 402, 263, 590, 37807, 9594, 3422, 320, 38423, 1517, 402, 263, 17390, 8, 2997, 20365, 716, 307, 258, 11, 55719, 258, 11, 323, 28170, 393, 627, 11180, 21254, 53703, 198, 264, 1912, 315, 33299, 430, 527, 7701, 8590, 2740, 56563, 1606, 198, 20670, 617, 520, 3325, 832, 653, 77267, 17130, 13, 9393, 814, 5249, 779, 31368, 449, 198, 1605, 32246, 11, 1949, 74356, 649, 3440, 7917, 323, 5353, 264, 2763, 315, 5674, 304, 198, 1820, 2547, 13, 2435, 1376, 304, 32813, 50127, 323, 32462, 11, 323, 439, 264, 720, 1407, 315, 14675, 311, 198, 266, 8801, 33349, 25407, 323, 12434, 83661, 11, 4315, 1023, 2574, 13, 320, 32, 198, 26380, 6892, 18450, 927, 220, 6549, 29160, 13, 315, 26333, 824, 1060, 13, 19513, 922, 1949, 74356, 28684, 37, 2234, 355, 198, 832, 315, 264, 538, 315, 44304, 430, 2997, 20043, 12019, 11, 29561, 11, 323, 198, 76, 1136, 9949, 13, 362, 1396, 315, 95447, 9606, 11, 1778, 439, 94916, 64, 82698, 38473, 11, 527, 198, 11600, 481, 315, 14718, 15748, 8624, 304, 4998, 16711, 63250, 442, 4147, 18939, 627, 53619, 533, 72036, 198, 39990, 87067, 315, 14403, 320, 2127, 1082, 36922, 11, 435, 2734, 301, 11, 650, 651, 467, 4390, 53619, 533, 118930, 6885, 198, 42393, 430, 57160, 477, 8163, 279, 87067, 315, 14403, 320, 33, 321, 15717, 345, 34, 395, 689, 60629, 11, 4656, 14997, 1481, 484, 4390, 38, 21100, 24823, 689, 198, 6784, 304, 279, 23152, 627, 38, 21100, 20000, 198, 37140, 315, 279, 23152, 36471, 627, 38, 23834, 1992, 20000, 198, 37140, 315, 279, 65104, 788, 36471, 315, 279, 23152, 323, 198, 71558, 42929, 627, 38, 1974, 198, 459, 2942, 477, 20438, 430, 19733, 2392, 264, 20278, 369, 1005, 18403, 304, 279, 198, 2664, 4856, 1109, 369, 1202, 1866, 31301, 627, 47941, 569, 689, 198, 264, 64677, 315, 5292, 616, 349, 18940, 13028, 64, 1063, 315, 902, 527, 33403, 49086, 11, 1766, 304, 198, 1820, 63900, 42929, 315, 12966, 323, 13018, 10099, 26, 34699, 555, 88447, 198, 1073, 63581, 82, 304, 55061, 750, 35172, 8778, 660, 3090, 323, 3691, 26, 41305, 288, 449, 279, 198, 3518, 66181, 315, 50127, 26, 50937, 3090, 304, 9035, 988, 1124, 627, 38, 19510, 198, 279, 65104, 788, 32643, 304, 279, 40335, 505, 53560, 339, 969, 11, 304, 5157, 315, 21249, 198, 11932, 17847, 41033, 627, 32641, 94697, 198, 264, 4382, 13465, 430, 374, 279, 12717, 2592, 315, 4907, 369, 279, 2547, 753, 198, 37791, 627, 32641, 13462, 198, 36581, 8176, 258, 11, 264, 13128, 430, 649, 387, 10235, 505, 34153, 11, 436, 9188, 345, 2308, 3258, 11, 323, 85270, 627, 38, 398, 66, 11968, 198, 264, 99919, 582, 1799, 579, 320, 24126, 67732, 8, 430, 374, 279, 1925, 1376, 304, 8370, 34323, 374, 9967, 304, 279, 2547, 11, 10213, 304, 279, 26587, 323, 24569, 13, 1102, 374, 198, 77304, 1203, 1139, 34323, 439, 4460, 311, 8312, 279, 2547, 449, 4907, 627, 38, 412, 198, 37140, 315, 279, 35358, 13, 622, 14737, 11754, 1253, 387, 520, 904, 3813, 11, 719, 198, 70, 412, 6118, 12302, 304, 279, 22095, 477, 4579, 627, 70793, 18825, 198, 264, 1749, 315, 26679, 279, 5990, 315, 34072, 11, 2737, 2225, 198, 998, 14668, 37182, 323, 7718, 34072, 11, 304, 279, 2547, 555, 30090, 279, 198, 444, 1189, 81, 811, 315, 1884, 34072, 304, 279, 7013, 13, 27140, 25107, 5990, 304, 279, 198, 51105, 11, 1884, 304, 279, 7013, 8881, 279, 1732, 753, 2704, 927, 3892, 38846, 198, 50814, 323, 872, 50549, 520, 279, 35693, 2237, 627, 65569, 93815, 198, 46258, 5540, 6832, 3230, 24128, 320, 64, 19179, 315, 198, 27428, 439, 7863, 449, 279, 3148, 315, 3090, 477, 35784, 8, 374, 7191, 1109, 220, 20, 13, 15, 627, 8538, 8987, 37182, 11, 1778, 439, 87364, 292, 11, 19973, 51318, 11, 3063, 11, 323, 51852, 11, 527, 198, 428, 54358, 21503, 627, 39, 336, 25265, 198, 42393, 9257, 304, 11245, 323, 87934, 323, 902, 49806, 323, 31518, 198, 1820, 2579, 43194, 19153, 315, 279, 6680, 320, 51105, 33245, 388, 8, 320, 32, 911, 65556, 11, 3489, 395, 689, 11, 26541, 198, 42568, 11, 423, 38221, 290, 4390, 39, 336, 575, 1978, 689, 198, 86139, 315, 832, 4376, 315, 279, 2547, 627, 39, 336, 94855, 198, 279, 2579, 320, 2534, 93871, 8, 77678, 304, 6680, 430, 24266, 24463, 198, 1527, 279, 45274, 311, 279, 39881, 315, 279, 2547, 13, 33924, 94855, 374, 264, 64380, 660, 13128, 198, 6387, 11330, 315, 305, 3981, 320, 8370, 374, 459, 11245, 19115, 8, 323, 13509, 258, 320, 8370, 374, 264, 4382, 198, 79565, 19115, 4390, 39, 336, 5849, 29150, 198, 220, 16, 13, 264, 20278, 902, 60832, 2579, 6680, 7917, 26, 220, 17, 13, 5552, 311, 279, 198, 451, 3099, 315, 2579, 6680, 7917, 627, 39, 336, 537, 780, 198, 18417, 279, 6530, 315, 6680, 26, 955, 315, 264, 928, 306, 430, 18417, 5419, 198, 901, 16490, 477, 71417, 4210, 627, 39, 752, 29470, 198, 42393, 1511, 311, 20259, 11, 16630, 323, 51077, 279, 84099, 5865, 198, 1073, 279, 26587, 11, 14718, 459, 7319, 6530, 315, 73394, 320, 26509, 1137, 278, 11, 423, 38221, 290, 11, 44925, 198, 1016, 29400, 11, 19313, 80629, 4390, 21364, 13616, 23258, 391, 552, 198, 279, 1005, 315, 51487, 28559, 369, 21730, 477, 60052, 198, 26047, 8449, 13, 6385, 1302, 649, 387, 1511, 304, 259, 7956, 1439, 11, 29679, 11, 65879, 477, 8819, 1376, 11, 439, 198, 9336, 439, 304, 59300, 11, 17258, 4937, 1238, 11, 30668, 11, 5099, 627, 21364, 79, 29470, 198, 42393, 430, 527, 21730, 311, 6930, 61354, 1324, 323, 28041, 19338, 1778, 198, 300, 10264, 56741, 13, 320, 33, 1983, 339, 1540, 60629, 11, 63226, 86427, 11, 37102, 22292, 11, 1219, 76331, 4390, 64157, 20588, 198, 264, 11742, 6004, 555, 279, 22852, 1887, 430, 14385, 389, 5370, 198, 2664, 39881, 13, 1102, 706, 279, 2515, 315, 390, 6765, 287, 279, 11113, 31071, 331, 532, 15286, 336, 355, 19153, 11, 19371, 1113, 2678, 6680, 31080, 11, 8617, 720, 7331, 287, 15962, 311, 24237, 505, 5370, 198, 83, 18934, 11, 323, 7859, 279, 87067, 315, 23152, 13935, 627, 79762, 4633, 19152, 198, 264, 1376, 315, 15419, 20034, 520, 27723, 279, 4459, 1732, 198, 1278, 485, 11, 2547, 323, 9090, 705, 539, 1120, 279, 961, 477, 5596, 304, 902, 13803, 12446, 627, 7778, 537, 10949, 198, 56411, 315, 5419, 4676, 627, 39, 494, 606, 198, 11742, 9622, 15232, 6004, 555, 279, 82375, 315, 279, 842, 78738, 198, 9125, 13, 2435, 527, 6004, 6089, 1139, 279, 100216, 323, 11953, 311, 279, 198, 83, 18934, 814, 7958, 13, 92208, 3233, 4498, 1139, 1403, 11306, 25, 28896, 323, 58161, 627, 2460, 44315, 527, 9193, 36875, 13, 2435, 527, 7524, 304, 1633, 2678, 15055, 627, 39, 494, 25180, 51354, 198, 42393, 430, 6782, 1343, 16820, 11975, 3145, 11, 477, 44315, 1511, 555, 279, 198, 21494, 369, 1202, 1866, 6650, 11, 527, 18641, 449, 8954, 44315, 323, 5101, 311, 198, 1816, 439, 4857, 10215, 311, 3493, 5644, 27975, 3769, 369, 74218, 198, 23452, 13, 4427, 42393, 11, 1093, 921, 5642, 9119, 44685, 11, 527, 3463, 311, 990, 389, 279, 198, 3374, 315, 279, 20428, 3159, 661, 67169, 320, 1820, 1054, 27510, 315, 279, 8954, 44315, 56955, 323, 649, 198, 98374, 3060, 459, 297, 478, 26252, 292, 477, 463, 7114, 29569, 2515, 11, 439, 279, 2547, 10800, 433, 311, 198, 1220, 1866, 1005, 13, 13266, 3967, 439, 297, 478, 26252, 292, 527, 1511, 311, 4322, 70180, 48294, 198, 96440, 323, 527, 7995, 7524, 320, 4139, 96070, 19385, 570, 13944, 34654, 198, 782, 68254, 279, 1193, 3967, 5933, 6136, 2592, 315, 30371, 5302, 606, 627, 39, 494, 25180, 744, 198, 17610, 315, 264, 4101, 315, 39881, 11, 82375, 11, 323, 7917, 13, 578, 198, 70, 8329, 8356, 26333, 320, 71, 494, 3233, 8, 430, 527, 6367, 291, 1139, 279, 100216, 627, 9673, 26333, 527, 3060, 6089, 6004, 1139, 279, 100216, 320, 20322, 198, 408, 78738, 82375, 8, 477, 6004, 1555, 34083, 2663, 45339, 82, 320, 327, 78738, 82375, 4390, 791, 44315, 51077, 1023, 7917, 477, 36853, 13, 2435, 37377, 1690, 315, 279, 198, 2664, 753, 7640, 11, 2737, 6650, 11, 4500, 11, 323, 2162, 537, 10949, 13, 2684, 198, 18864, 387, 439, 1690, 439, 220, 1041, 44315, 304, 279, 3823, 2547, 11, 719, 539, 682, 617, 1027, 198, 67, 47737, 13, 578, 3682, 506, 78738, 82375, 527, 682, 5938, 449, 279, 60071, 198, 9125, 13, 578, 3682, 36908, 7962, 846, 1303, 842, 78738, 82375, 304, 279, 2547, 527, 279, 198, 27520, 1607, 11, 60564, 11, 20428, 3159, 661, 11, 34697, 278, 11, 1370, 19682, 1607, 11, 323, 62268, 300, 320, 857, 846, 300, 374, 2225, 198, 327, 78738, 323, 842, 78738, 570, 2684, 527, 1403, 10026, 19440, 842, 78738, 82375, 2345, 198, 1820, 66168, 552, 304, 28585, 11, 323, 279, 1296, 288, 304, 25000, 627, 31916, 35031, 28523, 198, 39990, 30125, 727, 60773, 315, 15631, 2053, 627, 31916, 11513, 72967, 292, 50234, 198, 320, 39, 3218, 8, 264, 4725, 75164, 315, 89385, 23661, 13, 578, 3392, 198, 1073, 473, 3218, 20545, 304, 279, 23152, 35327, 11, 11911, 389, 3892, 9547, 345, 16564, 4478, 315, 87067, 315, 89385, 23661, 323, 279, 955, 315, 3691, 35661, 13, 1102, 198, 14500, 82, 281, 7270, 258, 11968, 1139, 281, 7270, 258, 323, 19159, 459, 13935, 11298, 37849, 369, 198, 1820, 5820, 315, 281, 7270, 258, 26, 14091, 18685, 323, 834, 81829, 988, 31484, 454, 5646, 1354, 323, 71313, 280, 67229, 398, 32893, 11405, 25888, 26, 36841, 82829, 1162, 258, 11968, 26, 20747, 1220, 47544, 315, 65, 78852, 11, 5423, 2231, 1116, 3104, 44304, 430, 68736, 326, 24045, 13935, 323, 3738, 198, 2398, 29569, 7739, 26, 95455, 87067, 555, 279, 3930, 347, 9195, 26, 20747, 1220, 279, 1957, 198, 1073, 281, 1919, 36207, 323, 8617, 18417, 4371, 344, 661, 74502, 304, 279, 23152, 627, 75046, 72967, 8671, 67, 4298, 198, 13937, 315, 17055, 72967, 292, 13935, 304, 89385, 87067, 198, 57437, 27781, 89385, 13935, 2612, 4390, 75046, 23797, 66, 22689, 198, 459, 35663, 20545, 315, 13465, 304, 279, 6680, 627, 39, 1100, 531, 2711, 198, 21249, 1579, 6680, 7410, 3629, 9057, 555, 8631, 627, 39, 1100, 531, 4114, 198, 1511, 311, 5376, 6680, 7410, 627, 75046, 27520, 1607, 2191, 198, 320, 2017, 3104, 54060, 8, 264, 3044, 9057, 555, 27639, 198, 21107, 290, 315, 279, 54060, 82375 ]
0xBreath/holistic-books
, is most unfortunate indeed! In every city where the Messengers have been, there have been a few, who thru silly human gossip, have allowed themselves to be turned from This Great Pathway of Light —the most Beautiful, Magnificent Thing on the face of This Earth. Watch them! They will drink the dregs of the cup, they have filled with destruction, and there is no de- scribing it! We do not wish it upon them. The Messengers do not wish it upon them; but We have explained to you, the Law of Life which compels It to act. There is nothing but themselves who can change it. So long as they allow their feeling to continue pouring forth destructive discor- dant activity; because it is their own energy acting. This energy flows thru naturally, as We might say, thru your Life Stream. It is going all the time. Energy does not dis- criminate! You are the discriminating Intelligence of your 288 THE "I AM99 DISCOURSES world; who should say how your energy shall act thru you and your world; but mankind has not understood that. Therefore, how were people to govern it? Today, the Beloved Saint Germain has brought to you, the Clear, Simple Understanding which a child can com- prehend. It is Majestic and All-powerful in Its Action, for the Individual when applied. Let Us take you by the hand and help you to understand and apply It, with Dynamic Power and Energy. Then see how quickly your world will be first stilled. Then, as This Pure Wondrous Energy flows forth and out into your world, you will find those who hated you will turn and love you; those who opposed you, will want to serve you in the Glory of Life; because your Out-pouring of Love has touched their world, refined it; and made it responsive to the Power of Life which is Light. Life is acting everywhere! Precious Ones in this audience today, do you understand, you are but the Individualization of the One Great Life ? If one of you sitting in this audience, were suddenly to turn and hate the rest, then those in the audience to some degree —knowingly or unknowingly, would be affected by that feeling which was sent into the room, if they did not un- derstand how to protect themselves. Individuals are doing this constantly and believing they are not affected by it; but too late, they realize they are their own destruction. DON'T EVER AGAIN BLAME ANY PERSON, PLACE OR CONDITION FOR ANYTHING WHICH EXISTS IN YOUR WORLD! Then, you will be in a po-DISCOURSE XXII 289 sition to call the Powers of your Presence forth to cleanse, purify and set your world into order; and have the Glory, the Presence, and the Perfection of All Life acting in your world. Think of it! Never in the experience of outer activity have such things been done, and I just refer to two or three. The Great Victory you will understand by His Name, is all Vic- tory implies. His Name is a Quality, a Power, an Authority! When He has offered to charge the Substance of Light, which is His Power of Victory into the feeling world of every honest, sincere student; in the Name of God, your "Mighty I AM Presence," do you realize what that means to you! His Power is Assistance for Victory in your world on the side of Light! The Mighty Goddess of Liberty has offered to charge your world with Her Power of Liberty; which is Her Quality of Action to give you Assistance. In My Humble Efforts, "I AM" the Director of Those Mighty Light Rays, I offer to dissolve and consume your human creation; as I find Individuals who are Earnest, Honest and Sincere in making their Application. Where their Streams of Life make it possible for Me to render that Service, I never lose an opportunity to give Assistance; to dissolve and consume the remainder of their human discordant qualities, which have been drawn into the feeling world. Remember, everything in Life is a Trinity of Action. Perhaps, I should explain to you why these particular qual- ities are being charged into the feeling world of the students everywhere. The demand for the World and our America 290 THE "I AM99 DISCOURSES especially, is Victory thru Liberty—in the acknowledgment of the Presence of all Life, which is the "Mighty I AM." America must have Invincible Protection. It is not a matter of can it, but America must have It! We are the Power and the Authority by the Full Co-operation of the Cosmic Be- ings of Light. Then can you tell Me honestly from your Heart, there is any human creation in the Universe which has any Power to oppose Our Authority of Life ? AWAKEN TODAY, BELOVED ONES, IN THE FULL FEELING OF WHAT THIS MEANS. Let Me remind you again, that which We refer to as the Cosmic Light, is not just an Universal Activity which is prevalent everywhere! The Cosmic Light to which We refer, is a Consciously Drawn and Projected Power of Light Sub- stance into the Earth; by the Great Group of Ascended Masters and Cosmic Beings, from what you have come to know as the Great Central Sun; which is the Heart Focus of Life and Light to This System of Worlds. Now is the only time, It has ever acted upon the Earth in more than two million years, because the need is so great; in order to hold the unity in This System of Worlds. Your planet has become known—Oh, let us put it, as a "shadow planet"; because of the discord long generated by mankind. Do you realize what it would mean, if the Earth failed in its Expansion of the Light as required; in relation to the other planets of This System ? You don't know that, the intellect cannot comprehend it, but We do! Do you wonder why Beloved Saint Germain wanted to DISCOURSE XXII 291 bring forth This Light to the Earth, in the last effort to free mankind ? Let Me tell you something, you could never re- pay Him in a million years for the Service, which He has rendered to the Earth and to mankind. Then, to think there are Individuals in America so depraved, as to condemn, criticize and put forth the vicious fiendish false statement, that the Messengers are trying to replace Beloved Jesus with Saint Germain; trying to ridicule the Dictations of
[ 11, 220, 374, 720, 3646, 220, 34707, 220, 13118, 0, 720, 644, 1475, 220, 3363, 1405, 220, 279, 19234, 15232, 220, 617, 220, 1027, 11, 220, 1070, 220, 617, 720, 82850, 220, 264, 2478, 11, 220, 889, 220, 41178, 220, 30571, 220, 3823, 220, 58587, 11, 220, 617, 220, 5535, 720, 339, 12116, 4372, 220, 311, 387, 6656, 220, 505, 220, 1115, 220, 8681, 220, 8092, 3195, 220, 315, 8828, 720, 22416, 220, 1455, 220, 20055, 11, 220, 20918, 37243, 220, 38300, 220, 389, 279, 3663, 220, 315, 720, 2028, 220, 9420, 13, 220, 10573, 220, 1124, 0, 220, 2435, 220, 690, 220, 7172, 220, 279, 294, 31986, 220, 315, 279, 720, 37765, 11, 814, 220, 617, 220, 10409, 220, 449, 220, 19814, 11, 220, 323, 220, 1070, 220, 374, 912, 409, 7058, 11853, 7278, 220, 433, 0, 1226, 656, 539, 6562, 220, 433, 5304, 220, 1124, 13, 220, 578, 220, 19234, 15232, 720, 3055, 539, 6562, 220, 433, 5304, 220, 1124, 26, 220, 719, 1226, 617, 220, 11497, 220, 311, 499, 11, 720, 1820, 7658, 220, 315, 9601, 220, 902, 220, 1391, 2053, 220, 1102, 311, 1180, 13, 2684, 220, 374, 4400, 720, 8248, 5694, 220, 889, 220, 649, 2349, 220, 433, 13, 2100, 1317, 220, 439, 814, 220, 2187, 720, 50828, 220, 8430, 220, 311, 3136, 220, 51513, 220, 13544, 220, 40652, 220, 2624, 269, 7058, 67, 519, 220, 5820, 26, 220, 1606, 220, 433, 374, 872, 220, 1866, 220, 4907, 220, 15718, 13, 220, 1115, 720, 17947, 220, 28555, 220, 41178, 220, 18182, 11, 220, 439, 1226, 2643, 220, 2019, 11, 220, 41178, 220, 701, 720, 26833, 9384, 13, 220, 1102, 374, 2133, 220, 682, 279, 892, 13, 220, 12634, 220, 1587, 220, 539, 834, 7058, 5192, 318, 3357, 0, 220, 1472, 220, 527, 279, 14572, 16252, 220, 22107, 220, 315, 701, 220, 15287, 3247, 220, 330, 40, 6912, 1484, 220, 12244, 34, 6934, 29095, 720, 14957, 26, 220, 889, 220, 1288, 220, 2019, 1268, 220, 701, 220, 4907, 220, 4985, 220, 1180, 41178, 220, 499, 720, 438, 701, 220, 1917, 26, 220, 719, 220, 43384, 220, 706, 220, 539, 16365, 220, 430, 13, 720, 55915, 11, 220, 1268, 220, 1051, 220, 1274, 220, 311, 2633, 220, 433, 949, 720, 15724, 11, 220, 279, 7984, 5047, 220, 14539, 220, 20524, 3902, 220, 706, 7263, 220, 311, 499, 11, 720, 1820, 12292, 11, 220, 9170, 220, 46551, 220, 902, 220, 264, 1716, 220, 649, 470, 7058, 31882, 408, 13, 220, 1102, 374, 31779, 10027, 220, 323, 220, 2052, 27624, 1285, 220, 304, 11699, 5703, 11, 220, 369, 720, 1820, 30440, 220, 994, 220, 9435, 13, 220, 6914, 4073, 1935, 220, 499, 555, 279, 1450, 720, 438, 1520, 220, 499, 220, 311, 3619, 220, 323, 220, 3881, 220, 1102, 11, 449, 220, 22648, 720, 15335, 220, 323, 220, 12634, 13, 220, 5112, 220, 1518, 1268, 220, 6288, 220, 701, 220, 1917, 720, 14724, 387, 1176, 220, 357, 4473, 13, 220, 5112, 11, 220, 439, 1115, 220, 30688, 220, 468, 94650, 220, 12634, 720, 39240, 220, 13544, 220, 323, 220, 704, 1139, 220, 701, 220, 1917, 11, 220, 499, 220, 690, 220, 1505, 220, 1884, 720, 14965, 220, 38674, 220, 499, 220, 690, 220, 2543, 220, 323, 220, 3021, 220, 499, 26, 220, 1884, 220, 889, 220, 16475, 720, 9514, 11, 690, 220, 1390, 220, 311, 8854, 220, 499, 220, 304, 279, 59261, 220, 315, 9601, 26, 220, 1606, 720, 22479, 220, 4470, 2320, 414, 287, 220, 315, 10919, 220, 706, 24891, 220, 872, 220, 1917, 11, 220, 38291, 720, 275, 26, 323, 220, 1903, 220, 433, 27078, 220, 311, 279, 7572, 220, 315, 9601, 220, 902, 220, 374, 720, 14235, 13, 220, 9601, 220, 374, 15718, 220, 17277, 0, 720, 69933, 1245, 220, 74933, 220, 304, 420, 10877, 220, 3432, 11, 220, 656, 499, 3619, 11, 720, 9514, 527, 719, 279, 30440, 2065, 220, 315, 279, 3861, 220, 8681, 220, 9601, 220, 949, 720, 2746, 832, 315, 499, 11961, 220, 304, 420, 10877, 11, 220, 1051, 220, 15187, 220, 311, 2543, 720, 438, 12491, 220, 279, 2800, 11, 220, 1243, 220, 1884, 220, 304, 279, 10877, 220, 311, 1063, 220, 8547, 720, 2345, 33134, 11559, 220, 477, 84644, 11559, 11, 220, 1053, 220, 387, 11754, 220, 555, 430, 720, 1897, 20659, 220, 902, 220, 574, 220, 3288, 220, 1139, 220, 279, 3130, 11, 220, 422, 814, 220, 1550, 539, 653, 7058, 1126, 2752, 220, 1268, 220, 311, 6144, 220, 5694, 13, 220, 62525, 220, 527, 3815, 720, 576, 15320, 220, 323, 35090, 220, 814, 220, 527, 539, 11754, 220, 555, 433, 26, 719, 720, 37227, 3389, 11, 220, 814, 220, 13383, 220, 814, 220, 527, 872, 220, 1866, 220, 19814, 13, 720, 85741, 17773, 220, 74766, 220, 67994, 220, 15195, 2797, 220, 4230, 220, 57477, 11, 720, 36975, 220, 2794, 11228, 220, 4716, 220, 4230, 57764, 220, 79264, 720, 3337, 26194, 220, 2006, 21592, 220, 51991, 0, 220, 5112, 11, 220, 499, 220, 690, 220, 387, 304, 264, 3273, 9607, 28729, 75008, 220, 30388, 5660, 220, 220, 17212, 720, 82, 684, 220, 311, 1650, 279, 46137, 220, 315, 701, 220, 79723, 220, 13544, 220, 311, 81155, 11, 720, 26047, 1463, 220, 323, 220, 743, 701, 220, 1917, 220, 1139, 220, 2015, 26, 220, 323, 220, 617, 220, 279, 59261, 11, 720, 1820, 79723, 11, 220, 323, 220, 279, 3700, 13421, 220, 315, 2052, 9601, 220, 15718, 220, 304, 701, 720, 14957, 13, 720, 39787, 220, 315, 433, 0, 15037, 220, 304, 279, 3217, 220, 315, 16335, 220, 5820, 220, 617, 720, 21470, 220, 2574, 220, 1027, 220, 2884, 11, 220, 323, 358, 1120, 8464, 220, 311, 1403, 477, 2380, 13, 220, 578, 720, 22111, 220, 49427, 220, 499, 690, 220, 3619, 220, 555, 5414, 4076, 11, 220, 374, 682, 44847, 7058, 83, 683, 24897, 13, 220, 5414, 4076, 220, 374, 264, 18410, 11, 220, 264, 7572, 11, 220, 459, 22677, 0, 720, 4599, 220, 1283, 706, 220, 9076, 220, 311, 6900, 220, 279, 95387, 220, 315, 8828, 11, 720, 8370, 220, 374, 5414, 220, 7572, 220, 315, 49427, 220, 1139, 220, 279, 8430, 220, 1917, 220, 315, 720, 30115, 220, 10978, 11, 220, 49424, 220, 5575, 26, 220, 304, 279, 4076, 220, 315, 4359, 11, 220, 701, 720, 74627, 492, 88, 220, 358, 6912, 220, 79723, 1359, 220, 656, 499, 13383, 220, 1148, 220, 430, 220, 3445, 720, 998, 499, 0, 220, 5414, 220, 7572, 220, 374, 46865, 220, 369, 49427, 220, 304, 701, 220, 1917, 720, 263, 279, 3185, 220, 315, 8828, 0, 220, 578, 220, 75268, 220, 61785, 220, 315, 32492, 220, 706, 720, 1885, 12616, 220, 311, 6900, 220, 701, 220, 1917, 220, 449, 220, 6385, 220, 7572, 220, 315, 32492, 26, 720, 8370, 220, 374, 6385, 220, 18410, 220, 315, 5703, 220, 311, 3041, 220, 499, 220, 46865, 13, 220, 763, 720, 5159, 20449, 901, 220, 31122, 19491, 11, 220, 330, 40, 6912, 1, 220, 279, 10783, 220, 315, 13266, 220, 75268, 720, 14235, 220, 80775, 11, 220, 358, 3085, 220, 311, 73739, 220, 323, 220, 25024, 220, 701, 220, 3823, 720, 38475, 26, 220, 439, 358, 1505, 220, 62525, 220, 889, 220, 527, 48793, 478, 11, 220, 54284, 220, 323, 720, 50, 2910, 486, 220, 304, 3339, 220, 872, 220, 7473, 13, 220, 11208, 220, 872, 220, 95622, 720, 1073, 9601, 220, 1304, 220, 433, 3284, 220, 369, 2206, 311, 3219, 220, 430, 220, 5475, 11, 220, 358, 720, 37593, 220, 9229, 220, 459, 6776, 220, 311, 3041, 220, 46865, 26, 220, 311, 73739, 720, 438, 25024, 220, 279, 27410, 220, 315, 872, 220, 3823, 220, 32141, 519, 720, 83465, 11, 220, 902, 220, 617, 220, 1027, 220, 15107, 220, 1139, 220, 279, 8430, 220, 1917, 13, 720, 29690, 11, 220, 4395, 220, 304, 9601, 220, 374, 264, 45659, 220, 315, 5703, 13, 720, 32576, 11, 220, 358, 1288, 220, 10552, 220, 311, 499, 3249, 220, 1521, 220, 4040, 220, 5965, 7058, 1385, 527, 1694, 220, 11684, 220, 1139, 220, 279, 8430, 220, 1917, 220, 315, 279, 4236, 720, 30115, 2940, 13, 220, 578, 220, 7631, 220, 369, 279, 4435, 220, 323, 220, 1057, 5270, 220, 13754, 3247, 220, 330, 40, 6912, 1484, 220, 12244, 34, 6934, 29095, 720, 36046, 11, 220, 374, 49427, 220, 41178, 220, 32492, 49525, 220, 279, 78570, 720, 1073, 279, 79723, 220, 315, 682, 9601, 11, 220, 902, 220, 374, 279, 330, 44, 492, 88, 220, 358, 6912, 1210, 720, 32132, 220, 2011, 220, 617, 220, 19337, 77972, 220, 19721, 13, 220, 1102, 374, 539, 264, 5030, 720, 1073, 649, 433, 11, 719, 5270, 220, 2011, 220, 617, 220, 1102, 0, 1226, 527, 279, 7572, 220, 323, 720, 1820, 22677, 220, 555, 279, 8797, 220, 3623, 67334, 220, 315, 279, 95789, 220, 2893, 7058, 826, 315, 8828, 13, 220, 5112, 220, 649, 220, 499, 220, 3371, 2206, 27136, 220, 505, 220, 701, 720, 46484, 11, 220, 1070, 220, 374, 904, 3823, 220, 9886, 220, 304, 279, 29849, 220, 902, 720, 4752, 904, 7572, 220, 311, 34134, 220, 5751, 220, 22677, 220, 315, 9601, 220, 949, 720, 14757, 12173, 965, 220, 41362, 11, 220, 7354, 1623, 22449, 220, 6328, 1600, 11, 220, 2006, 220, 3247, 720, 52749, 220, 29031, 2818, 1753, 220, 3083, 220, 38535, 220, 10245, 220, 16691, 11954, 13, 220, 6914, 220, 2206, 720, 1864, 485, 220, 499, 220, 1578, 11, 220, 430, 220, 902, 220, 1226, 220, 8464, 220, 311, 439, 279, 95789, 720, 14235, 11, 220, 374, 539, 1120, 220, 459, 26581, 220, 15330, 220, 902, 220, 374, 46941, 720, 30115, 2940, 0, 220, 578, 220, 95789, 220, 8828, 220, 311, 902, 220, 1226, 220, 8464, 11, 220, 374, 264, 720, 1128, 71888, 220, 12261, 77, 220, 323, 220, 5907, 291, 220, 7572, 220, 315, 8828, 220, 3804, 7058, 1333, 220, 1139, 220, 279, 9420, 26, 220, 555, 279, 8681, 220, 5856, 220, 315, 40660, 2954, 720, 44, 14533, 220, 323, 220, 95789, 220, 2893, 826, 11, 220, 505, 220, 1148, 220, 499, 220, 617, 220, 2586, 220, 311, 720, 33134, 220, 439, 279, 8681, 220, 10913, 220, 8219, 26, 220, 902, 220, 374, 279, 18449, 220, 26891, 720, 1073, 9601, 220, 323, 220, 8828, 220, 311, 1115, 220, 744, 220, 315, 52947, 13, 720, 7184, 220, 374, 279, 1193, 220, 892, 11, 220, 1102, 706, 3596, 220, 31532, 220, 5304, 220, 279, 9420, 720, 258, 810, 220, 1109, 220, 1403, 3610, 220, 1667, 11, 220, 1606, 220, 279, 1205, 220, 374, 779, 2294, 26, 720, 258, 2015, 220, 311, 3412, 220, 279, 31426, 220, 304, 1115, 220, 744, 220, 315, 52947, 13, 220, 4718, 720, 51174, 220, 706, 3719, 220, 3967, 2345, 12174, 11, 220, 1095, 603, 2231, 433, 11, 439, 264, 330, 34052, 720, 51174, 5233, 220, 1606, 220, 315, 279, 32141, 220, 1317, 220, 8066, 220, 555, 43384, 13, 720, 5519, 499, 220, 13383, 220, 1148, 220, 433, 1053, 220, 3152, 11, 220, 422, 279, 9420, 220, 4745, 220, 304, 720, 1220, 55654, 220, 315, 279, 8828, 220, 439, 2631, 26, 220, 304, 12976, 220, 311, 279, 720, 1605, 220, 33975, 220, 315, 1115, 220, 744, 220, 949, 1472, 220, 1541, 956, 220, 1440, 220, 430, 11, 220, 279, 720, 80643, 772, 220, 4250, 220, 58389, 220, 433, 11, 719, 1226, 656, 0, 720, 5519, 499, 220, 5895, 220, 3249, 220, 7984, 5047, 220, 14539, 220, 20524, 3902, 220, 4934, 220, 311, 12244, 34, 75008, 220, 30388, 5660, 220, 220, 17335, 720, 82477, 220, 13544, 220, 1115, 220, 8828, 220, 311, 279, 9420, 11, 220, 304, 279, 1566, 5149, 220, 311, 1949, 720, 76, 70370, 220, 949, 6914, 2206, 3371, 499, 2555, 11, 220, 499, 220, 1436, 220, 2646, 220, 312, 7058, 14214, 21058, 220, 304, 264, 3610, 220, 1667, 220, 369, 279, 5475, 11, 220, 902, 220, 1283, 706, 720, 7472, 291, 220, 311, 279, 9420, 220, 323, 311, 43384, 13, 220, 5112, 11, 220, 311, 1781, 220, 1070, 720, 548, 62525, 220, 304, 5270, 220, 779, 36980, 4234, 11, 220, 439, 311, 40074, 11, 720, 38096, 292, 553, 220, 323, 220, 2231, 13544, 220, 279, 43510, 220, 9314, 408, 819, 220, 905, 220, 5224, 11, 720, 9210, 279, 19234, 15232, 220, 527, 4560, 220, 311, 8454, 220, 7984, 5047, 220, 10811, 220, 449, 720, 57475, 220, 20524, 3902, 26, 220, 4560, 220, 311, 94847, 220, 279, 30226, 811, 220, 315 ]
0xBreath/holistic-books
poor habits have been established, one must faithfully eachday practice corrective exercises and good posture habits. How to Sit, Stand and Walk For Strength, Health and Youthfulness When walking, one should imagine that the legs are attached to the middle of the chest. That gives long, sweeping, graceful, springy steps because, when one walks correctly with this swing and spring, he thenautomatically builds energy. Habit either makes or breaks us, and good posture habits make graceful, strong bodies. Just as the twig is bent, the tree is inclined. When in a sitting position, see that the spine is stretched up and well back against the chair. Putshoulders back and lift chest up and off the stomach,head high and never forward. Be sure to have both your feet on the floor and never sit with your legs crossed! Under the knees run two of the largest arteries, carryingnourishing blood to the muscles below the knees and to all the nerves that are found in the feet.201 Right way to lift Wrong way to sit! Don’t Cross Legs! Wrong way to lift When you cross your legs you immediately cut down the blood flow to almost a trickle. When the leg and knee muscles are not nourished and don’t have good circulation, the blood goes stagnant in the extremities which can lead to varicose veins or broken capillaries. Look at the ankles of people over 40 who have made it a habit of crossing their legs and you’ll see broken veins and capillaries. When the muscles and feet don’t get their full supply of blood, the feet become weak andpoor circulation sets in. Cold feet torment leg-crossers. A well-known heart specialist was asked once, “When do most people have a heart attack?” The heart specialistanswered, “At a time they are sitting quietly with one leg crossed over the other.” So you can see that when you sit down, you should plant both of your feet squarelyon the floor and never cross your legs. People who are habitual leg-crossers always have more acid crystals stored in the feet than those who never cross their legswhile sitting. Crossing of the legs is one of the worst postural habits of man! It throws the hips, spine and the head off balance and can become one of the mostinsidious causes of a chronic backache. Poor posture of any kind can bring unbearable pain throughout the body, especially in the neck and lower back. One very simple habit that is most beneficial to establish for your health is to stand, walk and sit tall andnever sit with your legs crossed! Good posture does notrequire an exaggerated unhealthy position. It’s simply stretching up your spine and standing erect – which gives all your body’s machinery room to operate and keep youhealthier! When you maintain good posture, soon your body becomes more toned and healthier.202 That fasting is a normal part of our walk with God is taken for granted by the Lord Jesus. Immediately following the Lord’s Prayer, He said: “Moreover when ye fast... ” – Matthew 6:16Christian Century magazine advised its readers to fast out of enlightened self-interest and with the objectives to improve health and make the body more vibrant and beautiful. “Fast because it is good for you,” the magazine urged;it can be an “exercise to get the body in shape to be alive to itself. This processfrees the self to be more sensitive to the Creator and to ourselves.”“Relieved of the work of digesting foods, fasting permits the body to riditself of toxins while facilitating healing. Fasting regularly gives your organsa rest and helps reverse the ageing process for a longer and healthier life.” – James Balch, M.D., Prescription for Nutritional Healing “Bragg books were my conversion to the healthy way.”Now, stop and think! Our Creator has presented you with the world’s most miraculous machine – your own body! This incredible factory has its own non-stop motor (the heart), its own fuelingsystem (the digestive system), its own filtration system (the kidneys), its own thinking computer (brain and nervous system), its own temperature controls (sweat glands), etc. Indeed, thismiraculous creation even has the power to repr oduce itself!“The Illness That Cannot Be Cured By Fasting, Cannot Be Cured By Anything Else ” – German Proverb Dr. Nikolayev, director of a famous European fasting clinic, often quotes this old, wise German proverb above. Fasting permits the miracle cleansing and healing powersof the body, the mind and the soul to assert themselves. Dr. Nikolayev – who fasts several times a year in 10 to 15 day stretches – stated, “I usually fast for health and spiritual reasons. I have also fasted several times for a scientific experiment. I always feel excellent when I fast. It is always a happy occasion and a good rest.” Dr. Nikolayev discovered his patients responded to fasting when all other forms of therapy had failed. Thepatients had been chronically ill and felt hopeless abouttheir future! Most of them would never have functioned again. The famous doctor, Allan Cott, M.D. noted in his book Fasting, The Ultimate Diet that 75% of those treated by fasting improved so remarkably that they were ableto resume a more youthful, happier, active life!203 Doctor Human Mind Brain Areas Healthy Mind Habits Promote Health & LongevityChapter 27 BRAIN STEM Wake up and say - Today I am going to be happier, healthier and wiser in my daily living! I am the captain of my life and amgoing to steer it living a 100% healthy lifestyle! Fact – Happy peoplelook younger, are healthier, and live longer! – Patricia BraggThere is an old German saying: “Alle gute dinge sind drei,” or “All good things are three.” We, as Christians worship a God represented by a trinity – the Father, Son and Holy Ghost. Man, too, is composed of a trinity. The soul is the first man, the ego, the individual, the personality, which makes each of us unique. The mind is the second man, through which the soul or the firstman is expressed; the soul’s only means of expression.The body is the third man, the physical, visible part; the means by which the mind expresses; also its onlymeans, and its only mode of contact with environment.These three are one, just as the Godhead (Divine Force) is one, each making a part of this miracle called man.204 Everything in excess is opposed by Nature. – Hippocrates, the Father of MedicineYour Body Is Your Precious Home – Protect It The body is composed of many members, yet is one body. If one of the members suffer, all others suffer with it. We recognize that the body is a whole, cannot be divided and is made up of a community of closelygrouped and interrelated organs, tissues, and cells; each an individual unit, yet so closely related that not one of them can exist apart from the whole. For too long thepublic has viewed these various organs as unrelated, or loosely related, units. Most people are inclined to treat each more or less individually, not realizing that if onepart of the indivisible whole suffers, all the rest suffer. The body is the most wonderful m iracle example ever created of widely diversified functions in one whole and it must be treated always as a unit. What is good for one part is good for all; what is bad is bad for all the parts. If the toe is affected by gangrene, does not the whole body suffer with it? Not only is the pain inflicted on the whole man, but the absorption of decaying material has to betaken care of by the whole body – the loss of appetite, the headache, the nausea, the fever and the chills – yet thetoe is the only affected member that can be seen. In thescience of fasting, we are concerned with the whole person – including the soul, mind and body! Correct Thinking is Important for Health In the Book of Life, the Bible, Proverbs 23:7 tells us: “For as man thinketh in his heart, so is he.” When a sick person constantly convinces himself thathe will never get well, it becomes almost certain thathis negativity and troubles will carry him to the grave. Flesh is dumb! We never want you to forget that statement. That is the reason we use it over and overagain. The mind, your computer, is really the controlling factor in your entire makeup. Flesh cannot think for itself because only the mind does all the thinking. Thatis why you must cultivate Positive Thinking.205 New Harvard Study showed strong importance of mind/body connections in health of mind and body. Improving the mind with meditation, prayer, relaxation therapy, yoga, diet and positive thinking brought amazing improvements. – Harvard www.med.harvard.eduYour Mind Must Control Your Body! The mind must have a will of iron and always be in command of the body. From this day forward learn how to substitute thoughts. When negative thoughts ( page 144) as, “I am losing my energy because when you get older you start to lose energy” – enters your mind, replace itwith positive thoughts that say, “Age cannot in any way affect
[ 8009, 198, 10796, 1220, 617, 1027, 9749, 11, 832, 2011, 94176, 1855, 1316, 6725, 91852, 23783, 323, 1695, 48378, 26870, 627, 4438, 311, 29508, 11, 15948, 323, 12839, 198, 2520, 32937, 11, 6401, 323, 30160, 31514, 198, 4599, 11689, 11, 832, 1288, 13085, 430, 279, 14535, 527, 198, 68597, 311, 279, 6278, 315, 279, 15489, 13, 3011, 6835, 1317, 345, 82, 49642, 287, 11, 78462, 11, 10683, 88, 7504, 1606, 11, 994, 832, 198, 19599, 82, 12722, 449, 420, 19336, 323, 10683, 11, 568, 1243, 28172, 7167, 22890, 4907, 13, 95178, 3060, 3727, 477, 18808, 198, 355, 11, 323, 1695, 48378, 26870, 1304, 78462, 11, 3831, 13162, 627, 10156, 439, 279, 52346, 374, 30280, 11, 279, 5021, 374, 43131, 627, 4599, 304, 264, 11961, 2361, 11, 1518, 430, 279, 35776, 374, 198, 267, 62837, 709, 323, 1664, 1203, 2403, 279, 10716, 13, 10435, 5562, 388, 1203, 323, 12157, 15489, 709, 323, 1022, 279, 23152, 11, 2025, 1579, 323, 2646, 4741, 13, 2893, 2771, 311, 617, 2225, 701, 198, 1897, 295, 389, 279, 6558, 323, 2646, 2503, 449, 701, 14535, 28129, 4999, 16648, 279, 31624, 1629, 1403, 315, 279, 7928, 85648, 11, 15691, 77, 414, 11218, 6680, 311, 279, 24569, 3770, 279, 31624, 323, 311, 198, 543, 279, 50581, 430, 527, 1766, 304, 279, 7693, 13, 679, 198, 6107, 1648, 311, 12157, 198, 41856, 1648, 311, 2503, 4999, 8161, 1431, 198, 29601, 198, 19444, 82, 4999, 30285, 1648, 311, 12157, 198, 4599, 499, 5425, 701, 14535, 499, 7214, 4018, 1523, 198, 1820, 6680, 6530, 311, 4661, 264, 98444, 13, 3277, 279, 2531, 323, 198, 74, 34191, 24569, 527, 539, 46798, 3384, 323, 1541, 1431, 617, 1695, 198, 44398, 2987, 11, 279, 6680, 5900, 97043, 304, 279, 6000, 1385, 198, 8370, 649, 3063, 311, 767, 292, 974, 60764, 477, 11102, 2107, 484, 5548, 627, 10596, 520, 279, 90713, 315, 1274, 220, 927, 220, 220, 1272, 889, 617, 1903, 433, 264, 198, 97802, 315, 27736, 872, 14535, 323, 499, 4805, 1518, 11102, 60764, 198, 438, 2107, 484, 5548, 13, 3277, 279, 24569, 323, 7693, 1541, 1431, 636, 198, 50828, 2539, 8312, 315, 6680, 11, 279, 7693, 3719, 7621, 323, 5481, 269, 35855, 7437, 304, 13, 24062, 7693, 73770, 2531, 77529, 388, 627, 32, 1664, 22015, 4851, 24687, 574, 4691, 3131, 11, 1054, 4599, 198, 3055, 1455, 1274, 617, 264, 4851, 3440, 12671, 578, 4851, 24687, 57824, 11, 1054, 1688, 264, 892, 814, 527, 11961, 30666, 449, 832, 198, 1978, 28129, 927, 279, 1023, 2029, 2100, 499, 649, 1518, 430, 994, 198, 9514, 2503, 1523, 11, 499, 1288, 6136, 2225, 315, 701, 7693, 95563, 263, 279, 6558, 323, 2646, 5425, 701, 14535, 13, 9029, 889, 527, 198, 97802, 940, 2531, 77529, 388, 2744, 617, 810, 13935, 48473, 198, 72349, 304, 279, 7693, 1109, 1884, 889, 2646, 5425, 872, 14535, 3556, 11961, 13, 66093, 315, 279, 14535, 374, 832, 315, 279, 12047, 198, 2252, 4269, 26870, 315, 893, 0, 1102, 3872, 279, 43523, 11, 35776, 323, 198, 1820, 2010, 1022, 8335, 323, 649, 3719, 832, 315, 279, 1455, 1354, 80227, 11384, 315, 264, 21249, 1203, 1815, 13, 45773, 48378, 315, 198, 3852, 3169, 649, 4546, 99930, 6784, 6957, 279, 198, 2664, 11, 5423, 304, 279, 13272, 323, 4827, 1203, 627, 4054, 1633, 4382, 14464, 430, 374, 1455, 24629, 311, 198, 34500, 369, 701, 2890, 374, 311, 2559, 11, 4321, 323, 2503, 16615, 323, 37593, 2503, 449, 701, 14535, 28129, 0, 7839, 48378, 1587, 539, 4408, 459, 62258, 53808, 2361, 13, 1102, 753, 5042, 198, 73184, 287, 709, 701, 35776, 323, 11509, 38732, 1389, 902, 6835, 198, 543, 701, 2547, 753, 26953, 3130, 311, 14816, 323, 2567, 499, 12393, 1291, 0, 3277, 499, 10519, 1695, 48378, 11, 5246, 701, 198, 2664, 9221, 810, 98831, 323, 39345, 13, 2366, 198, 4897, 54560, 374, 264, 4725, 961, 315, 1057, 4321, 449, 4359, 374, 4529, 369, 198, 911, 7719, 555, 279, 10425, 10811, 13, 69352, 2768, 279, 10425, 753, 198, 3617, 1155, 11, 1283, 1071, 25, 1054, 58276, 994, 20043, 5043, 662, 662, 662, 19524, 1389, 19475, 220, 220, 21, 25, 845, 42042, 28200, 220, 14756, 26160, 1202, 13016, 311, 5043, 704, 315, 82315, 198, 726, 65873, 323, 449, 279, 26470, 311, 7417, 2890, 323, 1304, 279, 2547, 810, 198, 85, 10892, 519, 323, 6366, 13, 1054, 33274, 1606, 433, 374, 1695, 369, 499, 2476, 279, 14756, 28932, 26, 275, 649, 387, 459, 1054, 64562, 311, 636, 279, 2547, 304, 6211, 311, 387, 13989, 311, 5196, 13, 1115, 1920, 69, 8016, 279, 659, 311, 387, 810, 16614, 311, 279, 36778, 323, 311, 13520, 2029, 2118, 6882, 32077, 315, 279, 990, 315, 21552, 287, 15657, 11, 54560, 29790, 279, 2547, 311, 9463, 275, 726, 315, 62186, 1418, 68365, 21730, 13, 435, 15067, 15870, 6835, 701, 36853, 64, 2800, 323, 8779, 10134, 279, 80043, 1920, 369, 264, 5129, 323, 39345, 2324, 49216, 1389, 7957, 19984, 331, 11, 720, 44, 920, 2637, 77175, 369, 18878, 37842, 49741, 198, 2118, 33, 4193, 70, 6603, 1051, 856, 14747, 311, 279, 9498, 1648, 2029, 7184, 11, 3009, 323, 1781, 0, 220, 5751, 36778, 706, 10666, 499, 449, 279, 198, 14957, 753, 1455, 91813, 5780, 1389, 701, 1866, 2547, 0, 1115, 15400, 198, 22348, 706, 1202, 1866, 2536, 42311, 9048, 320, 1820, 4851, 705, 1202, 1866, 10633, 826, 615, 320, 1820, 60071, 1887, 705, 1202, 1866, 76038, 1887, 320, 1820, 198, 64381, 36371, 705, 1202, 1866, 7422, 6500, 320, 54160, 323, 23418, 1887, 1350, 1220, 1866, 9499, 11835, 320, 82, 906, 266, 82375, 705, 5099, 13, 23150, 11, 420, 20531, 582, 13850, 9886, 1524, 706, 279, 2410, 311, 31736, 297, 13677, 5196, 115655, 791, 12799, 2136, 3011, 35755, 2893, 356, 3149, 3296, 435, 15067, 345, 17902, 2893, 356, 3149, 3296, 42033, 19334, 19524, 1389, 6063, 1322, 23129, 198, 9023, 13, 96657, 352, 5230, 11, 7690, 315, 264, 11495, 7665, 54560, 198, 90365, 11, 3629, 17637, 420, 2362, 11, 24219, 6063, 79538, 3485, 627, 37, 15067, 29790, 279, 45125, 60052, 323, 21730, 13736, 1073, 279, 2547, 11, 279, 4059, 323, 279, 13836, 311, 2105, 5694, 627, 9023, 13, 96657, 352, 5230, 1389, 889, 5043, 82, 3892, 3115, 264, 1060, 304, 198, 220, 605, 311, 198, 868, 1938, 50699, 1389, 11224, 11, 1054, 40, 6118, 5043, 369, 2890, 323, 198, 86390, 940, 8125, 13, 358, 617, 1101, 5043, 291, 3892, 3115, 369, 264, 198, 85930, 9526, 13, 358, 2744, 2733, 9250, 994, 358, 5043, 627, 2181, 374, 2744, 264, 6380, 13402, 323, 264, 1695, 2800, 49216, 9023, 13, 96657, 352, 5230, 11352, 813, 6978, 16846, 311, 198, 9533, 287, 994, 682, 1023, 7739, 315, 15419, 1047, 4745, 13, 578, 81437, 1047, 1027, 27076, 2740, 5986, 323, 6612, 75323, 922, 50828, 3938, 0, 7648, 315, 1124, 1053, 2646, 617, 734, 291, 198, 33871, 13, 578, 11495, 10896, 11, 61325, 356, 1751, 11, 720, 44, 920, 13, 10555, 304, 813, 198, 2239, 435, 15067, 11, 578, 29950, 27304, 220, 430, 220, 2075, 4, 315, 1884, 12020, 198, 1729, 54560, 13241, 779, 49723, 430, 814, 1051, 3025, 998, 16063, 264, 810, 65655, 11, 44467, 11, 4642, 2324, 0, 9639, 198, 43824, 220, 11344, 23754, 198, 66177, 198, 72337, 198, 97213, 23754, 29976, 1220, 18042, 1295, 6401, 612, 5843, 52779, 26072, 220, 1544, 198, 33, 88840, 64182, 198, 91848, 709, 323, 2019, 482, 11450, 358, 1097, 2133, 311, 387, 44467, 11, 39345, 198, 438, 289, 12329, 304, 856, 7446, 5496, 0, 358, 1097, 279, 24862, 315, 856, 2324, 323, 1097, 9738, 311, 49715, 433, 5496, 264, 220, 1041, 4, 9498, 19433, 0, 220, 37812, 1389, 220, 24241, 1274, 7349, 14992, 11, 527, 39345, 11, 323, 3974, 5129, 0, 220, 1389, 55034, 3320, 16094, 3947, 374, 459, 2362, 6063, 5605, 25, 1054, 71551, 63802, 294, 18177, 12868, 198, 67, 56414, 2476, 477, 1054, 2460, 1695, 2574, 527, 2380, 2029, 1226, 11, 439, 22125, 198, 50810, 5383, 264, 4359, 15609, 555, 264, 490, 13797, 1389, 279, 20941, 11, 12103, 198, 438, 19229, 26099, 13, 2418, 11, 2288, 11, 374, 24306, 315, 264, 490, 13797, 13, 578, 198, 82, 11206, 220, 374, 279, 1176, 893, 11, 279, 37374, 11, 279, 3927, 11, 279, 198, 9164, 2786, 11, 902, 3727, 1855, 315, 603, 5016, 13, 578, 4059, 198, 285, 279, 2132, 893, 11, 1555, 902, 279, 13836, 477, 279, 1176, 1543, 374, 13605, 26, 279, 13836, 753, 1193, 3445, 315, 7645, 11829, 2547, 220, 374, 279, 4948, 893, 11, 279, 7106, 11, 9621, 961, 280, 1820, 3445, 555, 902, 279, 4059, 61120, 26, 1101, 1202, 1193, 47321, 11, 323, 1202, 1193, 3941, 315, 3729, 449, 4676, 5221, 2423, 2380, 527, 832, 11, 1120, 439, 279, 4359, 2025, 320, 12792, 483, 11994, 340, 285, 832, 11, 1855, 3339, 264, 961, 315, 420, 45125, 2663, 893, 13, 7854, 198, 36064, 304, 13937, 374, 16475, 555, 22037, 627, 4235, 75463, 78046, 11, 220, 279, 20941, 315, 19152, 7927, 14285, 2209, 4718, 42770, 1245, 5492, 1389, 34763, 1102, 198, 791, 2547, 374, 24306, 315, 1690, 3697, 11, 3686, 374, 832, 198, 2664, 13, 1442, 832, 315, 279, 3697, 7831, 11, 682, 3885, 7831, 449, 198, 275, 13, 1226, 15641, 430, 279, 2547, 374, 264, 4459, 11, 4250, 387, 198, 614, 4591, 323, 374, 1903, 709, 315, 264, 4029, 315, 15499, 4166, 291, 323, 958, 9920, 36853, 11, 39881, 11, 323, 7917, 26, 1855, 198, 276, 3927, 5089, 11, 3686, 779, 15499, 5552, 430, 539, 832, 315, 198, 49818, 649, 3073, 10980, 505, 279, 4459, 13, 1789, 2288, 1317, 279, 898, 706, 19894, 1521, 5370, 36853, 439, 46305, 11, 477, 198, 385, 437, 989, 5552, 11, 8316, 13, 7648, 1274, 527, 43131, 311, 4322, 198, 9739, 810, 477, 2753, 32399, 11, 539, 44114, 430, 422, 389, 752, 472, 315, 279, 3687, 23936, 4459, 47521, 11, 682, 279, 2800, 7831, 627, 791, 2547, 374, 279, 1455, 11364, 296, 6348, 8061, 3187, 3596, 198, 7266, 315, 13882, 85957, 5865, 304, 832, 4459, 323, 198, 275, 2011, 387, 12020, 2744, 439, 264, 5089, 13, 3639, 374, 1695, 369, 832, 198, 4581, 374, 1695, 369, 682, 26, 1148, 374, 3958, 374, 3958, 369, 682, 279, 5596, 13, 1442, 198, 1820, 31316, 374, 11754, 555, 13481, 48009, 11, 1587, 539, 279, 4459, 2547, 198, 82, 2084, 449, 433, 30, 2876, 1193, 374, 279, 6784, 69177, 389, 279, 4459, 198, 1543, 11, 719, 279, 44225, 315, 1654, 17718, 3769, 706, 311, 1297, 3448, 2512, 315, 555, 279, 4459, 2547, 1389, 279, 4814, 315, 38575, 11, 279, 198, 2025, 1815, 11, 279, 61880, 11, 279, 34653, 323, 279, 523, 3385, 1389, 3686, 279, 998, 68, 374, 279, 1193, 11754, 4562, 430, 649, 387, 3970, 13, 763, 279, 40657, 315, 54560, 11, 584, 527, 11920, 449, 279, 4459, 1732, 198, 4235, 2737, 279, 13836, 11, 4059, 323, 2547, 4999, 34192, 53389, 374, 44921, 369, 6401, 198, 644, 279, 6017, 315, 9601, 11, 279, 17377, 11, 1322, 56039, 220, 1419, 25, 22, 10975, 603, 512, 1054, 2520, 439, 893, 1781, 774, 304, 813, 4851, 11, 779, 374, 568, 49216, 4599, 264, 14363, 1732, 15320, 21770, 1634, 5678, 430, 383, 690, 2646, 636, 1664, 11, 433, 9221, 4661, 3738, 430, 26301, 93795, 323, 35665, 690, 6920, 1461, 311, 279, 25165, 627, 99155, 374, 30355, 0, 220, 1226, 2646, 1390, 499, 311, 10894, 430, 198, 25159, 13, 3011, 374, 279, 2944, 584, 1005, 433, 927, 323, 927, 33871, 13, 578, 4059, 11, 701, 6500, 11, 374, 2216, 279, 26991, 198, 38691, 304, 701, 4553, 27649, 13, 99155, 4250, 1781, 369, 198, 275, 726, 1606, 1193, 279, 4059, 1587, 682, 279, 7422, 13, 3011, 285, 3249, 499, 2011, 67632, 45003, 53389, 13, 10866, 198, 3648, 25996, 19723, 8710, 3831, 12939, 315, 4059, 62211, 198, 51086, 304, 2890, 315, 4059, 323, 2547, 13, 22728, 4504, 279, 4059, 449, 198, 2106, 7709, 11, 23788, 11, 43685, 15419, 11, 27102, 11, 10173, 323, 6928, 7422, 198, 65, 6478, 8056, 18637, 13, 220, 1389, 25996, 8604, 62123, 87555, 22329, 12871, 7927, 23754, 15832, 7935, 4718, 14285, 4999, 791, 4059, 2011, 617, 264, 690, 315, 11245, 323, 2744, 387, 304, 198, 5749, 315, 279, 2547, 13, 5659, 420, 1938, 4741, 4048, 1268, 198, 998, 28779, 11555, 13, 3277, 8389, 11555, 320, 2199, 220, 8929, 340, 300, 11, 1054, 40, 1097, 13490, 856, 4907, 1606, 994, 499, 636, 9191, 198, 9514, 1212, 311, 9229, 4907, 863, 1389, 29933, 701, 4059, 11, 8454, 433, 4291, 6928, 11555, 430, 2019, 11, 1054, 17166, 4250, 304, 904, 1648, 198, 64, 1740 ]
0xBreath/holistic-books
of feelings, of pleasure, of enduring love and respect. It is therefore not surprising that long-lasting relationships are almost invariably more or less dead in feelings. Diculties that arise in a relationship are always signals for something unattended to. They are a loud message for those who can hear it. The sooner it is heeded, the more spiritual energy will be released, so that the state of bliss can expand along with the inner being of both partners. There is a mechanism in a relationship between a man and a woman that can be likened to a very nely calibrated instrument that shows the nest and most subtle aspects of the relationship and the individual state of the two people involved. This is not suciently recognized by even the most aware and sophisticated people who are otherwise familiar with spiritual and psychological truth. Every day and every hour one’s inner state and feelings are a testimony to one’s state of growth, lb the degree they are heeded, the interaction, the feelings, the freedom of ow within and toward each other will blossom. The perfectly mature and spiritually valid relationship must always be deeply connected with personal growth. The moment a relationship is experienced as irrelevant to inner growth, left on its own, as it were, it will falter. Only when both grow to their ultimate, inherent potential can the relationship become more and more dynamic and alive. This work has to be done individually and mutually. When relationship is approached in that way, it will be built on rock, not sand. No fear will ever nd room under such circumstances. Feelings will expand, and security about the self and each other will grow. At any given moment, each partner will serve as a mirror to the inner state of the other and therefore to the relationship. Whenever there is friction or deadness, it is an indicat ion that something must be stuck. Some interaction between the two people remains unclear and it needs to be looked at. If it is understood and brought out into the open, growth will proceed at maximum speed,and, in the dimension of feeling, happiness, bliss, profound experience, and ecstasy will become forever deeper and more beautiful, and life will acquire more meaning. Conversely, fear of intimacy implies rigidity and the denial of one’s own share in the relationship’s diculties. Anyone who ignores these principles, or who pays only lip service to them, is emotionally not ready to assume the responsibility for his or her inner suering—either within a relationship or in its absence. So you see, my friends, it is of the greatest importance to recognize that bliss and beauty, which are eternal spiritual realities, are available to all those who seek the key to the problems of human interaction, as well as to loneliness, within their own hearts. True growth is as much a spiritual reality as are profound fulllment, vibrant aliveness, and blissful, joyous relating. When you are inwardly ready to relate to another human being in such a fashion, you will nd the appropriate partner with whom this manner of sharing is possible. It will no longer frighten you, will no longer beset you with conscious or unconscious fears when you use this all- important key. You cannot ever feel helpless or victimized when the signicant transition has taken place in your life and you no longer render others responsible for what you experience or fail to experience. Thus growth and fullled, beautiful living become one and the same. May you all carry with you this new material and an inner energy awakened by your goodwill. May these words be the beginning of a new inner modality to meet life, to nally decide, “I want to risk my good feelings. I want to seek the cause in me, rather than in the other person, so that I become free to love.” This kind of meditation will indeed bear fruit. If you carry away a germ, a particle, of this lecture, it has truly been fruitful. Be blessed, all of you, my dearest friends, so that you become the gods that you potentially are. OceanofPDF.com8 Emotional Growth and Its Function “If I didn’t feel anything, I wouldn’t suer.” Most people are trying very hard not to feel in the mistaken belief that then they could avoid being unhappy. Haven’t you had such a thought? We think it is only a thought, but this wish has its consequenc e: the numbing of our feeling capacity. Yet, the repression of feelings does not alleviate suering; on the contrary, it increases the pain. Feelings need room to grow, just as our minds and bodies do, so that we achieve a higher emotional state in which we can dare to love. Greetings, my dearest friends. God bless each one of you, blessed is this hour. In order to know yourself on a deeper level, it becomes increasingly necessary to allow all emotions to reach surface awareness, so as to understa nd these emotions and to enable them to mature. Most of you have a great resistance to letting this happen. You are unaware of the obstructions you put in the way of your own growth. Hence it is necessary that I discuss the mechanism of your resistance. Let us rst be clear about the unity of the human personality. Human beings who function harmoniously have developed the physical, ment al, and emotional sides of their nature. These three spheres are supposed to function harmoniously with one another, each helping the other, rather than one faculty subduing another. Ifone function is underdeveloped, it causes a disharmony in the human structure, and also cripples the entire personality. Now let us understand what causes human beings to particularly neglect, repres s, and cripple the growth of their emotion al nature. This neglect is universal. Most human beings look mainly after the physical self. They do more or less what is necessary to make it grow and remain healthy. A good portion of humanity cultivates the mental side. In order to do so you learn, you use your brain, your thinking capacity; you absorb, you train your memory and your logical reasoning. All this furthers mental growth. But why is the emotional nature generally neglected? There are good reasons for that, my friends. To gain more clarity, let us rst understand the function of the emotional nature in human beings. It includes, rst of all, the capacity to feel. The capacity to experience feeling is synonymous with the capacity to give and receive happiness. To the degree you shy away from any kind of emotional experience, to that extent you also close the door to the experience of happ iness. Moreover, the emotional side of your nature, when functioning, possesses creative ability. To the degree you close yourself o from emotional experience, to that very degree the full potential of your creative ability is hindered in manifesting itself. Contrary to what many of you may believe, the unfolding of creative ability is not a mere mental process. In fact, the intellect has much less to do with it than may appear at rst glance, in spite of the fact that technical skill also becomes a necessity in order to give the creative outow full expression. Creative unfoldment is an intuitive process. Needless to say, intuitio n can function only to the degree that your emotional life is strong, healthy, and mature. Therefore, your intuitive powers will be hindered if you have neglected emotional growth and discouraged yourself from experiencing the world of feeling. Why is there such a predominant emphasis in your world today on physical and mental growth and a conspicuous neglect of emotional growth? Several general explanations could be advanc ed, but I would like to go immediately to the root of the problem.Numbing of Feelings to Avoid Unhappiness In the world of feeling you experience the good and the bad, the happy and the unhappy, pleasure and pain. Contra ry to just registering such impressions mentally, emotional experie nce really touches you. Since your struggle is primarily for happiness, and since immature emotions lead to unhappiness, your secondary aim becomes the avoidance of unhappiness. Unhappy circumstances exist in every child’s life; pain and disappointment are common. This creates the early, mostly unconscious, conclusion: “If I do not feel, then I will not be unhappy.” In other words, instead of taking the courageous and appropriate step of living through negative, immature emotions in order to aord them the opportunity to grow and thus become mature and constructive, the childish emotions are suppressed, put out of awareness and buried, so that they remain inadequate and destructive, even though the person is unaware of their existence. Although it may be true that you can anesthetize your capacity for emotional experience, and therefore cannot feel immediate pain, it is also true that you dull your capacity for happiness and pleasure while not really avoiding the dreaded unhappiness in the long run. The unhappiness you seem to avoid will come to you in a dierent and much more painful, but indirect, way. The bitter hurt of isolation, of loneliness, of the gnawing feeling of having passed through life without experiencing its heights and depths, without developing yourself to
[ 315, 16024, 11, 315, 17069, 11, 315, 52876, 198, 31153, 323, 5201, 13, 1102, 374, 9093, 539, 15206, 430, 1317, 65265, 198, 86924, 527, 4661, 74614, 810, 477, 2753, 5710, 304, 16024, 627, 22427, 188, 93113, 552, 430, 31889, 304, 264, 5133, 527, 2744, 17738, 369, 198, 34431, 653, 86006, 311, 13, 2435, 527, 264, 17813, 1984, 369, 1884, 889, 198, 4919, 6865, 433, 13, 578, 31373, 433, 374, 568, 31035, 11, 279, 810, 18330, 4907, 690, 198, 1395, 6004, 11, 779, 430, 279, 1614, 315, 59045, 649, 9407, 3235, 449, 279, 198, 4481, 1694, 315, 2225, 8717, 13, 2684, 374, 264, 17383, 304, 264, 5133, 198, 42967, 264, 893, 323, 264, 5333, 430, 649, 387, 55385, 291, 311, 264, 1633, 220, 188, 77, 989, 198, 5531, 61666, 14473, 430, 5039, 279, 220, 188, 22129, 323, 1455, 27545, 13878, 198, 1073, 279, 5133, 323, 279, 3927, 1614, 315, 279, 1403, 1274, 198, 14386, 8905, 13, 1115, 374, 539, 924, 188, 12575, 398, 15324, 555, 1524, 279, 1455, 8010, 198, 438, 27877, 1274, 889, 527, 6062, 11537, 449, 18330, 198, 438, 24064, 8206, 13, 7357, 1938, 323, 1475, 6596, 832, 753, 9358, 1614, 198, 438, 16024, 527, 264, 24365, 311, 832, 753, 1614, 315, 6650, 11, 19398, 279, 8547, 198, 20670, 527, 568, 31035, 11, 279, 16628, 11, 279, 16024, 11, 279, 11542, 315, 220, 188, 363, 198, 56950, 323, 9017, 1855, 1023, 690, 89858, 627, 791, 14268, 15196, 323, 88853, 2764, 5133, 2011, 198, 33222, 387, 17693, 8599, 449, 4443, 6650, 13, 578, 4545, 264, 198, 37195, 374, 10534, 439, 40815, 311, 9358, 6650, 11, 2163, 389, 1202, 198, 785, 11, 439, 433, 1051, 11, 433, 690, 26564, 466, 13, 8442, 994, 2225, 3139, 311, 872, 198, 67666, 11, 38088, 4754, 649, 279, 5133, 3719, 810, 323, 198, 6518, 8915, 323, 13989, 13, 1115, 990, 706, 311, 387, 2884, 32399, 323, 198, 7129, 1870, 13, 3277, 5133, 374, 25735, 304, 430, 1648, 11, 433, 690, 387, 198, 47339, 389, 7091, 11, 539, 9462, 13, 2360, 8850, 690, 3596, 220, 188, 303, 3130, 1234, 1778, 198, 44398, 372, 9623, 13, 32833, 826, 690, 9407, 11, 323, 4868, 922, 279, 659, 323, 198, 9739, 1023, 690, 3139, 13, 2468, 904, 2728, 4545, 11, 1855, 8427, 220, 690, 8854, 198, 300, 264, 18327, 311, 279, 9358, 1614, 315, 279, 1023, 323, 9093, 311, 279, 198, 37195, 627, 65361, 1070, 374, 39676, 477, 5710, 2136, 11, 433, 374, 459, 4547, 266, 28772, 430, 198, 34431, 2011, 387, 16075, 13, 4427, 16628, 1990, 279, 1403, 1274, 198, 1864, 1771, 25420, 323, 433, 3966, 311, 387, 7111, 520, 13, 1442, 433, 374, 16365, 323, 198, 65, 6478, 704, 1139, 279, 1825, 11, 6650, 690, 10570, 520, 7340, 4732, 51526, 11, 304, 279, 13167, 315, 8430, 11, 23871, 11, 59045, 11, 28254, 198, 50659, 11, 323, 93663, 690, 3719, 16058, 19662, 323, 810, 198, 88044, 11, 323, 2324, 690, 21953, 810, 7438, 627, 1128, 3078, 989, 11, 8850, 315, 66264, 24897, 13552, 19025, 323, 279, 35013, 315, 198, 606, 753, 1866, 4430, 304, 279, 5133, 753, 1891, 188, 93113, 552, 13, 33634, 889, 198, 625, 4692, 1521, 16565, 11, 477, 889, 21935, 1193, 19588, 2532, 311, 1124, 11, 374, 198, 74453, 750, 539, 5644, 311, 9855, 279, 12014, 369, 813, 477, 1077, 198, 4481, 924, 188, 4776, 2345, 50998, 2949, 264, 5133, 477, 304, 1202, 19821, 627, 4516, 499, 1518, 11, 856, 4885, 11, 433, 374, 315, 279, 12474, 12939, 311, 198, 34551, 553, 430, 59045, 323, 13444, 11, 902, 527, 35825, 18330, 50446, 11, 527, 198, 10547, 311, 682, 1884, 889, 6056, 279, 1401, 311, 279, 5435, 315, 3823, 198, 69175, 11, 439, 1664, 439, 311, 75040, 11, 2949, 872, 1866, 23492, 13, 3082, 198, 74189, 374, 439, 1790, 264, 18330, 8903, 439, 527, 28254, 5716, 188, 657, 479, 13801, 85, 10892, 519, 453, 13071, 11, 323, 59045, 1285, 11, 16267, 788, 23343, 662, 3277, 499, 527, 198, 258, 1637, 398, 5644, 220, 311, 29243, 311, 2500, 3823, 1694, 304, 1778, 264, 11401, 345, 9514, 690, 220, 188, 303, 279, 8475, 220, 8427, 220, 449, 8884, 420, 11827, 315, 198, 84746, 374, 3284, 13, 1102, 690, 912, 5129, 30647, 268, 499, 11, 690, 912, 5129, 198, 9620, 295, 499, 449, 17371, 477, 40711, 24087, 994, 499, 1005, 420, 682, 7058, 15693, 1401, 13, 1472, 4250, 3596, 2733, 63628, 477, 11996, 1534, 994, 279, 198, 7908, 72, 188, 66363, 9320, 706, 4529, 2035, 304, 701, 2324, 323, 499, 912, 5129, 198, 7472, 3885, 8647, 369, 1148, 499, 3217, 477, 3775, 311, 198, 50659, 13, 14636, 6650, 323, 5716, 188, 75, 839, 11, 6366, 5496, 3719, 832, 198, 438, 279, 1890, 627, 11356, 499, 682, 6920, 449, 499, 420, 502, 3769, 323, 459, 9358, 4907, 198, 675, 3448, 291, 555, 701, 82746, 13, 3297, 1521, 4339, 387, 279, 7314, 315, 264, 198, 943, 9358, 1491, 2786, 311, 3449, 2324, 11, 311, 220, 188, 77, 750, 10491, 11, 1054, 40, 1390, 220, 311, 5326, 856, 198, 19045, 16024, 13, 358, 1390, 311, 6056, 279, 5353, 304, 757, 11, 4856, 1109, 304, 279, 198, 1605, 1732, 11, 779, 430, 358, 3719, 1949, 311, 3021, 2029, 1115, 3169, 315, 33862, 198, 14724, 13118, 11984, 14098, 13, 1442, 499, 6920, 3201, 264, 82986, 11, 264, 19320, 11, 315, 420, 198, 77861, 11, 433, 706, 9615, 1027, 89684, 13, 2893, 33944, 11, 682, 315, 499, 11, 856, 409, 15795, 198, 30562, 11, 779, 430, 499, 3719, 279, 29913, 430, 499, 13893, 527, 627, 97283, 1073, 24317, 916, 23, 720, 2321, 41964, 34871, 323, 11699, 5830, 198, 38684, 358, 3287, 1431, 2733, 4205, 11, 358, 8434, 1431, 924, 188, 261, 2029, 7648, 1274, 527, 198, 85134, 1633, 2653, 539, 311, 2733, 304, 279, 37104, 16801, 430, 1243, 814, 198, 29177, 5766, 1694, 43251, 13, 42714, 1431, 499, 1047, 1778, 264, 3463, 30, 1226, 198, 27963, 433, 374, 1193, 264, 3463, 11, 719, 420, 6562, 706, 1202, 12777, 967, 384, 25, 279, 198, 2470, 7278, 315, 1057, 8430, 8824, 13, 14968, 11, 279, 72498, 315, 16024, 1587, 198, 1962, 61705, 924, 188, 4776, 26, 389, 279, 26102, 11, 433, 12992, 279, 6784, 627, 34027, 826, 1205, 3130, 311, 3139, 11, 1120, 439, 1057, 20663, 323, 13162, 656, 11, 779, 198, 9210, 584, 11322, 220, 264, 5190, 14604, 1614, 304, 902, 584, 649, 33304, 311, 198, 31153, 627, 92886, 11, 856, 409, 15795, 4885, 662, 4359, 16458, 1855, 832, 315, 499, 11, 33944, 198, 285, 420, 6596, 627, 644, 2015, 311, 1440, 6261, 389, 264, 19662, 2237, 11, 433, 9221, 198, 43842, 4522, 398, 5995, 311, 2187, 682, 21958, 311, 5662, 7479, 198, 20111, 2136, 11, 779, 439, 311, 14653, 64, 15953, 1521, 21958, 323, 311, 7431, 1124, 198, 998, 15196, 13, 7648, 315, 499, 617, 264, 2294, 13957, 311, 20806, 420, 198, 71, 64860, 13, 1472, 527, 41747, 315, 279, 1536, 20232, 499, 2231, 304, 279, 1648, 315, 198, 22479, 1866, 6650, 13, 32140, 433, 374, 5995, 430, 358, 4358, 279, 17383, 198, 1073, 701, 13957, 627, 10267, 603, 220, 188, 59125, 387, 2867, 922, 279, 31426, 315, 279, 3823, 17743, 627, 35075, 23837, 220, 889, 734, 18249, 13610, 617, 8040, 279, 198, 47692, 11, 11540, 453, 11, 323, 14604, 11314, 315, 872, 7138, 13, 4314, 2380, 198, 82, 65733, 527, 10171, 311, 734, 18249, 13610, 449, 832, 2500, 345, 9739, 10695, 279, 1023, 11, 4856, 1109, 832, 22291, 1207, 1072, 287, 2500, 13, 1442, 606, 734, 374, 1234, 16219, 291, 11, 433, 11384, 264, 12269, 277, 65527, 304, 279, 198, 26380, 6070, 11, 323, 1101, 71108, 645, 279, 4553, 17743, 627, 7184, 1095, 603, 3619, 1148, 11384, 3823, 23837, 311, 8104, 198, 29875, 772, 11, 2109, 417, 274, 11, 323, 71108, 273, 279, 6650, 315, 872, 20356, 453, 7138, 627, 2028, 39332, 374, 20789, 13, 7648, 3823, 23837, 1427, 14918, 1306, 279, 198, 47692, 659, 13, 2435, 656, 810, 477, 2753, 1148, 374, 5995, 311, 1304, 433, 198, 67318, 323, 7293, 9498, 13, 362, 1695, 13651, 315, 22706, 27981, 988, 279, 198, 93221, 3185, 13, 763, 2015, 311, 656, 779, 499, 4048, 11, 499, 1005, 701, 8271, 11, 701, 198, 83360, 8824, 26, 499, 35406, 11, 499, 5542, 701, 5044, 220, 323, 701, 198, 31356, 33811, 13, 2052, 420, 18742, 3058, 10723, 6650, 627, 4071, 3249, 374, 279, 14604, 7138, 8965, 51533, 30, 2684, 527, 198, 19045, 8125, 369, 430, 11, 856, 4885, 13, 2057, 8895, 810, 32373, 11, 1095, 603, 220, 188, 59125, 198, 8154, 2752, 279, 734, 315, 279, 14604, 7138, 304, 3823, 23837, 13, 1102, 198, 14866, 11, 220, 188, 59125, 315, 682, 11, 279, 8824, 311, 2733, 13, 578, 8824, 311, 3217, 198, 1897, 20659, 374, 69593, 449, 279, 8824, 311, 3041, 323, 5371, 198, 71, 67391, 13, 2057, 279, 8547, 499, 33394, 3201, 505, 904, 3169, 315, 14604, 198, 50659, 11, 311, 430, 13112, 499, 1101, 3345, 279, 6134, 311, 279, 3217, 198, 1073, 2306, 304, 434, 13, 23674, 11, 279, 14604, 3185, 315, 701, 7138, 11, 994, 198, 1723, 287, 11, 50326, 11782, 5845, 13, 2057, 279, 8547, 499, 3345, 6261, 198, 78, 188, 505, 14604, 3217, 1174, 311, 430, 1633, 8547, 279, 2539, 4754, 315, 198, 22479, 11782, 5845, 374, 57780, 291, 304, 14794, 287, 5196, 13, 35341, 661, 311, 1148, 198, 35676, 315, 499, 1253, 4510, 11, 279, 33831, 315, 11782, 5845, 374, 539, 264, 198, 61031, 10723, 1920, 13, 763, 2144, 11, 279, 17108, 706, 1790, 2753, 311, 656, 449, 198, 275, 1109, 1253, 5101, 520, 220, 188, 59125, 34522, 11, 304, 34781, 315, 279, 2144, 430, 11156, 198, 30554, 1101, 9221, 264, 32961, 304, 2015, 311, 3041, 279, 11782, 704, 188, 363, 198, 9054, 7645, 13, 25248, 28572, 479, 374, 459, 42779, 1920, 13, 83383, 198, 998, 2019, 11, 97301, 822, 308, 649, 734, 1193, 311, 279, 8547, 430, 701, 14604, 198, 14789, 374, 3831, 11, 9498, 11, 323, 15196, 627, 55915, 11, 701, 42779, 13736, 690, 387, 57780, 291, 422, 499, 617, 198, 29875, 2258, 14604, 6650, 323, 64770, 6261, 505, 198, 327, 32836, 11627, 279, 1917, 315, 8430, 13, 8595, 374, 1070, 1778, 264, 96531, 198, 87292, 304, 701, 1917, 3432, 389, 7106, 323, 10723, 6650, 323, 264, 198, 444, 2203, 292, 9373, 39332, 315, 14604, 6650, 30, 26778, 4689, 198, 327, 10609, 811, 1436, 387, 3439, 1149, 1608, 11, 719, 358, 1053, 1093, 311, 733, 7214, 198, 998, 279, 3789, 315, 279, 3575, 2112, 33546, 315, 32833, 826, 311, 35106, 1252, 71, 67391, 198, 644, 279, 1917, 315, 8430, 499, 3217, 279, 1695, 323, 279, 3958, 11, 279, 198, 57621, 323, 279, 43251, 11, 17069, 323, 6784, 13, 1221, 2221, 35019, 311, 1120, 198, 6477, 287, 1778, 51091, 220, 34325, 11, 14604, 2183, 648, 308, 346, 2216, 198, 78053, 499, 13, 8876, 701, 14993, 374, 15871, 369, 23871, 11, 323, 198, 11536, 86525, 21958, 3063, 311, 31175, 67391, 11, 701, 14580, 9395, 198, 17106, 20969, 279, 65411, 315, 31175, 67391, 13, 1252, 57621, 13463, 198, 29675, 304, 1475, 1716, 753, 2324, 26, 6784, 323, 41698, 527, 4279, 627, 2028, 11705, 279, 4216, 11, 10213, 40711, 11, 17102, 25, 1054, 2746, 358, 656, 539, 198, 57676, 11, 1243, 358, 690, 539, 387, 43251, 2029, 220, 763, 1023, 4339, 11, 4619, 315, 4737, 279, 198, 66, 61140, 788, 323, 8475, 3094, 315, 5496, 1555, 8389, 345, 12828, 1598, 21958, 304, 2015, 311, 264, 188, 541, 1124, 279, 6776, 311, 3139, 198, 438, 8617, 3719, 15196, 323, 54584, 11, 279, 94271, 21958, 527, 198, 13066, 14655, 11, 2231, 704, 315, 17985, 323, 28016, 11, 779, 430, 814, 7293, 198, 258, 1037, 19684, 323, 40652, 11, 1524, 3582, 279, 1732, 374, 41747, 315, 198, 50828, 14209, 627, 16179, 433, 1253, 387, 837, 430, 499, 649, 459, 478, 14122, 553, 701, 8824, 198, 2000, 14604, 3217, 11, 323, 9093, 4250, 2733, 14247, 6784, 345, 275, 374, 1101, 837, 430, 499, 41630, 701, 8824, 369, 23871, 323, 17069, 198, 3556, 539, 2216, 31526, 279, 83590, 31175, 67391, 304, 279, 1317, 1629, 627, 791, 31175, 67391, 499, 2873, 311, 5766, 690, 2586, 311, 499, 304, 264, 1891, 188, 261, 306, 198, 438, 1790, 810, 26175, 11, 719, 25636, 11, 1648, 13, 578, 26242, 13194, 315, 198, 285, 36062, 11, 315, 75040, 11, 315, 279, 39719, 675, 287, 8430, 315, 3515, 5946, 198, 20322, 2324, 2085, 25051, 1202, 36394, 323, 43957, 11, 2085, 198, 16219, 287, 6261, 311 ]
0xBreath/holistic-books
hold you back! Giving from Your Heart The opposite of people pleasing is true giving. What differs is your motive. True giving is motivate d by joy, an overflow of inspiration, and a desire to extend. We all know how it gets in interd ependent relationships, where you are walking a fine line, trying to keep the balance of give-and-take. You need to wash away this idea of reciprocity by truly giving the love that’s in your heart without expectation and without exception. To do so, let go of the fear that you could lose something. Let go of the belief that you need special affiliations with certain people or groups. When you get in touch with your truly inspired purpose, things may fall away, but it will not matter, as you will feel that you have outgrown them. You don’t have to try to stretch anything or compromise, and you don’t have to play to the crowd. Follow your passion and your calling— that strong feeling of what it is that you have to give and how to extend it. This draws the mind away from past patterns and associations. It is very freeing. The story of Jesus shows us how to do this. Jesus had an attitude of love and respect without people pleasing at all. He had only true empathy and true compassion. I cry when I read the sermons Jesus gave. I cry when I see how he was interacting with his fellow human beings, no matter who they were or what they seemed to have done. We are all touched by how he treated the Samaritan woman at the well and the prostitute that they caught and were ready to stone. Most human beings deal with a lot of compliments and criticisms as part of daily life. Even though Jesus was living with the twelve apostles, he never said, “Hey James, I like that haircut,” or “Hey Peter, that’s a beautiful robe you’re wearing. Hey John, where did you get those sandals? They look great!” We laugh at that because those aren’ t Jesus’ s words. Yet, we often buy into compliments and criticisms in our own life. Compliments are generally judged to be positive, and the criticismsare nega tive. But Jesus and the Holy Spirit draw away from both of those, from judgment into a state of perfect equality, a state of grace. We see in the world exactly what we project from our unconsc ious mind. Everything we think is teaching the whole universe what we believe we are and what we believe it is. Every single thought, every single word, and every single action is teaching. It’s as if you were broadcasting or live streamin g to the entire cosmos all the time. Projection make s perception. The world reflects your consc iousness. This is why, in order to dismantle your people-pleaser habit, you need to go through a purification of consciousness, where you begin to realize how powerful your mind is. Jesus had gone through this purification; that’s why he is an example. I see him as a representation, a demonstration of the highest that we can attain in awareness. Jesus wasn’ t struggling and getting into all kinds of conflicts and competitions; he didn’ t compare and contrast or fight against anything. He had a presence that radiated, and this is a wonderful example of our natural state of mind—of gentleness, kindness, friendliness, openness, and love, all the things we would expect from a living demonstration of Spirit. It’s in the day-to-day, moment-by-moment living attitude that we can demonstrate that pure love too. Years ago, when I started undo ing people pleasing and practicing true empathy, I noticed that guidance was essential. I’d be getting into these deep mystical states while meditating, and my mother would invite me to family dinners and different things. I would usually be guided to respond with something like, “Thank you very much for thinking of me; thank you so much for inviting me.” The graciousness of the Spirit was always there with a thank-you, and then, “No, I don’t think I’m going to be coming.” Or sometimes it would even be, “I’ll just have to be in the moment. I will let you know.” I was living more in the moment instead of doing a lot of planning. I was allowing myself to be spontaneous and just let the Holy Spirit guide me moment by moment. I started to more and more consistently follow what I truly felt was in my heart. By letting go of the people- pleaser role, you step into your authenticity, your true nature. You have integrity, having gone through aprocess of discernment. You are going to say no at times. You need to say no to loved ones. Are you ready? Are you prepared? If you really want to move beyond the ego’s defenses, beyond people pleasing, get ready to say no to loved ones—as guided. And get ready to say yes—as guided. When you say no, let the Holy Spirit say it through you. It will usually come out something like, “No, thank you,” or “No, but thank you so much for asking.” It is a beautiful expression of love when you can say no while feeling gratitude in your heart. You are laying aside the ego’s voice that insists that no is bad and yes is good. No one comes to peace of mind by people pleasing, by saying yes to everyth ing. Jim Carrey’ s character in the movie Yes Man had to learn this! If you have a situation where you feel you have been compromi sing and you need to take action, do so when you are in a state of peace. A woman who had been compromising and “pleasing” her mother with certain behaviors for thirty years recognized this defense mechanism and had an open, direct talk with her mother. The theme of the talk was “no more.” The straightforward, direct approach may seem to make waves initially, but it is an antidote to denial, repression, and resentment. Spirit-inspired courtesy is not people pleasing. So, question your thoughts and behavior and be aware of your motive. You will know by how you feel if you are people pleasing. Guilt is always hidden in the past, and you cannot have both ego-induced politeness and freedom at the same time. The present moment is forgotten when we operate from people pleasing based on past conditioning and so is the Spirit’ s guidance. Do not think you can hold onto the past and expect yourself to feel infin ite and free at the same time. Instead, be Spirit-inspired in terms of real kindness. From this place, you do not have a moment of doubt, and there are none of those words that are in the grey zone. The results of laying aside people pleasing are authentic relationships, real healing, and joy! You will feel a calm assurance when you speak from your heart and say what you feel is truly most helpful. As you do, past pattern s, habits, and people-plea sing thoughts of guilt will dissolve away, for they were never truly a part of the real you.Exercise: Your Fear of Authenticity Bring to mind an area in your life, a relationship, or a situation where you feel that you are wearing a mask or you are afraid to “rock the boat.” Take some time with your journal to reflect upon your feelings around this situation. 1. Write down your thoughts and judgments of yourself or others. Do you have expectations of yourself or of others? 2. Look for a limiting belief about yourself. Give examples of how it is playing out in this situation. 3. Are you able to see that limiting beliefs about yourself are the cause of your people-pleasing habits? 4. Write down any ways you resist letting go of your people- pleasing habits and this limiting belief about yourself. How do you feel about letting the people-pleasing habits go? Do you want to be right about the way you perceive this situation and yourself? 5. Invite the Holy Spirit into this situation to help you release any feelings of responsibility or guilt that accompany the people pleasin g and to let go of any expectations of yourself and others. If it feels effortless and natural, share with the Holy Spirit in your journal about your people- pleasing habits and your willingness to let them go and be happy. Tips for Undoing People Pleasing Here are some stepping-stones to help loosen your automatic people pleasing.When you are asked a question, instead of responding immediately, out of habit, pause. If there is a sense of pressure, defensiveness, or a lack of clarity about what you should answer, give yourself permission to say, “I don’ t know right now, but I will get back to you.” This allows the space to really feel clear on your answer, as well as to see the ego motivation behind automatic responses. Pausing allows the space for the Spirit’ s guidance to be revealed. Be prayerful about making commitments. Giving yourself the space to feel things out and looking at your motivation before saying yes can help make the Holy Spirit’ s guidance more clear to you. When you have been prayerful about a decision, stick with it and follow it through. Speak from your heart! When you directly share your thoughts and feelings, notice any concerns about the other person’ s reactions. Notice and allow your fears and thoughts to arise, such as the fear
[ 3412, 499, 1203, 4999, 97602, 505, 4718, 18449, 198, 791, 14329, 315, 1274, 54799, 374, 837, 7231, 13, 3639, 44642, 374, 701, 198, 76, 24766, 13, 3082, 7231, 374, 62425, 294, 555, 16267, 11, 459, 16891, 315, 20343, 11, 323, 198, 64, 12876, 220, 311, 13334, 13, 1226, 682, 1440, 1268, 433, 5334, 304, 958, 67, 384, 3825, 306, 198, 86924, 11, 1405, 499, 527, 11689, 264, 7060, 1584, 11, 4560, 311, 2567, 279, 198, 22298, 315, 3041, 9976, 2442, 731, 13, 1472, 1205, 311, 11623, 3201, 420, 4623, 315, 67642, 9103, 198, 1729, 9615, 7231, 279, 3021, 430, 753, 304, 701, 4851, 2085, 31293, 323, 198, 30096, 4788, 627, 1271, 656, 779, 11, 1095, 733, 315, 279, 8850, 430, 499, 1436, 9229, 2555, 13, 6914, 733, 315, 198, 1820, 16801, 430, 499, 1205, 3361, 12204, 811, 449, 3738, 1274, 477, 5315, 627, 4599, 499, 636, 304, 5916, 449, 701, 9615, 14948, 7580, 11, 2574, 1253, 4498, 198, 14075, 1174, 719, 433, 690, 539, 5030, 1174, 439, 499, 690, 2733, 430, 499, 617, 704, 62376, 198, 49818, 13, 1472, 1541, 1431, 617, 311, 1456, 311, 14841, 4205, 477, 30485, 11, 220, 323, 499, 198, 15357, 1431, 617, 311, 1514, 311, 279, 13734, 13, 220, 11359, 701, 11939, 323, 701, 8260, 2345, 198, 9210, 3831, 8430, 315, 1148, 433, 374, 430, 499, 617, 311, 3041, 323, 1268, 311, 13334, 198, 275, 13, 1115, 27741, 279, 4059, 3201, 505, 3347, 12912, 323, 30257, 13, 1102, 374, 198, 1225, 67817, 627, 791, 3446, 315, 10811, 5039, 603, 1268, 311, 656, 420, 13, 10811, 1047, 459, 19451, 315, 198, 31153, 323, 5201, 2085, 1274, 54799, 520, 682, 13, 1283, 1047, 1193, 837, 198, 336, 2398, 88, 323, 837, 30481, 13, 358, 16106, 994, 358, 1373, 279, 1446, 24483, 10811, 6688, 627, 40, 16106, 994, 358, 1518, 1268, 568, 574, 45830, 449, 813, 12637, 3823, 23837, 345, 2201, 5030, 889, 814, 1051, 477, 1148, 814, 9508, 311, 617, 2884, 13, 1226, 527, 682, 198, 83, 34170, 555, 1268, 568, 12020, 279, 86356, 13145, 5333, 520, 279, 1664, 323, 279, 198, 782, 7815, 430, 814, 10791, 323, 1051, 5644, 311, 9998, 627, 13622, 3823, 23837, 3568, 449, 264, 2763, 315, 72739, 323, 63836, 439, 198, 4581, 315, 7446, 2324, 13, 7570, 3582, 10811, 574, 5496, 449, 279, 30335, 39571, 645, 345, 383, 2646, 1071, 11, 1054, 19182, 7957, 11, 358, 1093, 430, 86824, 2476, 477, 1054, 19182, 11291, 1174, 430, 753, 264, 198, 88044, 63719, 499, 3207, 12512, 662, 28653, 3842, 11, 1405, 1550, 499, 636, 1884, 198, 92346, 1147, 30, 2435, 1427, 2294, 18319, 1226, 12835, 520, 430, 1606, 1884, 7784, 529, 259, 10811, 529, 274, 198, 5880, 13, 14968, 11, 584, 3629, 3780, 1139, 72739, 323, 63836, 304, 1057, 1866, 198, 14789, 13, 1219, 501, 12843, 527, 8965, 45487, 311, 387, 6928, 11, 323, 279, 63836, 548, 4277, 64, 259, 535, 13, 2030, 10811, 323, 279, 19229, 17326, 4128, 3201, 505, 220, 2225, 315, 198, 54719, 11, 505, 19971, 1139, 264, 1614, 315, 4832, 22526, 1174, 264, 1614, 315, 21507, 627, 1687, 1518, 304, 279, 1917, 7041, 1148, 584, 2447, 505, 1057, 26118, 2445, 602, 788, 198, 38824, 13, 20696, 584, 1781, 374, 12917, 279, 4459, 15861, 1148, 584, 198, 9978, 19704, 584, 527, 323, 1148, 584, 4510, 433, 374, 13, 7357, 3254, 3463, 11, 1475, 198, 15698, 3492, 11, 323, 1475, 3254, 1957, 374, 12917, 13, 1102, 753, 439, 422, 499, 1051, 198, 55262, 287, 477, 3974, 4365, 258, 342, 311, 279, 4553, 83645, 682, 279, 892, 627, 47421, 1304, 274, 21063, 13, 578, 1917, 27053, 701, 13902, 602, 788, 2136, 627, 2028, 374, 3249, 11, 304, 2015, 311, 95158, 701, 1274, 12, 698, 12351, 14464, 11, 499, 1205, 311, 198, 3427, 1555, 264, 94536, 315, 25917, 11, 1405, 499, 3240, 311, 13383, 198, 5269, 8147, 701, 4059, 374, 627, 55065, 1047, 8208, 1555, 420, 94536, 26, 430, 753, 3249, 568, 374, 459, 198, 8858, 13, 358, 1518, 1461, 439, 264, 13340, 11, 264, 30816, 315, 279, 8592, 198, 9210, 584, 649, 36861, 304, 17985, 13, 10811, 5828, 529, 259, 20558, 323, 3794, 1139, 198, 543, 13124, 220, 315, 26885, 323, 43682, 26, 568, 3287, 529, 259, 9616, 323, 13168, 477, 198, 21828, 2403, 4205, 13, 1283, 1047, 264, 9546, 430, 12164, 660, 11, 323, 420, 374, 264, 198, 86, 14518, 1285, 3187, 315, 1057, 5933, 1614, 315, 4059, 2345, 1073, 16265, 77319, 345, 15674, 2136, 11, 4333, 49958, 11, 71160, 11, 323, 3021, 11, 682, 279, 2574, 584, 1053, 198, 17557, 505, 264, 5496, 30816, 315, 17326, 13, 1102, 753, 304, 279, 1938, 4791, 11477, 13801, 29699, 14656, 1474, 13209, 5496, 19451, 430, 584, 649, 20461, 430, 10748, 198, 31153, 2288, 627, 55519, 4227, 11, 994, 358, 3940, 29821, 6892, 1274, 54799, 323, 36666, 198, 1904, 48451, 11, 358, 14000, 430, 19351, 574, 7718, 13, 358, 7070, 387, 3794, 1139, 198, 45010, 5655, 69532, 5415, 1418, 220, 1812, 50644, 11, 323, 856, 6691, 1053, 22114, 198, 2727, 311, 3070, 74413, 323, 2204, 2574, 13, 358, 1053, 6118, 387, 33687, 311, 198, 6961, 449, 2555, 1093, 11, 1054, 13359, 499, 1633, 1790, 369, 7422, 315, 757, 280, 58517, 499, 779, 1790, 369, 42292, 757, 2029, 578, 82426, 2136, 315, 279, 17326, 574, 198, 33222, 1070, 449, 264, 9901, 46517, 11, 323, 1243, 11, 1054, 2822, 11, 358, 1541, 1431, 1781, 358, 4344, 2133, 311, 198, 1395, 5108, 2029, 2582, 7170, 433, 1053, 1524, 387, 11, 1054, 40, 4805, 1120, 617, 311, 387, 304, 279, 198, 29699, 13, 358, 690, 1095, 499, 1440, 662, 863, 358, 574, 5496, 810, 304, 279, 4545, 4619, 198, 1073, 3815, 264, 2763, 315, 9293, 13, 358, 574, 10923, 7182, 311, 387, 54557, 323, 198, 4345, 1095, 279, 19229, 17326, 8641, 757, 4545, 555, 4545, 13, 358, 3940, 220, 311, 810, 198, 438, 810, 21356, 1833, 1148, 358, 9615, 6612, 574, 304, 856, 4851, 627, 1383, 20806, 733, 315, 279, 1274, 12, 7245, 12351, 3560, 11, 499, 3094, 1139, 701, 198, 3322, 4351, 488, 1174, 701, 837, 7138, 13, 1472, 617, 17025, 1174, 3515, 8208, 1555, 264, 4734, 315, 42645, 479, 13, 1472, 527, 2133, 311, 2019, 912, 520, 3115, 13, 1472, 1205, 311, 198, 37890, 912, 311, 10456, 220, 6305, 13, 8886, 499, 5644, 30, 8886, 499, 10235, 30, 1442, 499, 2216, 198, 53757, 311, 3351, 7953, 279, 37374, 753, 46616, 11, 7953, 1274, 54799, 11, 636, 198, 2359, 311, 2019, 912, 311, 10456, 6305, 60654, 33687, 13, 1628, 636, 5644, 311, 2019, 10035, 60654, 198, 66519, 13, 3277, 499, 2019, 912, 11, 1095, 279, 19229, 17326, 2019, 433, 1555, 499, 13, 1102, 690, 198, 44066, 2586, 704, 2555, 1093, 11, 1054, 2822, 11, 9901, 499, 2476, 477, 1054, 2822, 11, 719, 9901, 499, 198, 708, 1790, 369, 10371, 2029, 1102, 374, 264, 6366, 7645, 315, 3021, 994, 499, 649, 198, 37890, 912, 1418, 8430, 46135, 304, 701, 4851, 13, 1472, 527, 35744, 16038, 279, 198, 13546, 753, 7899, 430, 43446, 430, 912, 374, 3958, 323, 10035, 374, 1695, 13, 2360, 832, 4131, 311, 198, 55225, 315, 4059, 555, 1274, 54799, 11, 555, 5605, 10035, 311, 1475, 339, 6892, 13, 11641, 198, 9028, 8233, 529, 274, 3752, 304, 279, 5818, 7566, 2418, 220, 1047, 311, 4048, 420, 4999, 2746, 499, 617, 264, 6671, 1405, 499, 2733, 499, 617, 1027, 26600, 72, 7936, 198, 438, 499, 1205, 311, 1935, 1957, 11, 656, 779, 994, 499, 527, 304, 264, 1614, 315, 9096, 13, 362, 198, 22803, 889, 1047, 1027, 76100, 323, 1054, 698, 4522, 863, 1077, 6691, 449, 198, 66, 7770, 28198, 369, 27219, 1667, 15324, 420, 9232, 17383, 323, 198, 32345, 459, 1825, 11, 2167, 3137, 449, 1077, 6691, 662, 578, 7057, 315, 279, 3137, 574, 1054, 2201, 198, 6518, 2029, 578, 31439, 11, 2167, 5603, 1253, 2873, 311, 1304, 17301, 198, 9613, 398, 1174, 719, 433, 374, 459, 90687, 1295, 311, 35013, 11, 72498, 11, 323, 71654, 627, 87475, 53161, 27104, 374, 539, 1274, 54799, 13, 2100, 11, 3488, 701, 198, 61665, 82, 323, 7865, 323, 387, 8010, 315, 701, 47094, 13, 1472, 690, 1440, 555, 198, 5269, 499, 2733, 422, 499, 527, 1274, 54799, 13, 4673, 3036, 374, 2744, 8340, 304, 279, 198, 53520, 11, 323, 499, 4250, 617, 2225, 37374, 38973, 3435, 24639, 323, 11542, 520, 198, 1820, 1890, 892, 13, 578, 3118, 4545, 374, 25565, 994, 584, 14816, 505, 198, 16455, 54799, 3196, 389, 3347, 35121, 323, 779, 374, 279, 17326, 529, 274, 198, 24343, 685, 13, 3234, 539, 1781, 499, 649, 3412, 8800, 279, 3347, 323, 1755, 6261, 311, 198, 57676, 4225, 258, 433, 68, 323, 1949, 520, 279, 1890, 220, 892, 13, 12361, 11, 387, 17326, 53161, 304, 3878, 198, 1073, 1972, 45972, 662, 5659, 420, 2035, 11, 499, 656, 539, 617, 264, 4545, 315, 10712, 345, 438, 1070, 527, 7000, 315, 1884, 4339, 430, 527, 304, 279, 20366, 10353, 13, 578, 3135, 198, 1073, 35744, 16038, 1274, 54799, 527, 13513, 12135, 11, 1972, 21730, 345, 438, 16267, 4999, 2675, 690, 2733, 264, 19858, 44701, 994, 499, 6604, 505, 701, 4851, 220, 323, 198, 37890, 1148, 499, 2733, 374, 9615, 1455, 11190, 13, 1666, 499, 656, 11, 3347, 5497, 274, 11, 26870, 345, 438, 1274, 12, 698, 64, 7936, 11555, 315, 34951, 690, 73739, 3201, 1174, 369, 814, 1051, 198, 37593, 9615, 264, 961, 315, 279, 1972, 499, 5231, 18865, 25, 4718, 43067, 315, 47467, 488, 198, 65627, 311, 4059, 459, 3158, 304, 701, 2324, 11, 264, 5133, 11, 477, 264, 6671, 198, 2940, 499, 2733, 430, 499, 527, 12512, 264, 7056, 477, 499, 527, 16984, 311, 198, 2118, 21161, 279, 15688, 2029, 12040, 1063, 892, 449, 701, 8486, 311, 8881, 5304, 198, 22479, 16024, 2212, 420, 6671, 627, 16, 13, 9842, 1523, 701, 11555, 323, 59358, 315, 6261, 477, 198, 59961, 13, 3234, 499, 617, 17078, 315, 6261, 477, 315, 3885, 5380, 17, 13, 9372, 369, 264, 33994, 16801, 922, 6261, 13, 21335, 10507, 315, 198, 5269, 433, 374, 5737, 704, 304, 420, 6671, 627, 18, 13, 8886, 499, 3025, 311, 1518, 430, 33994, 21463, 922, 6261, 527, 198, 1820, 5353, 315, 701, 1274, 12, 698, 4522, 26870, 5380, 19, 13, 9842, 1523, 904, 5627, 499, 22884, 20806, 733, 315, 701, 1274, 7058, 698, 4522, 26870, 323, 420, 33994, 16801, 922, 6261, 13, 2650, 198, 3055, 499, 2733, 922, 20806, 279, 1274, 12, 698, 4522, 26870, 733, 30, 3234, 198, 9514, 1390, 311, 387, 1314, 922, 279, 1648, 499, 45493, 420, 198, 47965, 4090, 323, 6261, 5380, 20, 13, 86023, 279, 19229, 17326, 1139, 420, 6671, 311, 1520, 499, 4984, 198, 3852, 16024, 315, 12014, 477, 34951, 430, 19780, 279, 198, 16455, 7245, 51410, 342, 323, 311, 1095, 733, 315, 904, 17078, 315, 198, 22479, 726, 323, 3885, 13, 1442, 433, 11321, 80192, 323, 5933, 11, 4430, 198, 4291, 279, 19229, 17326, 304, 701, 8486, 922, 701, 1274, 7058, 698, 4522, 26870, 323, 701, 39375, 311, 1095, 1124, 733, 323, 387, 198, 57621, 16853, 50179, 369, 71909, 287, 9029, 33540, 4522, 198, 8586, 527, 1063, 36567, 5594, 3233, 220, 311, 1520, 83842, 701, 17392, 1274, 198, 698, 4522, 51861, 499, 527, 4691, 264, 3488, 11, 4619, 315, 30438, 198, 318, 44287, 1174, 704, 315, 14464, 11, 18579, 13, 1442, 1070, 374, 264, 5647, 315, 7410, 345, 755, 729, 13071, 11, 477, 264, 6996, 315, 32373, 922, 1148, 499, 1288, 4320, 13801, 47530, 6261, 8041, 311, 2019, 1174, 1054, 40, 1541, 529, 259, 1440, 1314, 1457, 1174, 719, 358, 198, 14724, 636, 1203, 311, 499, 2029, 1115, 6276, 279, 3634, 311, 2216, 2733, 2867, 389, 198, 22479, 4320, 1174, 439, 1664, 439, 311, 1518, 279, 37374, 25835, 4920, 198, 84556, 14847, 13, 16056, 985, 6276, 279, 3634, 369, 279, 17326, 529, 274, 198, 24343, 685, 311, 387, 10675, 627, 3513, 23788, 1285, 922, 3339, 42356, 13, 58951, 6261, 279, 198, 8920, 311, 2733, 2574, 704, 323, 3411, 520, 701, 25835, 1603, 198, 82, 17718, 10035, 649, 1520, 1304, 279, 19229, 17326, 529, 274, 19351, 810, 2867, 311, 198, 9514, 13, 3277, 499, 617, 1027, 23788, 1285, 922, 264, 5597, 11, 9396, 449, 433, 198, 438, 1833, 433, 1555, 627, 96945, 505, 701, 4851, 0, 3277, 499, 6089, 4430, 701, 11555, 198, 438, 16024, 11, 5406, 904, 10742, 922, 279, 1023, 1732, 529, 274, 198, 265, 4109, 13, 25773, 323, 2187, 701, 24087, 323, 11555, 311, 31889, 11, 1778, 198, 300, 279, 8850 ]
0xBreath/holistic-books
man has become the beneficiary thereof. And none of his work and puny efforts can possibly improve them. ECONOMY—SIMPLICITY. IF there were nothing else to recommend the use of uncooked foods except simplicity and economy, it would be quite enough. There is nothing more complicated—more laborious and more nerve-destroying, than the preparation of the alleged good dinner. There is nothing simpler, easier and more entertaining than the preparation of an uncooked dinner. The largest eating place in New York could be operated from an ice box and a pantry, were they to abolish the cooking habit. This in all probability w ill be done a thousand or more years from now, when people learn the true relations between food, energy and health. In order to gain some conception of the number of articles used in the preparation of a Thanksgiving dinner, the authors took a very careful inventory during its preparation, from the kitchen of a New York hotel to which they had entrée. The total was 192, while dozens of articles counted as one, such as catsups, sauces, mayonnaise dressings, chow- chows. Such things were composed of from two to half a dozen different ingredients, which, if they could have been ascertained, would have run the grand total up, in all probability, to 250 different articles. Is this not a hint from which an y one at all gifted with the power of analysis might draw a few deductions that would explain why it is that nearly all diseases common to civilized man have their origin in the stomach and intestinal organs? All these food items must be carried in stock by somebody. They are first collected from the place of their growth, and brought to storehouses, factories, packing houses, mills, and cookeries, and put into casks, hogsheads, barrels, kegs, jugs, bottles, tin cans, bags, intestines of animals, and every conceivable thing that will hold liquid, powder, grain and piece matter, and are carted to some place of storage, sold by commission men, resold to jobbers, again carried in stock for a time, sold to dealers, where they are again held up and finally sold to the consumer, who has no conception of their age or where they are from, and but little knowledge of their value as food. All this is extremely complicated and expensive. It costs money every time this vast number of things are stopped and stored, and more every time they are moved. Every day added to their age renders them more valueless as food and more expensive as commodities. Not content with this aged, unnatural pickled and preserved condition, the housewife lays hold of them and proceeds to give them their finishing touch by fire. On the checkered highway of man's curious doings, there is indeed nothing stranger than th is. We have in this country hundreds of different articles of food which can be most advantageously used without cooking; yet the cook intrudes his art, bakes, boils, stews, broils and heats these things, until their original elements are wholly changed, until many of them are rendered almost totally valueless. Thus robbed of their elementary and delicious flavors, the cook endeavors to make them appeal to the sense of taste by mixing, jumbling together, spicing, and using decoctions called extracts, the properties of which he knows absolutely nothing, until the original substance Is so disguised that it cannot be recognized in taste, color or flavor. Those who enjoy their eating most and who have reached the highest standard of health and physi cal development, have succeeded in reducing their diet to less than a dozen articles. It seems that everything in connection with the affairs of people unites to recommend this simple method of living. We all know that taste, in the selection of his food, is the supreme power that dominates man, and if he will not pervert it, but will give it a chance, it will lead him into perfect obedience of nature's great dietetic laws. AS A REMEDY. UNDER the auspices of the Technology Club there was a meeting of about 100 of New York's most eminent doctors held a few evenings ago at the offices of Dr.——— to listen to a lecture on the subject of radium, and to consider and demonstrate as far as possible the application of this strange metal to the curing of disease. The opening remarks of the noted physician who was entertaining the assembly were as follows: "There is nothing dawnin g upon the profession with more certainty than that medicine as a curative agent is passing. The most learned men are depending less and less each year upon drugs as a means of combating disease. The best men in the profession are changing both their views and their practice. For many hundred years consumption has been treated with drugs, and nobody has ever been cured by them. To-day we send patients into the open air, where they are kept winter and summer, sleeping in tents, and they get well." We are perfectly willing to accept this statement as true. We are willing also to believe that all disease is a mere result of violating natural law, and that the only true remedy is found in obedience. We believe that foods occupy the same place in building a man that br icks, iron, stone and timber do in building a house. We believe that the kind of material (foods) used will determine to a very large extent the kind of man you will have when you get him done. We believe further that the kind of material with which you keep him repaired and fed will determine wholly whether he will be sick or well. If "more than 90 per cent. of all human ills have their origin in the stomach and intestinal organs, and are caused by incorrect habits of eating and drinking," then those human ills certainly can be cured by removing the cause and selecting such foods as will counteract these abnormal conditions. In combating this tremendous per cent. of disease, we must depend upon foods in their natural or elemental state, because their food and chemical properties have not been changed. We know—or should know what they are. We cannot rely upon foods whose chemical properties and nutritive values have been changed and dissipated by heat. The change that has taken place in them is measured entirely by the amount of heat to which they have been subjected. Certain protoplasmic or plant life is destroyed at 145 degrees F. This destruction continues on up to 212, the boiling point. If the article is re moved then, and put into an oven or a dry heat, it can be carried on up to 300 or 400 degrees, where it becomes a mere bit of ashes or charcoal,— totally destroyed. At every step on the way from 145 degrees to 400 degrees the article becomes of less and less value as food, and less and less reliable as a remedy or an element of construction of tissue and builder of life. We know that indigestion, our national ill, can be cured by the proper selection of uncooked foods. We know that constipation, its consequence, can also be cured by their use. We know that irritation of the mucous membrane or lining of the stomach, that hyperpeptia, or fermentation, and the desire for over-eating can all be cured by the use of uncooked foods. We know that where there is no indigestion, fermentation and constipation in the motive machinery of the body, the blood is pure and rich, and that pure blood builds every organ and inch of the body to its highest capacity. We know that, as compared with cooked foods, it only takes about half the quantity of uncooked food to sustain life. We believe that with these evils eliminated from the human system the ninety per cent. of ills referred to would nearly all disappear. In treating abnormal conditions which we are pleased to call disease, by proper feeding, it requires the knowledge of a food expert—one who is acqua inted with the chemical properties and the process of the conversion of food into energy in the human body. For instance, a great majority of stomach troubles are caused by the eating of too many starchy foods. This causes hyperpeptia, or fermentation. The consumption of too much starch also causes calcareous or limy deposits to collect in the 2,000 miles of tubing in the body called veins, capillaries and arteries. These deposits create stiffness and rigidity in the joints and muscles. This condition is specially manifest in the morning, after the body has lain in a horizontal position for six or eight hours. This condition marks the real difference between youth and age. It can be remedied by the elimination of cereal starch from the dietary and the substitu tion of such foods as will be remedial and counter-active. In foods can be found nearly every chemical and medicinal element that is contained in medicines, and in this form they can be taken as nature intended them, instead of being extracted, concentrated, and rendered artificial and unnatural, as nearly all medicines are. In none of the varied forms of matter on this globe is the warfare of construction and dest r
[ 893, 706, 3719, 720, 1820, 63932, 34366, 13, 1628, 7000, 315, 813, 990, 323, 8474, 88, 720, 6581, 19491, 649, 11000, 7417, 1124, 13, 2355, 36, 5910, 1937, 56, 2345, 47716, 37535, 3414, 13, 33006, 2843, 1070, 1051, 4400, 775, 311, 7079, 279, 1005, 315, 653, 99797, 720, 96420, 3734, 40075, 323, 8752, 11, 433, 1053, 387, 5115, 720, 268, 1409, 13, 2684, 374, 4400, 810, 17395, 2345, 6518, 9511, 1245, 720, 438, 810, 32015, 12, 15886, 287, 11, 1109, 279, 18459, 315, 279, 720, 278, 1978, 291, 1695, 14177, 13, 2684, 374, 4400, 35388, 11, 8831, 323, 720, 6518, 30311, 1109, 279, 18459, 315, 459, 653, 99797, 14177, 13, 720, 791, 7928, 12459, 2035, 304, 1561, 4356, 1436, 387, 24026, 505, 720, 276, 10054, 3830, 323, 264, 69357, 11, 1051, 814, 311, 90376, 279, 17677, 720, 97802, 13, 1115, 304, 682, 19463, 289, 5986, 387, 2884, 264, 16579, 477, 810, 720, 42820, 505, 1457, 11, 994, 1274, 4048, 279, 837, 4398, 1990, 720, 14239, 11, 4907, 323, 2890, 13, 720, 644, 2015, 311, 8895, 1063, 43656, 315, 279, 1396, 315, 720, 16641, 1511, 304, 279, 18459, 315, 264, 37250, 14177, 11, 279, 720, 48105, 3952, 264, 1633, 16994, 15808, 2391, 1202, 18459, 11, 720, 1527, 279, 9979, 315, 264, 1561, 4356, 9689, 311, 902, 814, 1047, 720, 24677, 8047, 13, 578, 2860, 574, 220, 5926, 11, 1418, 22700, 315, 9908, 31094, 439, 720, 606, 11, 1778, 439, 19987, 8772, 11, 91070, 11, 1253, 13767, 1082, 8679, 826, 11, 523, 363, 7058, 331, 4336, 13, 15483, 2574, 1051, 24306, 315, 505, 1403, 311, 4376, 264, 720, 3055, 5797, 2204, 14293, 11, 902, 11, 422, 814, 1436, 617, 1027, 720, 5171, 531, 2692, 11, 1053, 617, 1629, 279, 6800, 2860, 709, 11, 304, 682, 720, 88540, 11, 311, 220, 5154, 2204, 9908, 13, 720, 3957, 420, 539, 264, 13310, 505, 902, 459, 379, 832, 520, 682, 47880, 449, 279, 720, 13477, 315, 6492, 2643, 4128, 264, 2478, 71737, 430, 1053, 720, 95444, 3249, 433, 374, 430, 7154, 682, 19338, 4279, 311, 86079, 720, 1543, 617, 872, 6371, 304, 279, 23152, 323, 63900, 36853, 30, 720, 2460, 1521, 3691, 3673, 2011, 387, 11953, 304, 5708, 555, 720, 15031, 2664, 13, 2435, 527, 1176, 14890, 505, 279, 2035, 315, 872, 720, 74189, 11, 323, 7263, 311, 3637, 37841, 11, 35159, 11, 36813, 720, 37841, 11, 33008, 11, 323, 4394, 4804, 11, 323, 2231, 1139, 272, 4707, 11, 305, 27403, 36910, 11, 720, 2308, 54883, 11, 2004, 5981, 11, 503, 13602, 11, 27474, 11, 25826, 43732, 11, 18381, 11, 39408, 1572, 315, 720, 77896, 11, 323, 1475, 95883, 3245, 430, 690, 3412, 14812, 11, 720, 22491, 1126, 11, 24875, 323, 6710, 5030, 11, 323, 527, 7558, 291, 311, 1063, 2035, 720, 1073, 5942, 11, 6216, 555, 12396, 3026, 11, 594, 820, 311, 2683, 1941, 11, 1578, 720, 7063, 4588, 304, 5708, 369, 264, 892, 11, 6216, 220, 311, 27291, 11, 1405, 814, 527, 720, 33871, 5762, 709, 323, 5616, 6216, 311, 279, 11761, 11, 889, 706, 912, 720, 444, 1010, 315, 872, 4325, 477, 1405, 814, 527, 505, 11, 323, 719, 2697, 720, 90153, 315, 872, 907, 439, 3691, 13, 720, 2460, 420, 374, 9193, 17395, 323, 11646, 13, 1102, 7194, 720, 29359, 1475, 892, 420, 13057, 1396, 315, 2574, 527, 10717, 323, 720, 72349, 11, 323, 810, 1475, 892, 814, 527, 7882, 13, 7357, 1938, 3779, 720, 998, 872, 4325, 45382, 1124, 810, 907, 1752, 439, 3691, 323, 810, 720, 4683, 4114, 439, 51967, 13, 2876, 2262, 449, 420, 20330, 11, 720, 15278, 4688, 3820, 839, 323, 34683, 3044, 11, 279, 3838, 48841, 57622, 720, 6416, 315, 1124, 323, 34555, 311, 3041, 1124, 872, 25270, 5916, 720, 1729, 4027, 13, 720, 1966, 279, 1817, 12616, 27834, 315, 893, 596, 22999, 656, 826, 11, 1070, 720, 285, 13118, 4400, 35058, 1109, 270, 374, 13, 1226, 617, 304, 420, 3224, 720, 71, 46813, 315, 2204, 9908, 315, 3691, 902, 649, 387, 1455, 720, 14625, 25843, 7162, 1511, 2085, 17677, 26, 3686, 279, 4394, 10805, 29246, 720, 26301, 1989, 11, 293, 2094, 11, 90055, 11, 357, 28844, 11, 2967, 8839, 323, 77662, 1521, 2574, 11, 3156, 872, 4113, 5540, 527, 42241, 5614, 11, 3156, 1690, 315, 720, 49818, 527, 23188, 4661, 12756, 907, 1752, 13, 720, 45600, 63354, 315, 872, 36256, 323, 18406, 32523, 11, 720, 1820, 4394, 79645, 311, 1304, 1124, 14638, 311, 279, 5647, 315, 12945, 720, 1729, 27890, 11, 503, 42732, 3871, 11, 993, 10332, 11, 323, 1701, 68652, 5247, 720, 44982, 49062, 11, 279, 6012, 315, 902, 568, 8964, 11112, 720, 42312, 11, 3156, 279, 4113, 20278, 2209, 779, 79187, 430, 433, 720, 34360, 387, 15324, 304, 12945, 11, 1933, 477, 17615, 13, 13266, 889, 720, 268, 4215, 872, 12459, 1455, 323, 889, 617, 8813, 279, 8592, 720, 20885, 315, 2890, 323, 4571, 72, 1652, 4500, 11, 617, 26399, 720, 258, 18189, 872, 10173, 311, 2753, 1109, 264, 21030, 9908, 13, 720, 2181, 5084, 430, 4395, 304, 3717, 449, 279, 22747, 315, 720, 16455, 653, 3695, 311, 7079, 420, 4382, 1749, 315, 5496, 13, 1226, 720, 543, 1440, 430, 12945, 11, 304, 279, 6727, 315, 813, 3691, 11, 374, 279, 44222, 720, 13477, 430, 83978, 893, 11, 323, 422, 568, 690, 539, 824, 1653, 433, 11, 719, 720, 14724, 3041, 433, 264, 6140, 11, 433, 690, 3063, 1461, 1139, 4832, 67194, 315, 720, 67812, 596, 2294, 10173, 5411, 7016, 13, 2355, 1950, 362, 26669, 1507, 56, 13, 33006, 82491, 220, 279, 90196, 1238, 315, 279, 12053, 10349, 1070, 574, 264, 720, 62349, 315, 922, 220, 1041, 315, 1561, 4356, 596, 1455, 84629, 16410, 720, 28708, 264, 2478, 59938, 4227, 520, 279, 19672, 315, 2999, 13, 8713, 2345, 311, 9020, 720, 998, 264, 31678, 389, 279, 3917, 315, 9038, 2411, 11, 323, 311, 2980, 323, 720, 67, 7439, 71015, 439, 3117, 439, 3284, 279, 3851, 315, 420, 15234, 720, 55108, 311, 279, 97330, 315, 8624, 13, 578, 8736, 24208, 315, 279, 720, 1962, 291, 28378, 889, 574, 30311, 279, 14956, 1051, 439, 720, 19070, 82, 25, 720, 25938, 374, 4400, 39493, 258, 342, 5304, 279, 4913, 449, 720, 6518, 44743, 1109, 430, 16088, 439, 264, 2917, 1413, 8479, 374, 720, 6519, 287, 13, 578, 1455, 9687, 3026, 527, 11911, 2753, 323, 2753, 720, 9739, 1060, 5304, 11217, 439, 264, 3445, 315, 96178, 8624, 13, 578, 720, 16241, 3026, 304, 279, 4913, 527, 10223, 2225, 872, 6325, 323, 720, 50828, 6725, 13, 1789, 1690, 7895, 1667, 15652, 706, 1027, 720, 83, 2920, 449, 11217, 11, 323, 19093, 706, 3596, 1027, 64688, 555, 1124, 13, 720, 1271, 11477, 584, 3708, 6978, 1139, 279, 1825, 3805, 11, 1405, 814, 527, 8774, 720, 84028, 323, 7474, 11, 21811, 304, 64470, 11, 323, 814, 636, 1664, 1210, 720, 1687, 527, 14268, 10032, 311, 4287, 420, 5224, 439, 837, 13, 720, 1687, 527, 10032, 1101, 311, 4510, 430, 682, 8624, 374, 264, 17983, 1121, 720, 1073, 45462, 5933, 2383, 11, 323, 430, 279, 1193, 837, 40239, 374, 720, 15456, 304, 67194, 13, 1226, 4510, 430, 15657, 48678, 279, 1890, 720, 2050, 304, 4857, 264, 893, 430, 1437, 220, 5908, 11, 11245, 11, 9998, 323, 45888, 656, 720, 258, 4857, 264, 3838, 13, 1226, 4510, 430, 279, 3169, 315, 3769, 720, 82111, 82, 8, 1511, 690, 8417, 311, 264, 1633, 3544, 13112, 279, 3169, 315, 720, 1543, 499, 690, 617, 994, 499, 636, 1461, 2884, 13, 720, 1687, 4510, 4726, 430, 279, 3169, 315, 3769, 449, 902, 720, 9514, 2567, 1461, 52834, 323, 23114, 690, 8417, 42241, 3508, 720, 383, 690, 387, 14363, 477, 1664, 13, 1442, 330, 6518, 1109, 220, 1954, 824, 2960, 13, 315, 682, 720, 26380, 220, 3385, 617, 872, 6371, 304, 279, 23152, 323, 63900, 720, 1813, 598, 11, 323, 527, 9057, 555, 15465, 26870, 315, 12459, 323, 720, 3696, 16113, 1359, 1243, 1884, 3823, 220, 3385, 7995, 649, 387, 64688, 555, 720, 1864, 9308, 279, 5353, 323, 27397, 1778, 15657, 439, 690, 720, 8456, 533, 1521, 35663, 4787, 13, 5996, 644, 96178, 420, 28040, 824, 2960, 13, 315, 8624, 11, 584, 720, 25849, 6904, 5304, 15657, 304, 872, 5933, 477, 62235, 1614, 11, 720, 28753, 872, 3691, 323, 11742, 6012, 617, 539, 1027, 720, 17805, 13, 1226, 1440, 51749, 1288, 1440, 1148, 814, 527, 13, 1226, 720, 34360, 17631, 5304, 15657, 6832, 11742, 6012, 323, 720, 24217, 1018, 535, 2819, 617, 1027, 5614, 323, 14091, 63332, 555, 8798, 13, 720, 791, 2349, 430, 706, 4529, 2035, 304, 1124, 374, 17303, 720, 306, 556, 398, 555, 279, 3392, 315, 8798, 311, 902, 814, 617, 1027, 720, 11760, 291, 13, 35211, 1760, 56178, 10753, 292, 477, 6136, 2324, 374, 14763, 520, 720, 9591, 12628, 435, 13, 1115, 19814, 9731, 389, 709, 311, 220, 11227, 11, 279, 720, 754, 8138, 1486, 13, 1442, 279, 4652, 374, 312, 7882, 1243, 11, 323, 2231, 1139, 459, 720, 16651, 477, 264, 9235, 8798, 11, 433, 649, 387, 11953, 389, 709, 311, 220, 3101, 477, 220, 3443, 720, 70849, 11, 1405, 433, 9221, 264, 17983, 2766, 315, 67101, 477, 61203, 96197, 198, 28879, 750, 14763, 13, 720, 1688, 1475, 3094, 389, 279, 1648, 505, 220, 9591, 12628, 311, 220, 3443, 720, 70849, 279, 4652, 9221, 315, 2753, 323, 2753, 907, 439, 3691, 11, 323, 720, 1752, 323, 2753, 15062, 439, 264, 40239, 477, 459, 2449, 315, 720, 48297, 315, 20438, 323, 7514, 315, 2324, 13, 1226, 1440, 430, 1280, 15505, 290, 11, 1057, 5426, 5986, 11, 649, 387, 64688, 720, 1729, 279, 6300, 6727, 315, 653, 99797, 15657, 13, 1226, 1440, 430, 720, 1040, 49686, 11, 1202, 29774, 11, 649, 1101, 387, 64688, 555, 872, 1005, 13, 720, 1687, 1440, 430, 66510, 315, 279, 65104, 788, 39654, 477, 36471, 315, 720, 1820, 23152, 11, 430, 17508, 375, 418, 689, 11, 477, 220, 74454, 11, 323, 279, 12876, 720, 2000, 927, 5773, 1113, 649, 682, 387, 64688, 555, 279, 1005, 315, 653, 99797, 15657, 13, 720, 1687, 1440, 430, 1405, 1070, 374, 912, 1280, 15505, 290, 11, 74454, 323, 720, 1040, 49686, 304, 279, 47094, 26953, 315, 279, 2547, 11, 279, 6680, 374, 720, 52833, 323, 9257, 11, 323, 430, 10748, 6680, 22890, 1475, 2942, 323, 17560, 720, 1073, 279, 2547, 311, 1202, 8592, 8824, 13, 720, 1687, 1440, 430, 11, 439, 7863, 449, 30205, 15657, 11, 433, 1193, 720, 79079, 922, 4376, 279, 12472, 315, 653, 99797, 3691, 311, 14201, 2324, 13, 720, 1687, 4510, 430, 449, 1521, 86907, 34373, 505, 279, 720, 26380, 1887, 279, 78976, 824, 2960, 13, 315, 220, 3385, 14183, 311, 1053, 720, 77, 22928, 682, 32153, 13, 720, 644, 27723, 35663, 4787, 902, 584, 527, 18949, 311, 720, 6797, 8624, 11, 555, 6300, 26040, 11, 433, 7612, 279, 6677, 315, 264, 720, 14239, 6335, 87671, 889, 374, 19830, 64, 528, 291, 449, 279, 11742, 720, 13495, 323, 279, 1920, 315, 279, 14747, 315, 3691, 1139, 720, 17947, 304, 279, 3823, 2547, 13, 720, 2520, 2937, 11, 264, 2294, 8857, 315, 23152, 35665, 527, 720, 936, 2656, 555, 279, 12459, 315, 2288, 1690, 357, 15630, 15657, 13, 1115, 11384, 720, 69292, 375, 418, 689, 11, 477, 74454, 13, 578, 15652, 315, 2288, 1790, 720, 267, 1132, 1101, 11384, 10241, 548, 788, 477, 4671, 88, 34751, 311, 6667, 304, 279, 720, 17, 11, 931, 8931, 315, 75002, 304, 279, 2547, 2663, 60764, 11, 2107, 484, 5548, 323, 720, 5408, 552, 13, 4314, 34751, 1893, 70334, 323, 13552, 19025, 304, 279, 720, 73, 14737, 323, 24569, 13, 720, 2028, 3044, 374, 35426, 14794, 304, 279, 6693, 11, 1306, 720, 1820, 2547, 706, 51476, 304, 264, 16600, 2361, 369, 4848, 477, 8223, 720, 31482, 13, 1115, 3044, 15785, 279, 1972, 6811, 1990, 12822, 720, 438, 4325, 13, 1102, 649, 387, 34630, 1142, 555, 279, 44032, 315, 62233, 70181, 720, 1527, 279, 34625, 323, 279, 32434, 84, 73352, 315, 1778, 15657, 439, 690, 387, 720, 1864, 291, 532, 323, 5663, 32344, 13, 720, 644, 15657, 649, 387, 1766, 7154, 1475, 11742, 323, 720, 2106, 292, 992, 2449, 430, 374, 13282, 304, 39653, 11, 323, 304, 420, 720, 630, 814, 649, 387, 4529, 439, 7138, 10825, 1124, 11, 4619, 315, 720, 35214, 28532, 11, 38626, 11, 323, 23188, 21075, 323, 720, 15278, 4688, 11, 439, 7154, 682, 39653, 527, 13, 720, 644, 7000, 315, 279, 28830, 7739, 315, 5030, 389, 420, 24867, 374, 279, 720, 11710, 23920, 315, 8246, 323, 3281, 436 ]
0xBreath/holistic-books
. I’m not trying to make you crazy, I’m trying to make you happy. So, even though you’ve heard some of this before, this time I’d like you to really think about it. No, really. I mean, please, just close your eyes and think about this. Because what I’ve said here is one of the most important (and revolutionary) things anyone will ever say to you. And even if you have heard it before, you may not have deeply explored the possibility of its being true. So, will you do that now? I mean, is it possible that this is something you simply do not completely understand... the understanding of which could change everything? This time I’m asking you to stop reading. Just for a second. Just for a brief pause. Just time enough to decide how you want to feel about this. Did you catch the irony there? I want you to choose how you wish to feel about the idea that you can choose how you wish to feel. So please go ahead. Close the book and think about it. Ask yourself some que stions. What would my life be like if I thought I could actually select my emotions, rather than be subjected to them? Is it possible to change an emotion after I’m already having it? Not ignore it or operate “on top of it,” but actually, really and truly change the emotion I’m having. Can I do that? At will? Please ponder that question —and what it would mean if the answer were yes —and take some... Breathing Space Breathe into what you’ve just read, then... decide now if you want to go on, or rest wit h it for a while and meet with me here later... or not at all. If you’re ready to go on, drop down to... THE SPONSOR OF ALL EMOTIONS Okay, so we’re talking here about emotions. Well, I’m talking about emotions. Meanwhile, you’re having them. All that you’re trying to do is deal with the changes that are occurring in your life, with the very threatening calamities that may be happening, while I’m launching into a small lecture on human psychology and what causes emotions and how we can change them. But you know what? I wouldn’t dare do such a thing, I wouldn’t even bring any of this up, if I didn’t think it was going to help you. Right here, right now. No matter what’s going on. Yes, even if you’ve lost your job. Even if you’ve lost your house. Even if you feel you are in danger of losing everything. As I’ve said, I think I know a little about what you’re going through. I’ve been there. And it took me years to figure out what I’m going to be telling you now. I just didn’t get it. I just didn’t understand. Until I did. (With a little help from a Friend....) So now, let me double back just a bit and reinforce the point I just made about emotions. And I promise you, you’ll see how this all ties together and how this relates directly to you. .. as well a s how it can make a real difference in this moment of your life. I mean, that’s the idea here, yes? That’s the point of us having this conversation, right? Otherwise I’m just flapping my gums here. So... let’s dive back in. Let’s look at that one specif ic emotion of fear (I use this one because it is so powerful) and see how we can change that. Fear is an emotion that you have that is sponsored by a thought that you have, which produces an experience that you have of an event that has occurred in your li fe. Most people think that fear is produced directly by the event. That is, most people think that the sequence is: event=experience. This is not true. The proof that it’s not true is that emotion does not arise uniformly. The same things do not produce fe ar, for example, in two different people. They sometimes do, but they just as often do not. A roaring lion can produce fear in one person and not in another (say, a lion tamer). Heights can produce fear in one person and not in another (say, the star of a high -wire act). Giving a speech can produce fear in one person (it has been listed in survey after survey as among the single biggest fears faced by many human beings) and not in another (say, a lecturer or an entertainer). So we can agree that no two peop le can be guaranteed to have the same experience (fear) when faced with the same exterior event, yes? Heck, the same event does not even produce the identical experience in the same person every time. So what does produce the fear? If it is not the roaring lion or the height of the ladder or the audience waiting to hear you, then what is it? It’s something inside you. It’s your ideas and your memories and your projections and your concepts and your apprehensions and your understandings and your desires and your conditioning and more. And all of these things fall into one broad category. Thoughts. It is your thoughts that sponsor your fears, and nothing else. Thoughts sponsor all emotions. Now this is both a revolutionary and controversial statement that I am making here, because standard brain science says that is it just the other way around. Neuroscientists tell us that emotion comes before thought, as a product of the brain’s limbic syst em, and that “thought” occurs in the higher regions of the brain, which analyze the emotions we are having. I am saying here that the opposite is true. I am saying that the limbic system produces what I call a Truth (an overall mental concept of something), from which emerges a Thought, which generates an Emotion. Every time you display any kind of emotion you can say, “And now, a word from our sponsor!” Like the sponsors on television, thoughts stop the show. That fact that thoughts sponsor emotions is the greatest news you could ever hear. If we accept the view of scientists that it is the other way around, we accept as a matter of fact that each of us has a built in handicap: an utter inability to decide objectively which emotions we are go ing to feel. We accept that we are subject to our emotional reactions and then have to overcome them with our thoughts if we want them to be different. My thesis here is that it is not a question of overcoming our emotions to get them to be what we want th em to be, but of creating them that way from the start. This idea may be new to medical science, but it is not new to spirituality, which insists that we are more than biological machines, and that the Mind is not the same as the brain, but is far more com plex and sophisticated —and that the Soul is even bigger and more sophisticated than the Mind! In this moment, as you face all the changes that are occurring in your life, this is the best news you could ever receive. Why? Because it gives you tools you nev er thought you had. Because it reverses the standard medical model, putting thoughts before emotions, rather than after them —meaning that we are in charge here, since thoughts are changeable. Just a while ago we talked about changing your emotions. I said that changing emotions was the way to change Change Itself. I’m now going to tell you how you can change emotions. Change your thoughts. Whereas the Heart is used to being the only place where Love is found a Mind full of joy draws the Heart like a moth, into a surprisingly different flame. A flame where nothing burns — no wings are forfeited. As if God stretches the length of The Home to abide in every room at once, simply because We can * —‘A Mind Full of Joy’ © 2007 Em Claire 7. THE THIRD CHANGE YOU MAY N OT BE able to change the fact that things are changing, but you can change your thought about the things that are changing. Not only is this possible, it is next on the list of Nine Changes That Can Change Everything. CHANGE #3: Change your choice of thoug hts Thought is an idea that you are making up. The change that is occurring in your life is not something you are making up, but your thought about it is. That thought often bears no relationship to ultimate reality, it often bears no relationship to observed reality, yet it often does bear a relatio nship to distorted reality. In fact, it often creates it. Oh-oh, this is Something Big here. I’m thinking we should not just fly right past what was just said. Let’s look at it more closely. What I said was... “Your thought is something you are making u p. It often bears no relationship to ultimate reality, it often bears no relationship to observed reality, yet it often does bear a relationship to distorted reality. In fact, it often creates it.” Now, I just introduced a whole new idea there. Did you cat ch me at it? I just referred to
[ 13, 358, 4344, 539, 4560, 311, 720, 7072, 499, 14599, 11, 358, 4344, 4560, 311, 1304, 499, 6380, 13, 2355, 4516, 11, 1524, 3582, 499, 4070, 6755, 1063, 315, 420, 1603, 11, 420, 892, 358, 7070, 1093, 499, 311, 2216, 1781, 720, 9274, 433, 13, 2360, 11, 2216, 13, 358, 3152, 11, 4587, 11, 1120, 3345, 701, 220, 6548, 323, 1781, 922, 420, 13, 9393, 1148, 720, 40, 4070, 1071, 1618, 374, 832, 315, 279, 1455, 3062, 320, 438, 30191, 8, 2574, 5606, 690, 3596, 2019, 311, 720, 9514, 13, 1628, 1524, 422, 499, 617, 220, 6755, 433, 1603, 11, 499, 1253, 539, 617, 17693, 36131, 279, 13336, 720, 1073, 1202, 1694, 837, 13, 2100, 11, 690, 499, 656, 430, 1457, 30, 2355, 40, 3152, 11, 374, 433, 3284, 430, 420, 374, 2555, 499, 5042, 656, 539, 6724, 3619, 662, 662, 662, 720, 1820, 8830, 315, 902, 1436, 2349, 4395, 30, 2355, 2028, 892, 358, 4344, 10371, 220, 499, 311, 3009, 5403, 13, 4702, 369, 264, 2132, 13, 4702, 369, 264, 10015, 18579, 13, 4702, 720, 1712, 3403, 311, 10491, 1268, 499, 1390, 311, 2733, 922, 420, 13, 2355, 7131, 499, 2339, 279, 51705, 1070, 30, 358, 1390, 499, 311, 5268, 220, 1268, 499, 6562, 311, 2733, 922, 279, 4623, 720, 9210, 499, 649, 5268, 1268, 499, 6562, 311, 2733, 13, 2355, 4516, 4587, 733, 8469, 13, 13330, 279, 2363, 323, 1781, 922, 433, 13, 21069, 6261, 1063, 1744, 357, 919, 13, 3639, 720, 41450, 856, 2324, 387, 1093, 422, 358, 3463, 358, 1436, 3604, 3373, 220, 856, 21958, 11, 4856, 1109, 387, 720, 11760, 291, 311, 1124, 30, 2209, 433, 3284, 311, 2349, 459, 20356, 1306, 358, 4344, 2736, 3515, 433, 30, 2876, 10240, 433, 477, 14816, 1054, 263, 1948, 315, 433, 2476, 719, 3604, 11, 2216, 323, 9615, 2349, 279, 20356, 358, 4344, 720, 69666, 662, 3053, 358, 656, 430, 30, 2468, 690, 30, 2355, 5618, 48883, 430, 3488, 2001, 438, 1148, 433, 1053, 3152, 422, 279, 4320, 1051, 10035, 2001, 438, 1935, 720, 15031, 662, 662, 662, 2355, 51329, 44661, 11746, 2355, 33, 1244, 383, 1139, 1148, 499, 4070, 1120, 1373, 11, 1243, 662, 662, 662, 10491, 1457, 422, 499, 1390, 311, 733, 389, 11, 477, 2800, 38467, 305, 720, 275, 369, 264, 1418, 323, 3449, 449, 757, 1618, 3010, 662, 662, 662, 477, 539, 520, 682, 13, 2355, 2746, 499, 3207, 5644, 311, 733, 389, 11, 6068, 1523, 311, 662, 662, 662, 2355, 17673, 9440, 30626, 878, 3083, 13398, 17329, 1831, 43486, 2355, 33413, 11, 779, 584, 3207, 7556, 1618, 922, 21958, 13, 8489, 11, 358, 4344, 7556, 922, 21958, 13, 720, 26054, 11, 499, 3207, 3515, 1124, 13, 2052, 430, 220, 499, 3207, 4560, 311, 656, 374, 3568, 449, 279, 4442, 430, 527, 720, 511, 46839, 304, 701, 2324, 11, 449, 279, 1633, 27903, 80933, 1385, 430, 1253, 387, 12765, 11, 1418, 720, 40, 4344, 28818, 1139, 264, 2678, 31678, 389, 3823, 31018, 323, 1148, 11384, 21958, 323, 720, 5269, 584, 649, 2349, 1124, 13, 2355, 4071, 499, 1440, 1148, 30, 358, 8434, 1431, 33304, 656, 1778, 264, 3245, 11, 358, 8434, 1431, 1524, 4546, 904, 315, 420, 720, 455, 11, 422, 358, 3287, 1431, 1781, 433, 574, 2133, 311, 1520, 499, 13, 10291, 1618, 11, 1314, 1457, 662, 2360, 5030, 1148, 753, 220, 2133, 720, 263, 13, 7566, 11, 1524, 422, 499, 4070, 5675, 701, 2683, 13, 7570, 422, 499, 4070, 5675, 701, 3838, 13, 7570, 422, 499, 2733, 499, 527, 720, 258, 8137, 315, 13490, 4395, 13, 2355, 2170, 358, 4070, 1071, 11, 358, 1781, 358, 1440, 264, 2697, 922, 1148, 499, 3207, 2133, 1555, 13, 358, 4070, 1027, 1070, 13, 1628, 720, 275, 3952, 757, 1667, 311, 7216, 704, 1148, 358, 4344, 2133, 311, 387, 11890, 499, 1457, 13, 358, 1120, 3287, 1431, 636, 433, 13, 358, 1120, 720, 97849, 1431, 3619, 662, 30070, 358, 1550, 13, 320, 2409, 264, 2697, 1520, 505, 264, 11848, 13, 662, 662, 662, 8, 2355, 4516, 1457, 11, 1095, 757, 2033, 1203, 1120, 264, 2766, 323, 55414, 279, 1486, 358, 1120, 1903, 922, 21958, 13, 720, 3112, 358, 11471, 499, 11, 499, 4805, 1518, 1268, 420, 682, 20405, 3871, 323, 1268, 420, 36716, 6089, 311, 499, 662, 720, 13, 662, 439, 1664, 264, 274, 1268, 433, 649, 1304, 264, 1972, 6811, 304, 420, 4545, 315, 701, 2324, 13, 358, 3152, 11, 430, 753, 279, 720, 42877, 1618, 11, 10035, 30, 3011, 753, 279, 1486, 315, 603, 3515, 420, 10652, 11, 1314, 30, 18715, 358, 4344, 1120, 720, 1517, 3713, 856, 98754, 1618, 13, 2355, 4516, 662, 662, 662, 1095, 753, 30963, 1203, 304, 13, 6914, 753, 1427, 520, 430, 832, 1424, 333, 18385, 20356, 315, 8850, 320, 40, 1005, 420, 832, 720, 28753, 433, 374, 779, 8147, 8, 323, 1518, 1268, 584, 649, 2349, 430, 13, 2355, 91471, 374, 459, 20356, 430, 499, 617, 430, 374, 30638, 555, 264, 3463, 430, 499, 617, 11, 902, 720, 8723, 1634, 459, 3217, 430, 499, 617, 315, 459, 1567, 430, 706, 10222, 304, 701, 908, 1172, 13, 7648, 720, 16455, 1781, 430, 8850, 374, 9124, 6089, 555, 279, 1567, 662, 3011, 374, 11, 1455, 1274, 1781, 430, 279, 720, 15880, 374, 25, 1567, 28, 50659, 13, 1115, 374, 539, 837, 13, 578, 11311, 430, 433, 753, 539, 837, 374, 430, 20356, 720, 28156, 539, 31889, 78909, 13, 578, 1890, 2574, 656, 539, 8356, 1172, 802, 11, 369, 3187, 11, 304, 1403, 720, 64750, 1274, 13, 2435, 7170, 656, 11, 719, 814, 1120, 439, 3629, 656, 539, 13, 2355, 32, 93856, 40132, 649, 8356, 8850, 304, 832, 1732, 323, 539, 304, 2500, 320, 37890, 11, 264, 40132, 259, 15589, 570, 720, 1548, 2866, 649, 8356, 8850, 304, 832, 1732, 323, 539, 304, 2500, 320, 37890, 11, 279, 6917, 315, 264, 1579, 482, 36631, 1180, 570, 720, 97602, 264, 8982, 649, 8356, 8850, 304, 832, 1732, 320, 275, 706, 1027, 10212, 304, 10795, 1306, 10795, 439, 4315, 279, 3254, 8706, 24087, 17011, 555, 1690, 3823, 23837, 8, 323, 539, 304, 2500, 320, 37890, 11, 264, 720, 772, 7889, 477, 459, 23737, 1780, 570, 2355, 4516, 584, 649, 7655, 430, 912, 1403, 1069, 454, 514, 649, 387, 19883, 311, 617, 279, 1890, 3217, 720, 968, 686, 8, 994, 17011, 449, 279, 1890, 28362, 1567, 11, 10035, 30, 73817, 11, 279, 1890, 1567, 1587, 539, 1524, 720, 98374, 279, 20086, 3217, 304, 279, 1890, 220, 1732, 1475, 892, 13, 2355, 4516, 1148, 1587, 220, 8356, 279, 8850, 30, 1442, 433, 374, 539, 279, 93856, 220, 40132, 477, 279, 2673, 315, 279, 36865, 477, 720, 1820, 10877, 8748, 311, 6865, 499, 11, 1243, 1148, 374, 433, 30, 2355, 2181, 753, 2555, 4871, 220, 499, 13, 1102, 753, 701, 6848, 323, 701, 19459, 323, 701, 41579, 323, 720, 22479, 19476, 323, 701, 47291, 4769, 323, 701, 3619, 826, 323, 701, 32097, 323, 701, 720, 9233, 287, 323, 810, 13, 1628, 682, 315, 1521, 2574, 4498, 1139, 832, 7353, 5699, 13, 2355, 85269, 82, 13, 2355, 2181, 374, 701, 11555, 220, 430, 25438, 701, 24087, 11, 323, 4400, 775, 13, 61399, 25438, 682, 720, 336, 41356, 13, 2355, 7184, 420, 374, 2225, 264, 30191, 323, 20733, 5224, 430, 358, 1097, 3339, 1618, 11, 720, 28753, 5410, 8271, 8198, 2795, 430, 374, 433, 1120, 279, 1023, 1648, 2212, 13, 32359, 56447, 1705, 720, 73457, 603, 430, 20356, 4131, 1603, 220, 3463, 11, 439, 264, 2027, 315, 279, 8271, 753, 48694, 292, 42345, 991, 11, 323, 720, 9210, 1054, 61665, 863, 13980, 304, 279, 5190, 13918, 315, 279, 8271, 11, 902, 24564, 279, 21958, 584, 527, 720, 69666, 13, 358, 1097, 5605, 1618, 430, 279, 14329, 374, 837, 13, 358, 1097, 5605, 430, 279, 48694, 292, 1887, 720, 8723, 1634, 1148, 358, 1650, 264, 30198, 320, 276, 8244, 10723, 7434, 220, 315, 2555, 8, 1174, 505, 902, 59696, 720, 64, 36287, 11, 902, 27983, 459, 5867, 6082, 13, 2355, 11769, 892, 499, 3113, 904, 3169, 315, 20356, 499, 649, 2019, 11, 1054, 3112, 1457, 11, 264, 3492, 505, 1057, 720, 96911, 18319, 9086, 279, 39701, 389, 12707, 11, 11555, 3009, 279, 1501, 13, 2355, 4897, 2144, 430, 11555, 25438, 21958, 374, 279, 12474, 3754, 499, 1436, 3596, 6865, 13, 2355, 2746, 584, 4287, 279, 1684, 315, 14248, 430, 433, 374, 279, 1023, 1648, 2212, 11, 584, 4287, 439, 264, 5030, 720, 1073, 2144, 430, 1855, 315, 603, 706, 264, 5918, 304, 75379, 25, 459, 22256, 38550, 311, 10491, 85121, 902, 720, 336, 41356, 584, 527, 733, 6892, 311, 2733, 13, 1226, 4287, 430, 584, 527, 3917, 311, 1057, 14604, 25481, 220, 323, 720, 3473, 617, 311, 23075, 1124, 220, 449, 1057, 11555, 422, 584, 1390, 1124, 311, 387, 2204, 13, 2355, 5159, 17850, 1618, 374, 430, 433, 374, 539, 264, 3488, 315, 74017, 1057, 21958, 311, 636, 1124, 311, 387, 720, 12840, 584, 1390, 270, 991, 311, 387, 11, 719, 315, 6968, 1124, 430, 1648, 505, 279, 1212, 662, 1115, 4623, 1253, 387, 720, 943, 311, 6593, 8198, 11, 719, 433, 374, 539, 502, 311, 75456, 11, 902, 43446, 430, 584, 527, 810, 1109, 720, 8385, 5848, 12933, 11, 323, 430, 279, 23754, 374, 539, 279, 1890, 439, 279, 8271, 11, 719, 374, 3117, 810, 470, 281, 2635, 720, 438, 27877, 2001, 438, 430, 279, 30242, 374, 1524, 11493, 220, 323, 810, 27877, 1109, 279, 23754, 0, 2355, 644, 420, 4545, 11, 439, 499, 3663, 682, 279, 4442, 430, 527, 31965, 304, 701, 2324, 11, 420, 374, 279, 1888, 720, 10189, 499, 1436, 3596, 5371, 13, 8595, 30, 9393, 433, 6835, 499, 7526, 499, 102306, 2781, 3463, 499, 1047, 13, 720, 18433, 433, 17888, 288, 279, 5410, 6593, 1646, 11, 10917, 11555, 1603, 220, 21958, 11, 4856, 720, 54895, 1306, 1124, 2001, 57865, 430, 584, 527, 304, 6900, 1618, 11, 2533, 11555, 527, 2349, 481, 13, 2355, 10156, 264, 1418, 4227, 584, 15243, 922, 10223, 701, 21958, 13, 358, 1071, 430, 10223, 21958, 720, 16514, 279, 1648, 311, 2349, 10604, 1102, 726, 13, 358, 4344, 1457, 2133, 311, 3371, 499, 1268, 220, 499, 649, 2349, 720, 336, 41356, 13, 2355, 4164, 701, 11555, 13, 220, 61695, 279, 18449, 374, 1511, 311, 1694, 2355, 1820, 1193, 2035, 1405, 10919, 374, 1766, 2355, 64, 23754, 2539, 315, 16267, 2355, 7788, 82, 279, 18449, 1093, 264, 98178, 11, 2355, 18614, 264, 29392, 2204, 220, 35678, 13, 2355, 32, 35678, 1405, 4400, 44154, 2001, 720, 2201, 27296, 527, 50032, 1639, 13, 2355, 2170, 422, 4359, 50699, 279, 3160, 315, 578, 5492, 2355, 998, 58299, 304, 1475, 3130, 520, 3131, 11, 2355, 15124, 2603, 2355, 28753, 2355, 1687, 720, 4919, 720, 9, 720, 2345, 14336, 32, 23754, 8797, 315, 28237, 529, 220, 7388, 220, 1049, 22, 5867, 43675, 220, 220, 22, 13, 720, 17673, 69257, 44139, 2355, 57489, 40330, 452, 8775, 7354, 220, 3025, 311, 2349, 279, 2144, 430, 2574, 527, 10223, 11, 719, 499, 649, 2349, 701, 720, 61665, 220, 922, 279, 2574, 430, 527, 10223, 13, 2355, 2688, 1193, 374, 420, 3284, 11, 433, 374, 1828, 389, 279, 1160, 315, 38166, 29240, 3011, 3053, 10604, 720, 36064, 13, 2355, 41973, 674, 18, 25, 2355, 4164, 701, 5873, 315, 34223, 70, 305, 2641, 720, 85269, 374, 459, 4623, 430, 499, 527, 3339, 709, 662, 578, 2349, 430, 374, 31965, 304, 701, 2324, 374, 539, 720, 34431, 499, 527, 3339, 709, 11, 719, 701, 3463, 922, 433, 374, 13, 3011, 3463, 3629, 30824, 912, 720, 37195, 311, 17139, 8903, 11, 433, 3629, 30824, 912, 5133, 311, 13468, 8903, 11, 3686, 433, 720, 61917, 1587, 11984, 264, 1375, 6400, 308, 5383, 311, 62236, 8903, 13, 763, 2144, 11, 433, 3629, 11705, 220, 433, 13, 720, 12174, 12, 2319, 11, 420, 374, 25681, 6295, 1618, 13, 358, 4344, 7422, 584, 1288, 539, 1120, 11722, 1314, 3347, 1148, 574, 720, 4345, 1071, 13, 6914, 753, 1427, 520, 433, 810, 15499, 13, 3639, 358, 1071, 574, 662, 662, 662, 2355, 2118, 7927, 3463, 374, 2555, 499, 527, 3339, 577, 281, 13, 1102, 3629, 30824, 912, 5133, 311, 17139, 720, 265, 2786, 11, 433, 3629, 30824, 912, 5133, 311, 13468, 8903, 11, 3686, 433, 3629, 1587, 11984, 264, 720, 37195, 311, 62236, 8903, 13, 763, 2144, 11, 433, 3629, 11705, 220, 433, 2029, 720, 7184, 11, 358, 1120, 11784, 264, 4459, 502, 4623, 1070, 13, 14910, 499, 8415, 523, 757, 520, 433, 30, 358, 1120, 14183, 311 ]
0xBreath/holistic-books
to have to die. And we won’t be dying of “old age,” that’s for sure. Because we’ll be able to replace all of our old parts, our “aging parts,” with brand new parts. And so “old age” will no longer be a reason to expire. We still might have accidents—that’ s of course true—and we may be so injured that we can’t put Humpty Dumpty back together again. But“old age” may be a virtually unheard of reason for us to leave physical form. That is going to create a tremendous conundrum for people. Because then they’ll have to really start asking themselves the kinds of questions we ask ourselves now, when we get as old as I am. Then the human species will really have to start to ask itself, you know, “What is the point? What am I doing here for 120, 150, 170 years, or more? “What actually is the point of this physical platform that I have found myself on?” And surely it will be very clear when we start living to be 120, 140, or 150 years old that it obviously can’t be about get the guy, get the girl, get the car, get the job... There clearly is something else going on. And that will become patently obvious to us, as we begin living so long that we become bored with nothing but the physical accouterments of our life. So the extended lifespan of humanity is going to create a real conundrum for human beings. And the question is: Will it work against the Agenda of the Soul, or in favor of the Agenda of the Soul? And that question will be placed before the house, and answered by people who are paying particular and specific attention to not only the health of the body, but to the existence of the human soul and its purpose and function in the overall process that we call human life. DR. COOPER: Yes! It certainly will bring up that important question: are we here to serve the Agenda of the Body (to gather the physicalaccouterments of life, as you put it), or are we in fact here to serve the Agenda of the Soul? And it would certainly change our experience dramatically, in particular our spiritual experience, if we were to live for 150 years! I notice coming to your retreats that often people will hit that point of spiritual inquiry around mid-life with our current lifespan. Because, as you said, the whole “to-do list’ of get the guy, get the girl, get the car, get the house etc., is no longer a novelty. And people come to see, maybe around forty, fifty, or sixty: Okay, I’ve done that, and that was wonderful... but maybe now there’ s something more! So perhaps that would all be even more magnified with a lifespan two times as long! NEALE: Imagine that! Imagin e if you’d gotten done all the things you thought you were supposed to get done by the age of 45, or 50, or even 60. Now what are you going to do for the next hundred years?!! DR. COOPER: (Laughs.) That’ s a really good question. NEALE: That’ s the question that medical science had better be prepared to answer. Because docto rs are going to become more than just healers and “life extenders”—they’re going to become life explainers. People are going to be going to doctors saying, “Whoa,” you know, “What do I do now for the next hundred years? I already got the guy, got the girl, got the car, got the job... now what am I going to do?”And we’re going to find that the doctors who call themselves psychiatrists, who are, of course, medical doctors, are going to have enormously different kinds of work to do. In fact, there will be a brand new field, as physicians in other fields begin to extend the lifespan of human beings. Doctors of the mind—psychiatrists (I promise you, and I predict that this will happen in your lifetime)—will develop a new occupation, a new branch and a new field of Psychiatry. It’ll be called. .. I don’t know what they’ll call it ultimately, but my description of it would be Spiritual Psychiatry. My understanding is that the word “psychology” is a deriv ative of two words, “psycho” and “logy,” which emerge from the Greek word for soul, and the Gree k word for logic, or wisdom. So “psycho- logy” is the wisdom or the logic of the soul. They took the soul out of “psycho-logy” when it became “psychology” (the profession), and these days psychologists and psychiatrists are not allowed to bring into their treatment the word God, unless it is at the behest and at the specific request of the patient. But even then, they can only ask the patient what they think about that. It is considered out of bounds for psychiatrists to propose or suggest or explore ideas about God that the psychiatrist puts into the space. They can only discuss what the patient brings into the conversation. But there will be Spiritual Therapists as a branch of Psychiatry and Psychology in the next fifty years who will be just as much a specialist in that area as eye, ear, nose, and throat specialists, and other physician s who specialize in certain areas of the physical body, are today. The metaphysical discipline will join the physical disciplines as part of the overall medical profession. DR. COOPER: That’ s such a beautiful way of putting it—the metaphysical will join the physical. This whole concept makes me think back to a doctor I worked with who was a Pediatric Oncologist, meaning that she worked in the field of childhood cancer. Many people would consider this to be a challenging if not a deeply saddening field to work in, given that many of these children never make it into their adult years. But what this doctor offered these children is a gift I’ll never forget. She was certainly a “Doctor of the Soul,” if I could put it that way... someone who merged the physical with the metaphysical, to use your words. As we’ve talked about before, in the chapter on medical miracles, heali ng the physical and the metaphysical are two sides of the same coin. It is in the Intersection of the Physical and the Spiritual—where God and Medicine meet—where true healing takes place. For in situations as dramatic and life-changing as childhood cancer, to heal the body without taking into account the spiritual journey of the individual would be to consider just one small piece of the pie. And this is what separated this particular physician from anyone else I’ve worked with. She took children, many of whom were in a “tragic situation” when we consider life from a purely physical point of view, and she understood at an intuitive level how to nurture these children’ s souls. I remem ber being so touched, Neale, by the way she walked through the world. Every week, she would get the kids together and volunteer her time for a “group outing.” Sometimes it would be an outdoor activity like going for a walk in the woods, or having a picnic,and other times it would be an indoor activity like arts and crafts or watching a movie with pizza. All of the kids would get together with one another, but the rule was that they could not talk about cancer. Each one of them had cancer, and each one of them had been enduring challenging health battles, but for the durat ion of the evening they got to experience being normal, regular children, free from the psychological burdens of chronic disease. All they were to do was to “hang out” with one anoth er, to spend quality time, and to celebrate their gifts. So every activity they would do—whether it was arts and crafts, whether it was walking in nature, no matter what it was—this doctor would point out to them their talents and their successes. And she would celebrate the gifts that they each had in this lifetime. And whether your life is 7 years or 17 years or 70 years long, to me in that moment I felt like gosh, it almost doesn’t make a difference. Because what she was teaching these children was to live a spiritual life in the time they were here. And rather than feeling like their life was “worse off,” these kids were actually some of the happiest childr en I’d ever met! Every time they saw this particular doctor, they walked into the room with a smile on their face and with joy pouring out of their hearts. And I think it’s because, although these kids had a fraction of time on the planet compare d with our current life expectancy, she was teaching them how to live in alignment with the Agenda of the Soul. So while their bodies may have been “dying,” their souls were not. And to that degree, their lives were... NEALE: ... complete. DR. COOPER: Yes! Their lives were complete. And if this isn’t true healing, then I don’t know what is. To me, it illustrates perfectly what
[ 311, 617, 311, 2815, 13, 1628, 198, 906, 2834, 1431, 387, 23069, 315, 1054, 820, 4325, 2476, 430, 753, 369, 2771, 13, 9393, 584, 4805, 387, 3025, 198, 998, 8454, 682, 315, 1057, 2362, 5596, 11, 1057, 1054, 4210, 5596, 2476, 449, 6883, 502, 198, 18753, 13, 1628, 779, 1054, 820, 4325, 863, 690, 912, 5129, 387, 264, 2944, 311, 33663, 13, 1226, 2103, 198, 46068, 617, 33788, 41128, 529, 274, 315, 3388, 837, 17223, 584, 1253, 387, 779, 198, 258, 80491, 430, 584, 649, 1431, 2231, 20449, 1625, 65082, 1625, 1203, 3871, 1578, 13, 2030, 2118, 820, 4325, 863, 1253, 387, 264, 21907, 86560, 315, 2944, 369, 603, 311, 5387, 198, 47692, 1376, 627, 4897, 374, 2133, 311, 1893, 264, 28040, 390, 1263, 10952, 369, 1274, 627, 18433, 1243, 814, 4805, 617, 311, 2216, 220, 1212, 10371, 5694, 279, 13124, 198, 1073, 4860, 584, 2610, 13520, 1457, 11, 994, 584, 636, 439, 2362, 439, 358, 1097, 627, 12487, 279, 3823, 9606, 690, 2216, 617, 311, 1212, 311, 2610, 5196, 11, 499, 198, 33134, 1174, 1054, 3923, 374, 279, 1486, 30, 3639, 1097, 358, 3815, 1618, 369, 220, 4364, 11, 220, 3965, 11, 220, 8258, 198, 42820, 11, 477, 810, 5380, 44130, 3604, 374, 279, 1486, 315, 420, 7106, 5452, 430, 358, 617, 198, 15456, 7182, 389, 12671, 198, 3112, 22225, 433, 690, 387, 1633, 2867, 994, 584, 1212, 5496, 311, 387, 220, 4364, 345, 6860, 11, 477, 220, 3965, 1667, 2362, 430, 433, 14224, 649, 1431, 387, 922, 636, 279, 7564, 11, 636, 198, 1820, 3828, 11, 636, 279, 1841, 11, 636, 279, 2683, 662, 662, 662, 2684, 9539, 374, 2555, 775, 198, 9738, 389, 13, 1628, 430, 690, 3719, 3352, 4501, 8196, 311, 603, 11, 439, 584, 3240, 198, 64275, 779, 1317, 430, 584, 3719, 34386, 449, 4400, 719, 279, 7106, 198, 4575, 2743, 1392, 315, 1057, 2324, 627, 4516, 279, 11838, 61961, 315, 22706, 374, 2133, 311, 1893, 264, 1972, 198, 444, 1263, 10952, 369, 3823, 23837, 13, 1628, 279, 3488, 374, 25, 4946, 433, 990, 198, 69849, 279, 58662, 315, 279, 30242, 11, 477, 304, 4799, 315, 279, 58662, 315, 279, 198, 50, 11206, 5380, 3112, 430, 3488, 690, 387, 9277, 1603, 279, 3838, 11, 220, 323, 198, 57824, 555, 1274, 889, 527, 12798, 4040, 323, 3230, 6666, 198, 998, 539, 1193, 279, 2890, 315, 279, 2547, 11, 719, 311, 279, 14209, 315, 279, 3823, 198, 82, 11206, 323, 1202, 7580, 323, 734, 304, 279, 8244, 1920, 430, 584, 1650, 198, 26380, 2324, 627, 720, 7842, 13, 7432, 47465, 25, 7566, 0, 1102, 7995, 690, 4546, 709, 430, 3062, 3488, 512, 548, 584, 1618, 311, 8854, 279, 58662, 315, 279, 14285, 320, 998, 9762, 279, 7106, 4575, 2743, 1392, 315, 2324, 11, 439, 499, 2231, 433, 705, 477, 527, 584, 304, 2144, 1618, 311, 8854, 198, 1820, 58662, 315, 279, 30242, 30, 220, 1628, 433, 1053, 7995, 2349, 1057, 198, 50659, 29057, 1174, 304, 4040, 1057, 18330, 3217, 1174, 422, 584, 198, 52898, 311, 3974, 369, 220, 3965, 1667, 4999, 40, 5406, 5108, 311, 701, 31114, 82, 430, 3629, 1274, 690, 4295, 430, 198, 2837, 315, 18330, 26981, 2212, 5209, 26928, 449, 1057, 1510, 61961, 627, 18433, 11, 439, 499, 1071, 11, 279, 4459, 1054, 998, 30659, 1160, 529, 315, 636, 279, 7564, 11, 636, 279, 198, 29652, 11, 636, 279, 1841, 11, 636, 279, 3838, 5099, 2637, 374, 912, 5129, 264, 67409, 13, 1628, 198, 16455, 2586, 311, 1518, 11, 7344, 220, 2212, 36498, 11, 33517, 11, 477, 53474, 25, 36539, 1174, 358, 4070, 198, 10655, 430, 11, 323, 430, 574, 11364, 662, 662, 662, 719, 7344, 1457, 1070, 529, 274, 198, 34431, 810, 4999, 4516, 8530, 430, 1053, 682, 387, 1524, 810, 8622, 1908, 449, 264, 198, 75, 83395, 857, 1403, 3115, 439, 1317, 4999, 720, 4031, 25940, 25, 38891, 430, 0, 77533, 258, 384, 422, 499, 7070, 17454, 2884, 682, 279, 2574, 499, 198, 61665, 499, 1051, 10171, 311, 636, 2884, 555, 279, 4325, 315, 220, 1774, 11, 477, 220, 1135, 11, 477, 198, 17206, 220, 1399, 13, 4800, 1148, 527, 499, 2133, 311, 656, 369, 279, 1828, 7895, 1667, 30, 51447, 720, 7842, 13, 7432, 47465, 25, 320, 99332, 6266, 3011, 529, 274, 264, 2216, 1695, 3488, 627, 720, 4031, 25940, 25, 3011, 529, 274, 279, 3488, 430, 6593, 8198, 1047, 2731, 387, 198, 61212, 311, 4320, 16853, 18433, 656, 302, 78, 10242, 527, 2133, 311, 3719, 810, 1109, 1120, 27661, 388, 198, 438, 1054, 14789, 13334, 388, 63750, 20670, 3207, 2133, 311, 3719, 2324, 10552, 388, 13, 9029, 198, 548, 2133, 311, 387, 2133, 311, 16410, 5605, 11, 1054, 15546, 64, 2476, 499, 1440, 1174, 1054, 3923, 656, 198, 40, 656, 1457, 369, 279, 1828, 7895, 1667, 30, 358, 2736, 2751, 279, 7564, 11, 2751, 279, 198, 29652, 11, 2751, 279, 1841, 1174, 2751, 279, 2683, 662, 662, 662, 1457, 1148, 1097, 358, 2133, 311, 656, 12671, 3112, 584, 3207, 2133, 311, 1505, 430, 279, 16410, 889, 1650, 5694, 198, 92109, 10574, 95059, 11, 889, 527, 11, 315, 3388, 11, 6593, 16410, 11, 527, 2133, 311, 617, 198, 268, 494, 7162, 2204, 13124, 315, 990, 311, 656, 13, 763, 2144, 11, 1070, 690, 387, 264, 6883, 198, 943, 2115, 11, 439, 35944, 304, 1023, 5151, 3240, 311, 13334, 279, 61961, 315, 198, 26380, 23837, 13, 54943, 315, 279, 4059, 2345, 92109, 10574, 95059, 320, 40, 11471, 499, 11, 323, 198, 40, 7168, 430, 420, 690, 3621, 304, 701, 19569, 68850, 14724, 2274, 264, 502, 198, 59362, 11, 264, 502, 9046, 323, 264, 502, 2115, 315, 69244, 13, 1102, 4805, 387, 2663, 16853, 13, 662, 358, 1541, 1431, 1440, 1148, 814, 4805, 1650, 433, 13967, 11, 719, 856, 4096, 315, 433, 198, 41450, 387, 63849, 69244, 627, 5159, 8830, 374, 430, 279, 3492, 1054, 92109, 2508, 863, 374, 264, 19290, 520, 535, 198, 1073, 1403, 4339, 11, 1054, 46246, 971, 863, 323, 1054, 36781, 1174, 863, 902, 34044, 505, 279, 18341, 198, 1178, 369, 13836, 11, 323, 279, 21053, 597, 3492, 369, 12496, 11, 477, 24278, 13, 2100, 1054, 46246, 971, 7058, 36781, 863, 374, 279, 24278, 477, 279, 12496, 315, 279, 13836, 627, 7009, 3952, 279, 13836, 704, 315, 1054, 46246, 971, 12, 36781, 863, 994, 433, 6244, 198, 2118, 92109, 2508, 863, 320, 1820, 4913, 705, 323, 1521, 2919, 74191, 323, 198, 92109, 10574, 95059, 527, 539, 5535, 220, 311, 4546, 1139, 872, 6514, 279, 3492, 198, 28622, 11, 7389, 433, 374, 520, 279, 387, 6536, 323, 520, 279, 3230, 1715, 315, 279, 198, 23557, 13, 2030, 1524, 1243, 11, 814, 649, 1193, 2610, 279, 8893, 1148, 814, 1781, 198, 9274, 430, 13, 1102, 374, 6646, 704, 315, 14597, 369, 46876, 95059, 311, 30714, 198, 269, 4284, 477, 13488, 6848, 922, 4359, 430, 279, 73969, 9711, 1139, 198, 1820, 3634, 13, 2435, 649, 1193, 4358, 1148, 279, 8893, 12716, 1139, 279, 198, 62737, 627, 4071, 1070, 690, 387, 63849, 23258, 391, 1705, 439, 264, 9046, 315, 69244, 198, 438, 36673, 304, 279, 1828, 33517, 1667, 889, 690, 387, 1120, 439, 1790, 264, 198, 15495, 380, 304, 430, 3158, 439, 8071, 11, 2487, 11, 19689, 11, 323, 28691, 35416, 11, 323, 198, 1605, 28378, 274, 889, 48444, 304, 3738, 5789, 315, 279, 7106, 2547, 13801, 548, 3432, 13, 578, 31768, 19506, 26434, 690, 5249, 279, 7106, 198, 17242, 10567, 1572, 439, 961, 315, 279, 8244, 6593, 4913, 13, 720, 7842, 13, 7432, 47465, 25, 3011, 529, 274, 1778, 264, 6366, 1648, 315, 10917, 433, 22416, 198, 4150, 1366, 19506, 690, 5249, 279, 7106, 627, 2028, 4459, 7434, 3727, 757, 1781, 1203, 311, 264, 10896, 358, 6575, 198, 4291, 889, 574, 264, 95936, 77854, 16549, 11, 7438, 430, 1364, 6575, 304, 279, 198, 2630, 315, 20587, 9572, 662, 9176, 1274, 1053, 2980, 220, 420, 311, 387, 264, 198, 331, 34869, 287, 422, 539, 264, 17693, 58272, 6147, 2115, 311, 990, 304, 11, 2728, 430, 198, 35676, 315, 1521, 2911, 2646, 1304, 433, 1139, 872, 6822, 1667, 13, 2030, 1148, 198, 576, 10896, 9076, 1521, 2911, 374, 264, 8352, 358, 4805, 2646, 10894, 13, 3005, 574, 198, 66, 7770, 398, 264, 1054, 43824, 315, 279, 30242, 2476, 422, 358, 1436, 2231, 433, 430, 1648, 662, 662, 662, 4423, 198, 14965, 27092, 279, 7106, 449, 279, 31768, 19506, 11, 220, 311, 1005, 701, 4339, 627, 2170, 584, 4070, 15243, 922, 1603, 11, 304, 279, 12735, 389, 6593, 198, 20531, 18709, 11, 568, 8115, 7933, 279, 7106, 220, 323, 279, 31768, 19506, 220, 527, 1403, 11314, 315, 198, 1820, 1890, 16652, 13, 1102, 374, 304, 279, 80114, 315, 279, 28479, 323, 279, 198, 87475, 940, 2345, 2940, 4359, 323, 19152, 3449, 2345, 2940, 837, 21730, 5097, 198, 2050, 13, 1789, 304, 15082, 439, 22520, 323, 2324, 49961, 439, 20587, 198, 66, 11967, 1174, 311, 27661, 279, 2547, 2085, 4737, 1139, 2759, 279, 18330, 198, 30362, 3520, 315, 279, 3927, 1053, 387, 311, 2980, 1120, 832, 2678, 6710, 315, 198, 1820, 4447, 627, 3112, 420, 374, 1148, 19180, 420, 4040, 28378, 505, 198, 3852, 606, 775, 358, 4070, 6575, 449, 13, 3005, 3952, 2911, 11, 1690, 315, 8884, 198, 52898, 304, 264, 1054, 376, 13070, 6671, 863, 994, 584, 2980, 2324, 505, 264, 32227, 198, 47692, 1486, 315, 1684, 1174, 323, 1364, 16365, 520, 459, 42779, 2237, 1268, 311, 198, 77, 324, 5081, 1521, 2911, 529, 274, 35826, 627, 40, 1323, 336, 10418, 1694, 779, 24891, 11, 4275, 1604, 11, 555, 279, 1648, 1364, 15203, 198, 20322, 279, 1917, 13, 7357, 2046, 11, 1364, 1053, 636, 279, 6980, 3871, 323, 198, 12821, 42005, 1077, 892, 369, 264, 1054, 4166, 65281, 2029, 18156, 433, 1053, 387, 459, 198, 412, 11020, 5820, 1093, 2133, 369, 264, 4321, 304, 279, 33633, 11, 477, 3515, 264, 55562, 51526, 1023, 3115, 433, 1053, 387, 459, 30619, 5820, 1093, 19071, 323, 44948, 477, 198, 14658, 287, 264, 5818, 449, 23317, 13, 2052, 315, 279, 6980, 1053, 636, 3871, 449, 198, 606, 2500, 1174, 719, 279, 6037, 574, 430, 814, 1436, 539, 3137, 922, 9572, 16853, 4959, 832, 315, 1124, 1047, 9572, 1174, 323, 1855, 832, 315, 1124, 1047, 1027, 198, 408, 1711, 17436, 2890, 220, 25572, 11, 719, 369, 279, 10878, 266, 28772, 315, 279, 198, 17206, 287, 814, 2751, 311, 3217, 1694, 4725, 11, 5912, 2911, 11, 1949, 198, 1527, 279, 24064, 64074, 315, 21249, 8624, 627, 2460, 814, 1051, 311, 656, 574, 311, 1054, 21313, 704, 863, 449, 832, 459, 8942, 2781, 11, 311, 198, 2203, 408, 4367, 892, 11, 323, 311, 18890, 872, 21258, 13, 2100, 1475, 5820, 814, 198, 41450, 656, 2345, 49864, 433, 574, 19071, 323, 44948, 11, 3508, 433, 574, 11689, 304, 198, 67812, 11, 912, 5030, 1148, 433, 574, 2345, 576, 10896, 1053, 1486, 704, 311, 1124, 198, 50828, 35032, 323, 872, 48188, 13, 220, 1628, 1364, 1053, 18890, 279, 21258, 198, 9210, 814, 1855, 1047, 304, 420, 19569, 13, 1628, 3508, 701, 2324, 374, 220, 22, 1667, 477, 198, 1114, 1667, 477, 220, 2031, 1667, 1317, 11, 311, 757, 304, 430, 4545, 358, 6612, 1093, 342, 9451, 11, 433, 198, 60301, 3250, 1431, 1304, 264, 6811, 627, 18433, 1148, 1364, 574, 12917, 1521, 2911, 574, 311, 3974, 264, 198, 86390, 940, 2324, 304, 279, 892, 814, 1051, 1618, 13, 1628, 4856, 1109, 8430, 1093, 198, 50828, 2324, 574, 1054, 86, 11073, 1022, 2476, 1521, 6980, 1051, 3604, 1063, 315, 279, 198, 71, 680, 13744, 1716, 81, 665, 358, 7070, 3596, 2322, 0, 7357, 892, 814, 5602, 420, 4040, 198, 38083, 1174, 814, 15203, 1139, 279, 3130, 449, 264, 15648, 389, 872, 3663, 323, 449, 198, 4215, 51513, 704, 315, 872, 23492, 13, 1628, 358, 1781, 433, 753, 1606, 1174, 8051, 198, 45010, 6980, 1047, 264, 19983, 315, 892, 389, 279, 11841, 9616, 294, 449, 1057, 198, 3311, 2324, 66995, 1174, 1364, 574, 12917, 1124, 1268, 311, 3974, 304, 198, 45698, 449, 279, 58662, 315, 279, 30242, 627, 4516, 1418, 872, 13162, 1253, 617, 1027, 1054, 67, 7169, 2476, 872, 35826, 1051, 198, 1962, 627, 3112, 311, 430, 8547, 11, 872, 6439, 1051, 662, 662, 16853, 8014, 25940, 25, 220, 662, 662, 662, 4686, 627, 720, 7842, 13, 7432, 47465, 25, 7566, 0, 11205, 6439, 1051, 4686, 13, 220, 1628, 422, 420, 4536, 1431, 837, 198, 383, 6260, 11, 1243, 358, 1541, 1431, 1440, 1148, 374, 627, 1271, 757, 11, 433, 46480, 14268, 1148 ]
0xBreath/holistic-books
time I will be going for a blood test, my cholesterol level will be found to be even lower. So, goodbye to the "normal" Egypt ian standards and welcome to the American new levels of cho lesterol without the accompanying sense of deprivation! Enjoying eating, moderately of course, as I had not been doing for a long time and free from a worry that wasalways at the back of my mind, I believe I owe you a big THANK Y OU. YOURS SINCEREL Y MINISTER MOHAM MED W AHBY Director, Press and Information Bureau These same chemicals can also set the stage for the deposit of cholesterol in the walls of the arteries. The common facto r to all of the various co nditions labeled as different diseases of the heart and the lungs is an established dehydration. Take a look at Mr. Sam Liguori's letter, published by his kind permission. His a nginal pain disappeared when he started to increase his wat er intake. He also has suffered from hiatus hernia. That, too, has sta rted to dear up. Give him time, and it will recover completely. Al so take a look at Loretta Johnson's letter. You will see that even at the young-at-heart age of 90, her anginal pain can be treated with water to the extent that she does not need any medication for her heart pains. I have many, many letters sim ilar to these. It is not possible to publish them all. I have selected a few o f them to show you that what I propose is not a theory. It, in fact /works for different people of varying ages. WARD The Talk Station 155 0-AM December 2, 1994 Global Health Service, Inc. Dr. Fereydo on Batmanghelidj Foundation For The Simple In Medicine P.O Bo x 3267, Falls Ch urch, VA 2 2043 Dear Dr. Batmanghelidj: Just a short letter to thank you for informing our listeners about the health benefits o f drinking two quarts of water a day. Not only did you help our radio audience, but I personally have enjoyed a resurgence of energy after drinking two quarts of water each day for just over one week. The angina pain I endured for five years has disappeared and my d istress f rom a hiatal hernia has greatly lessened. I feel like a new person. I've been doing talk shows at WARD Ra dio for the past 20 years, and I must say y our interview w ith us is o ne I'll always remember. Sincerely, Samuel M. L iguori, Program Director WARD Br oadcasting Corporation P.O Bo x 1550 Pittston, PA 1 8640 (717) 655-5521Mr. John Fox's case is very unusual in that his severe case of heart disease was r eversed sufficiently to make life once again normal for him—with out the bypass surgery that is now in vogue. Mr. Fox is in his sixth decade of life. He is a retired electronics engineer who has sp ent many highly responsible years with the Navy. Today, he is one of the 50 living Bates-Trained Natural "Visio n specialists. At so me point in time, he was nearly blind in one eye and losing vision in the other. He became intrigued with the Bates method of vision training because of his own needs. As a result of his training, he is not going blind anymore and his eyesight is saved—virtually normal now. A few years back, he was con sidered hypertensive. He received medication to reduce his blood pressure. He could not take the medications; they made him worse. His problems sta rted when he suffered his heart attacks. His le tter explains what happened to him and how he is better now. Th e highlight of this letter is that after two months of taking increased water, and a slight adjustment to his diet, in addition to his daily walks, his coronary arteries m ust have cleared sufficiently for him to feel normal. He now enjoys normal activity without having to endure any pain, and all of that with out the use of any medication or suffering by-pass surgery. Imagine that a person with such a severe heart problem as Mr. Fox cou ld in about two months get back to normal life and not need invasive treatment even though chemical treatments failed! The proposed nature-designed approach to the problem scientifically and logically seems to depend on physiological reversal of the disease process. It's an ideal way of offering cures for some degenerative disease conditions. BATES-F OXNatural Vision Training 2945 North Lexington Street Arlin gton Virginia 22207 Telephone 703 536 7482 Attestation: 25 March 1992 It was in the spring of 1991 when I first learned from a member of the Foun dation For the Simple In Medicine t he value of water as a form of medication. Six months before, I had suffered two heart attacks a nd had undergone angioplasty surgery. Afte r the operation, I was prescribed heavy dosages of calcium and beta blockers, baby aspirin, nitroglycerine (for pain), and cholesterol-reducing medicine for recovery. The angiogram before the angioplasty had shown one of the arteries of my heart was 97 percent blocked by cholesterol deposits. I was t old my heart had been damaged. After six months of strict attention to my prescribed "recuperation" program, I noticed that my condition was rapidly deteriorating, to the extent that I had difficulty sleeping because of pain in my left arm, back and chest, and also felt these same pains whe n I took my daily walks. I visualized myself going for bypass sur gery at the sche duled time for reevaluation of my condition. By this time, I also suffered from serious side effects caused by th e medications, su ch as: my p rostate created retention and blocking problems; I had also developed problems with my v ision and memory recall. I first began my rehabilitation through diet by a regular intake of six to eight 8-ounce glasses of water each day for three days. I was told to drink water a half-hour before eating my daily meals. I cut off my anti-cholesterol pills, aspirin and nitroglycerine pills. Judging by the effect of the water, it seemed I did not need them. I also started taking orange juice and started using salt in my diet again (I had been on a sodium-free diet). After the first three days, I was fee ling more comfortable about all of that added water. Afte r three weeks of gradually reducing the calcium and beta-blockers, I noticed som e very favorable/ changes. Whenever I felt pain, I would drink water and /get instant relief. My diet remained the same—fruits, vegetables, chicken, fish, orange juice, and carrot juice. To get more tryptophan, I was asked to add cottage cheese and lentil soup to my d iet. Dr. Batmanghelidj requested that I take two one-hour walks (25 min. mile) a day. After the second month, I noticed no more pain—even walking up steep hills. After the fifth month, I changed my walks to 1/2 hour and increased my pace to a 15-minute mile. No constrictions wer e noticed during my walks and my energy had increased two-fold. Much of my p ower to recall had been reestablished, and my vision returned to normal. In Octo ber 1991, I had a series of chemical and physical tests, including x-rays, so nogram, echocardiogram and electrocardiogram, to determine the state of my heart. The tests sh owed that my h eart had restored to its normal state and I did not need any form of medication to cope with my daily routine. My doctor could not believe how simply all this change had taken place. John 0. Fox Bates-Fox Natural Visio n Training Adding the statements of Mr. Wahby to the results presented by Mr. Fox, Mr. Paturis, Mr. Liguori, Mrs. Johnson, Col. Burmeister and Mr. Peck, one begins to recognize the fact that common tap water has medicinal values hitherto unrecognized. Water is a readily avail able natural medicine f or some of the pr evalent a nd very serious medical conditions that are known to kill many thousands of people every year. Is it heart disease or dehydration that is killing people? In my professional and scientific view, it is dehydration that is the biggest killer, more than any other condition you could imagine. The different aspects and "chemical idiosyncrasies" of each individual's body reaction to the same pattern of dehydration have received different professio nal labels and have been treated differently—and i neffective ly. Dehydration is the common factor. It is the difference in the "chemical blueprint" in the design of each body that initially demonstrates the signs of chronic dehydration by different outward indicators. Later in the process, other indicators of the same dehydration become apparent. The reason for this difference in the initial pattern may well be the selective process of "shower-head" emergency hydration of some cell types in the body. If you take a second look at the letters by Mr. Peck, Mr. Paturis and Mr. William Gray (p age 152), you will see that
[ 892, 358, 690, 387, 2133, 369, 264, 198, 51105, 1296, 11, 856, 39086, 2237, 690, 387, 1766, 311, 387, 1524, 4827, 13, 2100, 11, 47555, 311, 279, 330, 8416, 1, 15212, 602, 276, 10886, 323, 198, 35184, 311, 279, 3778, 502, 5990, 315, 2665, 514, 33282, 2085, 279, 24442, 5647, 315, 69764, 4999, 39804, 287, 12459, 11, 70351, 315, 3388, 11, 439, 358, 1047, 539, 1027, 3815, 369, 264, 1317, 892, 323, 1949, 505, 264, 11196, 430, 574, 33222, 520, 279, 1203, 315, 856, 4059, 11, 358, 4510, 358, 42210, 499, 264, 2466, 81957, 816, 63935, 627, 56, 60373, 328, 39539, 643, 2818, 816, 198, 16818, 20092, 11672, 74593, 52699, 468, 48388, 20507, 198, 38294, 11, 8612, 323, 8245, 22555, 198, 9673, 1890, 26333, 649, 220, 1101, 743, 279, 6566, 369, 279, 16946, 315, 39086, 304, 279, 14620, 315, 279, 85648, 13, 578, 4279, 198, 34210, 78, 436, 311, 682, 315, 279, 5370, 1080, 15953, 6055, 30929, 439, 2204, 19338, 315, 279, 4851, 323, 279, 45274, 374, 459, 9749, 198, 80660, 50791, 13, 12040, 264, 1427, 520, 4491, 13, 8388, 445, 27843, 13915, 596, 6661, 11, 4756, 555, 813, 3169, 8041, 13, 5414, 264, 7933, 992, 6784, 29496, 198, 9493, 568, 3940, 311, 5376, 813, 30125, 2781, 23730, 13, 1283, 1101, 706, 16654, 505, 81286, 72909, 689, 13, 3011, 11, 2288, 11, 706, 29611, 436, 6702, 311, 25237, 198, 455, 13, 21335, 1461, 892, 11, 323, 433, 690, 11993, 6724, 13, 1708, 779, 1935, 264, 1427, 520, 445, 18673, 2629, 11605, 596, 6661, 13, 1472, 690, 1518, 430, 1524, 198, 266, 279, 3995, 29883, 43344, 4325, 315, 220, 1954, 11, 1077, 6590, 992, 6784, 649, 387, 12020, 449, 3090, 311, 279, 13112, 430, 1364, 1587, 539, 1205, 904, 198, 2106, 20901, 369, 1077, 4851, 51266, 627, 40, 617, 1690, 11, 1690, 12197, 1675, 220, 3653, 311, 1521, 13, 1102, 374, 539, 3284, 311, 3498, 1124, 682, 13, 358, 617, 4183, 264, 2478, 297, 282, 1124, 311, 198, 3528, 499, 430, 1148, 358, 30714, 374, 539, 264, 10334, 13, 1102, 11, 304, 2144, 611, 19033, 369, 2204, 1274, 315, 29865, 17051, 627, 29266, 198, 791, 19513, 17040, 198, 9992, 220, 15, 12, 1428, 198, 33246, 220, 17, 11, 220, 2550, 19, 198, 11907, 6401, 5475, 11, 4953, 13, 720, 9023, 13, 435, 486, 88, 3055, 389, 16488, 76, 526, 50222, 307, 73, 720, 19137, 1789, 578, 9170, 763, 19152, 720, 47, 8548, 2577, 865, 220, 17470, 22, 11, 30743, 921, 220, 2639, 11, 21571, 220, 17, 220, 7854, 18, 198, 31765, 2999, 13, 16488, 76, 526, 50222, 307, 73, 512, 10156, 264, 2875, 6661, 311, 9901, 499, 369, 63025, 1057, 24475, 922, 279, 2890, 7720, 297, 282, 16558, 1403, 934, 7183, 315, 3090, 264, 198, 1316, 627, 2688, 1193, 1550, 499, 1520, 1057, 9063, 10877, 11, 719, 358, 16102, 617, 14333, 264, 91590, 315, 4907, 1306, 16558, 1403, 198, 447, 7183, 315, 3090, 1855, 1938, 369, 1120, 927, 832, 2046, 627, 791, 6590, 2259, 6784, 358, 56224, 369, 4330, 1667, 706, 29496, 323, 856, 294, 6127, 676, 282, 10083, 264, 15960, 4306, 72909, 689, 706, 19407, 2753, 6901, 627, 40, 2733, 1093, 264, 502, 1732, 627, 40, 3077, 1027, 3815, 3137, 5039, 520, 468, 7527, 18989, 65570, 369, 279, 3347, 220, 508, 1667, 11, 323, 358, 2011, 2019, 379, 1057, 7274, 289, 78942, 603, 374, 297, 841, 358, 3358, 198, 33222, 6227, 627, 50, 87191, 345, 24903, 4088, 386, 13, 445, 19935, 84, 13915, 11, 6826, 10783, 198, 29266, 3320, 297, 329, 77432, 13332, 720, 47, 8548, 2577, 865, 220, 9992, 15, 220, 21823, 7876, 11, 13174, 220, 16, 220, 19355, 15, 320, 25150, 8, 220, 15573, 12, 21478, 16, 12555, 13, 3842, 13585, 596, 1162, 374, 1633, 19018, 304, 430, 813, 15748, 1162, 220, 315, 4851, 8624, 574, 436, 384, 44876, 40044, 311, 1304, 2324, 198, 13486, 1578, 4725, 369, 1461, 81902, 704, 279, 31818, 15173, 430, 374, 1457, 304, 220, 348, 28523, 13, 4491, 13, 13585, 374, 304, 813, 26084, 13515, 315, 2324, 627, 1548, 374, 264, 22311, 31591, 24490, 889, 706, 993, 1218, 1690, 7701, 8647, 1667, 449, 279, 19574, 13, 11450, 11, 568, 374, 832, 315, 198, 1820, 220, 1135, 5496, 74962, 89147, 2692, 18955, 330, 3198, 822, 308, 35416, 13, 2468, 779, 757, 1486, 304, 892, 11, 568, 574, 7154, 18507, 304, 832, 8071, 323, 198, 18310, 11376, 304, 279, 1023, 13, 1283, 6244, 69118, 449, 279, 74962, 1749, 315, 11376, 4967, 1606, 315, 813, 1866, 3966, 627, 2170, 264, 1121, 315, 813, 4967, 11, 568, 374, 539, 2133, 18507, 14926, 323, 813, 6548, 492, 374, 6924, 2345, 48481, 1870, 4725, 1457, 627, 32, 2478, 1667, 1203, 11, 568, 574, 390, 87674, 291, 48855, 4114, 13, 1283, 4036, 24099, 311, 8108, 813, 6680, 7410, 13, 1283, 1436, 198, 1962, 1935, 279, 31010, 26, 814, 1903, 1461, 11201, 13, 5414, 5435, 29611, 436, 6702, 994, 568, 16654, 813, 4851, 8951, 13, 5414, 514, 259, 466, 198, 30992, 1771, 1148, 7077, 311, 1461, 323, 1268, 568, 374, 2731, 1457, 13, 666, 384, 11415, 315, 420, 6661, 374, 430, 1306, 1403, 4038, 315, 198, 89894, 7319, 3090, 11, 323, 264, 8275, 28174, 311, 813, 10173, 11, 304, 5369, 311, 813, 7446, 23291, 11, 813, 66298, 85648, 296, 88689, 198, 19553, 23803, 40044, 369, 1461, 311, 2733, 4725, 13, 1283, 1457, 32838, 220, 4725, 5820, 2085, 3515, 311, 46753, 904, 6784, 345, 438, 682, 315, 430, 449, 704, 279, 1005, 315, 904, 24099, 477, 16066, 555, 48067, 15173, 627, 52157, 430, 264, 1732, 449, 1778, 264, 15748, 4851, 3575, 439, 4491, 13, 13585, 4020, 27221, 304, 922, 1403, 4038, 636, 1203, 311, 4725, 198, 14789, 323, 539, 1205, 53354, 6514, 1524, 3582, 11742, 22972, 4745, 0, 578, 11223, 7138, 69956, 198, 16082, 613, 311, 279, 3575, 74647, 323, 74145, 5084, 311, 6904, 389, 53194, 59214, 315, 279, 8624, 198, 4734, 13, 1102, 596, 459, 10728, 1648, 315, 10209, 272, 1439, 369, 1063, 5367, 75989, 8624, 4787, 627, 33, 31404, 7424, 507, 55, 55381, 31541, 16543, 198, 17168, 20, 4892, 71758, 6825, 720, 32, 2438, 258, 342, 783, 13286, 220, 9716, 2589, 720, 68491, 220, 20436, 220, 21600, 220, 20338, 17, 198, 1688, 1985, 367, 25, 220, 914, 5587, 220, 2550, 17, 198, 2181, 574, 304, 279, 10683, 315, 220, 2550, 16, 994, 358, 1176, 9687, 505, 264, 4562, 315, 279, 435, 1656, 294, 367, 1789, 279, 9170, 763, 220, 19152, 259, 568, 198, 970, 315, 3090, 439, 264, 1376, 315, 24099, 13, 19198, 4038, 1603, 11, 358, 1047, 16654, 1403, 4851, 8951, 264, 15953, 1047, 64238, 198, 79428, 92335, 88, 15173, 13, 13203, 668, 436, 279, 5784, 11, 358, 574, 32031, 8987, 8924, 1154, 315, 35719, 323, 13746, 84235, 11, 8945, 198, 300, 5682, 258, 11, 25719, 12184, 68590, 483, 320, 2000, 6784, 705, 323, 39086, 5621, 1072, 6253, 16088, 369, 13654, 13, 578, 92962, 13255, 1603, 279, 198, 79428, 92335, 88, 1047, 6982, 832, 315, 279, 85648, 315, 856, 4851, 574, 220, 3534, 3346, 19857, 555, 39086, 34751, 13, 358, 574, 259, 2362, 856, 198, 18207, 1047, 1027, 20727, 627, 6153, 4848, 4038, 315, 7452, 6666, 311, 856, 32031, 330, 2827, 3550, 367, 1, 2068, 11, 358, 14000, 430, 856, 3044, 574, 19019, 198, 67, 1430, 2521, 1113, 11, 311, 279, 13112, 430, 358, 1047, 17250, 21811, 1606, 315, 6784, 304, 856, 2163, 6916, 11, 1203, 323, 15489, 11, 323, 1101, 6612, 198, 45010, 1890, 51266, 15240, 308, 358, 3952, 856, 7446, 23291, 13, 358, 9302, 1534, 7182, 2133, 369, 31818, 1765, 342, 727, 520, 279, 71351, 3930, 839, 892, 369, 198, 770, 24756, 315, 856, 3044, 13, 3296, 420, 892, 11, 358, 1101, 16654, 505, 6129, 3185, 6372, 9057, 555, 270, 384, 31010, 11, 924, 523, 198, 300, 25, 856, 281, 938, 2513, 3549, 38231, 323, 22978, 5435, 26, 358, 1047, 1101, 8040, 5435, 449, 220, 856, 348, 374, 290, 323, 198, 17717, 19635, 627, 40, 1176, 6137, 856, 44438, 1555, 10173, 555, 264, 5912, 23730, 315, 4848, 311, 220, 8223, 220, 23, 12, 9933, 29247, 315, 3090, 1855, 1938, 369, 198, 28956, 2919, 13, 358, 574, 3309, 311, 7172, 3090, 264, 4376, 21925, 1603, 12459, 856, 7446, 21644, 13, 358, 4018, 1022, 856, 7294, 12, 971, 273, 33282, 26153, 345, 300, 5682, 258, 323, 25719, 12184, 68590, 483, 26153, 13, 11462, 3252, 555, 279, 2515, 315, 279, 3090, 11, 433, 9508, 358, 1550, 539, 1205, 1124, 13, 358, 1101, 3940, 4737, 198, 35264, 23661, 323, 3940, 1701, 12290, 304, 856, 10173, 1578, 320, 40, 1047, 1027, 389, 264, 39695, 12862, 10173, 570, 4740, 279, 1176, 2380, 2919, 11, 358, 198, 16514, 11307, 38172, 810, 10882, 922, 682, 315, 430, 3779, 3090, 13, 13203, 668, 436, 2380, 5672, 315, 27115, 18189, 279, 35719, 323, 198, 19674, 9612, 388, 11, 358, 14000, 1794, 384, 1633, 37849, 14, 4442, 13, 43633, 358, 6612, 6784, 11, 358, 1053, 7172, 3090, 323, 611, 456, 9888, 198, 3833, 4843, 13, 3092, 10173, 14958, 279, 1890, 2345, 1658, 12059, 11, 24822, 11, 16553, 11, 7795, 11, 19087, 23661, 11, 323, 75294, 23661, 13, 2057, 636, 810, 198, 1568, 418, 5237, 276, 11, 358, 574, 4691, 311, 923, 46722, 17604, 323, 48907, 321, 19724, 311, 856, 294, 602, 295, 627, 9023, 13, 16488, 76, 526, 50222, 307, 73, 11472, 430, 358, 1935, 1403, 832, 21925, 23291, 320, 914, 1332, 13, 14929, 8, 264, 1938, 13, 4740, 279, 2132, 2305, 11, 358, 14000, 198, 2201, 810, 6784, 80078, 11689, 709, 32366, 35231, 13, 4740, 279, 18172, 2305, 11, 358, 5614, 856, 23291, 311, 220, 220, 16, 14, 17, 6596, 323, 7319, 856, 198, 1330, 311, 264, 220, 868, 24401, 14929, 13, 2360, 390, 6765, 919, 7205, 384, 14000, 2391, 856, 23291, 323, 856, 4907, 1047, 7319, 1403, 24325, 627, 43182, 220, 315, 856, 281, 297, 6703, 311, 19635, 1047, 1027, 312, 34500, 291, 11, 323, 856, 11376, 6052, 311, 4725, 627, 644, 5020, 78, 10418, 220, 2550, 16, 11, 358, 1047, 264, 4101, 315, 11742, 323, 7106, 7177, 11, 2737, 865, 82817, 11, 779, 308, 13255, 11, 31972, 511, 37489, 13255, 323, 198, 19493, 299, 5057, 72, 13255, 11, 311, 8417, 279, 1614, 315, 856, 4851, 13, 578, 7177, 559, 49009, 430, 856, 305, 384, 472, 1047, 28101, 311, 1202, 4725, 198, 2513, 323, 358, 1550, 539, 1205, 904, 1376, 315, 24099, 311, 37586, 449, 856, 7446, 14348, 13, 3092, 10896, 1436, 539, 4510, 1268, 198, 15124, 2603, 682, 420, 2349, 1047, 4529, 2035, 627, 13379, 220, 15, 13, 13585, 198, 33, 988, 7424, 5241, 18955, 7811, 822, 308, 16543, 198, 33408, 279, 12518, 315, 4491, 13, 70690, 1729, 311, 279, 3135, 10666, 555, 4491, 13, 13585, 11, 4491, 13, 393, 2693, 285, 11, 4491, 13, 445, 27843, 13915, 11, 18083, 13, 11605, 345, 6255, 13, 12649, 2727, 1601, 323, 4491, 13, 5250, 377, 11, 832, 12302, 311, 15641, 279, 2144, 430, 4279, 15596, 3090, 706, 58041, 2819, 198, 71, 411, 14200, 97239, 13, 10164, 374, 264, 31368, 39011, 3025, 5933, 16088, 282, 477, 1063, 315, 279, 550, 5720, 306, 264, 15953, 1633, 6129, 198, 69216, 4787, 430, 527, 3967, 311, 5622, 1690, 9214, 315, 1274, 1475, 1060, 13, 2209, 433, 4851, 8624, 477, 99857, 198, 9210, 374, 13419, 1274, 30, 763, 856, 6721, 323, 12624, 1684, 11, 433, 374, 99857, 430, 374, 279, 8706, 25534, 11, 810, 1109, 904, 198, 1605, 3044, 499, 1436, 13085, 13, 578, 2204, 13878, 323, 330, 32056, 887, 3614, 1756, 13075, 552, 1, 315, 1855, 3927, 596, 2547, 198, 60307, 311, 279, 1890, 5497, 315, 99857, 617, 4036, 2204, 35578, 822, 85633, 9382, 323, 617, 1027, 12020, 198, 67, 14657, 4501, 17223, 602, 841, 40784, 14869, 627, 1951, 81824, 374, 279, 4279, 8331, 13, 1102, 374, 279, 6811, 304, 279, 330, 32056, 54029, 1, 304, 279, 2955, 315, 1855, 2547, 430, 198, 9613, 398, 32216, 279, 12195, 315, 21249, 99857, 555, 2204, 52046, 34824, 13, 25929, 304, 279, 1920, 11, 1023, 198, 485, 43152, 315, 279, 1890, 99857, 3719, 10186, 13, 578, 2944, 369, 420, 6811, 304, 279, 2926, 5497, 1253, 1664, 387, 198, 1820, 44010, 1920, 315, 330, 939, 1223, 27488, 1, 13147, 88000, 315, 1063, 2849, 4595, 304, 279, 2547, 13, 1442, 499, 1935, 264, 2132, 198, 7349, 520, 279, 12197, 555, 4491, 13, 5250, 377, 11, 4491, 13, 393, 2693, 285, 323, 4491, 13, 12656, 24255, 320, 79, 4325, 220, 9756, 705, 499, 690, 1518, 430 ]
0xBreath/holistic-books
the patient may have itching sensation but he should not be alarmed. He should contiune the rubbing and the sensation will gradually subside. 2. 3. Sometimes the accumulated heat of the body comes out and small white pimples with red points appear on the body. The excessive heat begins to come out only after rubbing urine. It is the sign of organic purification. Pimples appear in prop~~ion to the accumulation of heat in the body. In such a cond1t1on, urine may be rubbed on them ~ith some bearable pressure, so that pimples get open and urine enters into them. After an hour or two the patient should take bath with lukewarm water. Soap, in no case, should be used. The disease is rooted out only when the accumulated poison is eliminated. There are three exits of this poison-through month in the form of vom1ting, through pores in the form of pimples and heat eruptions, and through the anus in the form of frequent stools. All the three reactions are possible whi!e undergoing this treatment. The poison may come out slowly 1n the form of cough and cold. In that case, vomiting may not 41 42 : AUTO-URINE THERAPY occur. Similarly, loose motions may not occur in case accumulated toxins are eliminated in several ordinary motions. In case they are not washed out through some such way, there is every possibility of vomiting and loose motions during the period of fast. There is nothing to be worried about these reactions. Nature should be allowed to have her way; it is positively beneficial to do so. In spite of relatives persuasion, no medicine or injection should be taken to stop these reactions, because that would be extremely harmful. The reactions will subside automatically during this treatment. There is nothing to be alarmed even when there are no reactions due to one's peculiar constitution. Sometimes, many minor troubles appear along with the main disease. I quote here a case to clarify the point. Mr. Kantilal Shah, the chief reporter of Gujarat Samachar (Ahmedabad) was suffering from piles. Consequently, he had fissures on the soft part of the anus and as a result, pain and burning sensation were unbearable. He resorted to this treatment and started massage with urine. He had an allergy. The rubbing on foot resulted in pimples on the face. He was alarmed and telephoned me. I advised him to stop the rubbing and continue dringking urine twice or thrice' a day. The pimples disappeared in a week but the allergy continued. This is a disease caused by constipation which also could be got rid of. I advised him to continue the drinking of urine and he followed my instructions. Consequently, the toxins accumulated in his system were eliminated. His bowels were cleared and he experienced a light body. At the same time, the allergy also disappeared. Shri Shamalbhai, the organizer of Gram-Rakshak Dal in the Kaira district got itching on the nose and it became red. He began the urine treatment. He had itching on the whole body along with acute allergy. In addition, he had diabetes also. He did not care for all these troubles and began the treatment without taking instructions. He was accustomed to taking saccharine in tea and he continued the same during the urine treatment and kept no control over his diet. In DANGER -SIGNALS AND CAUTIONS : 43 three days, his whole body became allergic in addition to ha~ing pimples. In this condition, he informed me from Bors~d." I ~dv1sed him to have patience and not to take any medicine o~ 1nJect10~. He was further advised to rub urine with pressure. He d1d accordmgly and he got relief in two days though after suffering a gre~t d~al. Urine is a natural complex chemical substance and sacchanne IS a chemical compound. No homogeneity is possible between such mutually contradictory substances. The above two example are sufficient to caution the patients adpoting the urine therapy. 1. 2. 3. 4. 5. 6. 7. 8. 9. 1 0. Important Precautio ns : Utilize urine only scientifically as shown in the foregoing chapters. Do not use any medicine during urine treatment. Do not get alarmed by the reactions like vomiting, loose motions, etc., during urine treatment. Start urine treatment only after giving up habits like smoking, snuffing, wine-drinking and at least these habits must be well controlled. Give up use of condiments at le~st during the urine treatment. Eschew white sugar as far as possible and utilize treacle instead. Give up white flour and its preparations. Do not utilize tinned food and fruits. Do not use polished rice and use hand-pounded rice as far as possible. Do not use pasteurized milk. 11. Do not use vegetable ghee. 12. Do not eat too sour, too pungent and too salty foods. i = I ~ ~ i I PART II REVIVAL OF URINE THERAPY (Summary of "Water of Life" by Armstrong ) U. T.-6 CHAPTER I MR. ARMSTRONG AND REVIVAL OF URINE THERAPY We do not know much about the life of ]. W. Armstrong who revived urine therapy. He was not for publicity. Urine therapy appeared to him very useful. He applied it first to himself and then cured thousands of patients thereby. He was not eager to publish his experiments, but on insistence of his friends, he prepared the book, Water of life which gives an account of extremely serious and complicated cases in a brief and clear style. In order to grasp his ideas the book should be read repeatedly and thoroughly. He has cured thousands of patients with urine therapy. The disease of leprosy is generally absent from England. Natural he did not get any chance to handle this disease but he has treated all types of other diseases with wonderful success. His parents came from an ordinary family. In his book, he has mentioned his father curing the ailments of cow, horse, dog and other animals with the application of their own urine. He took up this therapy, not as a profession but as a hobby. In india, we use a bamboo-pipe to give doses of urine by inserting it into the mouth of the animals but he did this with a horn. Armstrong has given, a vivid description of the treatment of brids and animals by narrating the experiences of his father.· The conditions in which an ordinary person like Armstrong initiated this therapy and the measure of his success give us an idea of his strong religious belief, moral courage, patience, equilibrium of mind, unshakable faith in Nature, absence of a desire for wealth and fame, altruistic bent of mind and other noble qualities. The sound common sense couched in his writing can be seen on every page of his book. He experimented on his own body and cured himself of tuberculosis of the third stage. A description of his experiments is given below in his own words: "Although I should prefer to avoid the first personal pronoun, it is not possible to do so in the circumstances if I am to carry 47 48 : AUTO~UR INE THERAPY conviction. For, as already implied, one ounce of experience outweighs a ton of arguments. "My first patient was myself. It happened in this way. During last ~ar,. at the age of thirty-four I presented myself for medical examination under what was called the Derby Schem d · d b e, an was reJecte. y four examining doctors on the grounds that I was consu~~tlve. Moreover, I was urged to put myself under the care of a ph:'sloan. Cons~q_u_ently, I consulted a specialist. He, however, cons1dered my cond1t1on as not serious he told ·, me 1t was more a catar_rh~l ca_se and advised plenty of fresh air, sunshine and nouns~mg diet. I follwed his advice and in one year put on two lb. of Weight. Nevertheless, not being satisfied with my condition 1 consulted another specialist who informed me that both m I . were affected and despite what the previous specialist ha/sa~~g~ was consumptive and must keep up my strength on a diet rich 'in sug_ars and starches. Fi~ally, diabetes set in and I was placed on an entirely new and drastic regime which consisted of fasting on six gla~ses of cold water (sipped) every day for four days of every week whd_st on t~e fifth and the two following days, was permitted a restncte~?let to whet my appetite, not to mention the fact that 1 was enJomed to chew every morsel of it to such a degree that it only produced a very so~~ mouth, aching teeth, swollen gums and sv:oll~n
[ 279, 8893, 1253, 720, 19553, 86075, 37392, 719, 568, 1288, 539, 387, 82140, 13, 1283, 720, 5562, 687, 72, 2957, 279, 57035, 323, 279, 37392, 690, 27115, 720, 2008, 3002, 13, 720, 17, 13, 720, 18, 13, 18156, 279, 41165, 8798, 315, 279, 2547, 4131, 704, 323, 720, 9181, 4251, 85448, 645, 449, 2579, 3585, 5101, 389, 279, 2547, 13, 578, 720, 327, 87728, 8798, 12302, 311, 2586, 704, 1193, 1306, 57035, 40335, 13, 1102, 374, 720, 1820, 1879, 315, 17808, 94536, 13, 393, 6802, 645, 5101, 304, 2047, 5940, 290, 720, 998, 279, 46835, 315, 8798, 304, 279, 2547, 13, 763, 1778, 264, 9955, 16, 83, 16, 263, 11, 720, 324, 483, 1253, 387, 67854, 389, 1124, 4056, 411, 1063, 11984, 481, 7410, 11, 779, 720, 9210, 85448, 645, 636, 1825, 323, 40335, 29933, 1139, 1124, 13, 4740, 459, 6596, 720, 269, 1403, 279, 8893, 1288, 1935, 9061, 449, 82380, 365, 2227, 3090, 13, 720, 96631, 11, 304, 912, 1162, 11, 1288, 387, 1511, 13, 720, 791, 8624, 374, 41976, 704, 1193, 994, 279, 41165, 21109, 374, 720, 40895, 15846, 13, 2684, 527, 2380, 43186, 315, 420, 21109, 43847, 2305, 720, 258, 279, 1376, 315, 22752, 16, 1303, 11, 1555, 72028, 304, 279, 1376, 315, 85448, 645, 720, 438, 8798, 61354, 1324, 11, 323, 1555, 279, 82408, 304, 279, 1376, 315, 720, 69, 70791, 90872, 13, 2052, 279, 2380, 25481, 527, 3284, 421, 72, 0, 68, 720, 8154, 9738, 420, 6514, 13, 578, 21109, 1253, 2586, 704, 14297, 220, 16, 77, 720, 1820, 1376, 315, 40700, 323, 9439, 13, 763, 430, 1162, 11, 63571, 1253, 539, 720, 3174, 220, 2983, 551, 36440, 12, 1539, 4069, 350, 3087, 2599, 56, 720, 511, 2407, 13, 35339, 11, 20784, 54245, 1253, 539, 12446, 304, 1162, 720, 40031, 7913, 62186, 527, 34373, 304, 3892, 19664, 54245, 13, 720, 644, 1162, 814, 527, 539, 38593, 704, 1555, 1063, 1778, 1648, 11, 1070, 720, 285, 1475, 13336, 315, 63571, 323, 20784, 54245, 2391, 279, 720, 19862, 315, 5043, 13, 2684, 374, 4400, 311, 387, 18290, 922, 1521, 720, 265, 4109, 13, 22037, 1288, 387, 5535, 311, 617, 1077, 1648, 26, 433, 374, 720, 2792, 3210, 24629, 311, 656, 779, 13, 763, 34781, 315, 29658, 98224, 11, 720, 2201, 16088, 477, 26127, 1288, 387, 4529, 311, 3009, 1521, 720, 265, 4109, 11, 1606, 430, 1053, 387, 9193, 28856, 13, 578, 720, 265, 4109, 690, 1207, 3002, 9651, 2391, 420, 6514, 13, 720, 3947, 374, 4400, 311, 387, 82140, 1524, 994, 1070, 527, 912, 720, 265, 4109, 4245, 311, 832, 596, 44797, 16812, 13, 720, 32148, 11, 1690, 9099, 35665, 5101, 3235, 449, 279, 1925, 720, 67, 56407, 13, 358, 12929, 1618, 264, 1162, 311, 38263, 279, 1486, 13, 4491, 13, 63262, 321, 278, 37617, 11, 720, 1820, 10388, 19496, 315, 62953, 8388, 613, 277, 320, 25797, 2106, 28447, 8, 574, 16066, 720, 1527, 59872, 13, 53123, 11, 568, 1047, 95159, 1439, 389, 279, 8579, 961, 315, 279, 82408, 720, 438, 439, 264, 1121, 11, 6784, 323, 20252, 37392, 1051, 99930, 13, 1283, 720, 417, 13909, 311, 420, 6514, 323, 3940, 6378, 449, 40335, 13, 1283, 1047, 459, 720, 543, 43043, 13, 578, 57035, 389, 4579, 19543, 304, 85448, 645, 389, 279, 3663, 13, 1283, 574, 720, 8093, 2106, 323, 8122, 764, 20262, 757, 13, 358, 26160, 1461, 311, 3009, 279, 57035, 323, 720, 9726, 1377, 287, 10789, 40335, 11157, 477, 8983, 560, 6, 264, 1938, 13, 578, 85448, 645, 720, 4338, 99567, 304, 264, 2046, 719, 279, 60754, 8738, 13, 1115, 374, 264, 8624, 720, 936, 2656, 555, 738, 49686, 902, 1101, 1436, 387, 2751, 9463, 315, 13, 358, 26160, 1461, 720, 998, 3136, 279, 16558, 315, 40335, 323, 568, 8272, 856, 11470, 13, 720, 1128, 39742, 11, 279, 62186, 41165, 304, 813, 1887, 1051, 720, 40895, 15846, 13, 5414, 15631, 2053, 1051, 23803, 323, 568, 10534, 264, 3177, 720, 2664, 13, 2468, 279, 1890, 892, 11, 279, 60754, 1101, 29496, 13, 720, 2059, 462, 73191, 278, 65, 26279, 11, 279, 47302, 315, 29937, 11151, 587, 939, 587, 29210, 304, 279, 735, 90880, 720, 36491, 2751, 86075, 389, 279, 19689, 323, 433, 6244, 2579, 13, 1283, 6137, 279, 720, 324, 483, 6514, 13, 1283, 1047, 86075, 389, 279, 4459, 2547, 3235, 449, 30883, 720, 543, 43043, 13, 763, 5369, 11, 568, 1047, 20335, 1101, 13, 1283, 1550, 539, 2512, 369, 682, 720, 45010, 35665, 323, 6137, 279, 6514, 2085, 4737, 11470, 13, 720, 1548, 574, 53184, 311, 4737, 11347, 1799, 483, 304, 15600, 323, 568, 8738, 279, 720, 25030, 2391, 279, 40335, 6514, 323, 8774, 912, 2585, 927, 813, 10173, 13, 763, 423, 93468, 482, 50, 18227, 50, 3651, 9362, 29717, 50, 551, 220, 3391, 720, 28956, 2919, 11, 813, 4459, 2547, 6244, 57596, 304, 5369, 311, 6520, 93, 287, 720, 79, 6802, 645, 13, 763, 420, 3044, 11, 568, 16369, 757, 505, 426, 1105, 93, 67, 1210, 358, 4056, 38361, 16, 32424, 720, 40617, 311, 617, 30401, 323, 539, 311, 1935, 904, 16088, 297, 93, 220, 16, 77, 41, 440, 605, 93, 13, 1283, 720, 16514, 4726, 26160, 311, 10485, 40335, 449, 7410, 13, 1283, 294, 16, 67, 14902, 12591, 398, 720, 438, 568, 2751, 16337, 304, 1403, 2919, 3582, 1306, 16066, 264, 2886, 93, 83, 294, 93, 278, 13, 720, 52, 40101, 374, 264, 5933, 6485, 11742, 20278, 323, 11347, 5776, 818, 3507, 264, 720, 32056, 24549, 662, 2360, 5105, 76730, 374, 3284, 1990, 1778, 720, 7129, 1870, 71240, 33155, 662, 720, 791, 3485, 1403, 3187, 527, 14343, 311, 28930, 279, 6978, 720, 329, 79, 11780, 279, 40335, 15419, 13, 720, 16, 13, 720, 17, 13, 720, 18, 13, 720, 19, 13, 720, 20, 13, 720, 21, 13, 720, 22, 13, 720, 23, 13, 720, 24, 13, 720, 16, 220, 15, 13, 44921, 5075, 936, 332, 822, 12548, 551, 720, 2810, 553, 40335, 1193, 74647, 439, 6982, 304, 279, 88931, 720, 331, 17881, 13, 720, 5519, 539, 1005, 904, 16088, 2391, 40335, 6514, 13, 720, 5519, 539, 636, 82140, 555, 279, 25481, 1093, 63571, 11, 20784, 720, 76, 41356, 11, 5099, 2637, 2391, 40335, 6514, 13, 720, 3563, 40335, 6514, 1193, 1306, 7231, 709, 26870, 1093, 20149, 11, 720, 9810, 1386, 287, 11, 13378, 19158, 16113, 323, 520, 3325, 1521, 26870, 2011, 387, 1664, 720, 59707, 13, 720, 36227, 709, 1005, 315, 9955, 12843, 520, 514, 93, 267, 2391, 279, 40335, 6514, 13, 720, 17812, 331, 365, 4251, 13465, 439, 3117, 439, 3284, 323, 29166, 4353, 8061, 720, 65937, 13, 720, 36227, 709, 4251, 20415, 323, 1202, 47979, 13, 720, 5519, 539, 29166, 259, 21203, 3691, 323, 26390, 13, 720, 5519, 539, 1005, 44461, 20228, 323, 1005, 1450, 2320, 13382, 20228, 439, 3117, 439, 720, 10236, 13, 720, 5519, 539, 1005, 3347, 12844, 1534, 14403, 13, 720, 806, 662, 3234, 539, 1005, 36581, 342, 50153, 13, 720, 717, 13, 3234, 539, 8343, 2288, 20897, 11, 2288, 281, 2234, 306, 323, 2288, 74975, 15657, 13, 602, 720, 28, 358, 720, 93, 720, 93, 602, 358, 6909, 8105, 720, 73587, 91593, 720, 12766, 720, 1539, 4069, 350, 3087, 2599, 56, 720, 3844, 372, 1563, 315, 330, 29353, 315, 9601, 1, 555, 45966, 883, 720, 52, 13, 350, 12898, 21, 96424, 358, 720, 18953, 13, 31586, 6805, 7691, 3651, 66923, 91593, 3083, 35514, 4069, 350, 3087, 2599, 56, 720, 1687, 656, 539, 1440, 1790, 922, 279, 2324, 315, 21087, 468, 13, 45966, 889, 720, 7430, 2270, 40335, 15419, 13, 1283, 574, 539, 369, 43763, 13, 17229, 483, 15419, 720, 99567, 311, 1461, 1633, 5505, 13, 1283, 9435, 433, 1176, 311, 5678, 323, 1243, 720, 66, 3149, 9214, 315, 6978, 28592, 13, 1283, 574, 539, 24450, 311, 3498, 813, 720, 327, 50732, 11, 719, 389, 79397, 315, 813, 4885, 11, 568, 10235, 279, 720, 2239, 11, 10164, 315, 2324, 902, 6835, 459, 2759, 315, 9193, 6129, 323, 720, 5807, 14040, 5157, 304, 264, 10015, 323, 2867, 1742, 13, 763, 2015, 311, 34477, 813, 720, 94784, 279, 2363, 1288, 387, 1373, 19352, 323, 27461, 13, 1283, 706, 720, 66, 3149, 9214, 315, 6978, 449, 40335, 15419, 13, 578, 8624, 315, 720, 273, 782, 23707, 374, 8965, 28310, 505, 9635, 13, 18955, 568, 1550, 539, 636, 720, 3852, 6140, 311, 3790, 420, 8624, 719, 568, 706, 12020, 682, 4595, 315, 720, 1605, 19338, 449, 11364, 2450, 13, 5414, 6699, 3782, 505, 459, 720, 21707, 3070, 13, 763, 813, 2363, 11, 568, 706, 9932, 813, 7126, 97330, 279, 720, 607, 1392, 315, 19923, 11, 15580, 11, 5679, 323, 1023, 10099, 449, 279, 3851, 720, 1073, 872, 1866, 40335, 13, 1283, 3952, 709, 420, 15419, 11, 539, 439, 264, 4913, 719, 720, 300, 264, 32628, 13, 763, 28811, 11, 584, 1005, 264, 59982, 2320, 3527, 311, 3041, 35130, 315, 40335, 720, 1729, 39398, 433, 1139, 279, 11013, 315, 279, 10099, 719, 568, 1550, 420, 449, 264, 720, 51984, 13, 45966, 706, 2728, 11, 264, 43120, 4096, 315, 279, 6514, 315, 720, 84688, 323, 10099, 555, 13713, 1113, 279, 11704, 315, 813, 7126, 13, 14260, 578, 720, 16902, 304, 902, 459, 19664, 1732, 1093, 45966, 33230, 420, 720, 46755, 323, 279, 6767, 315, 813, 2450, 3041, 603, 459, 4623, 315, 813, 3831, 720, 97250, 16801, 11, 16033, 25775, 11, 30401, 11, 56411, 315, 4059, 11, 720, 359, 939, 587, 481, 10082, 304, 22037, 11, 19821, 315, 264, 12876, 369, 12205, 323, 33651, 11, 720, 278, 66353, 4633, 30280, 315, 4059, 323, 1023, 35482, 29600, 13, 578, 5222, 4279, 720, 98935, 4020, 2454, 304, 813, 4477, 649, 387, 3970, 389, 1475, 2199, 315, 813, 2363, 13, 720, 1548, 98504, 389, 813, 1866, 2547, 323, 64688, 5678, 315, 720, 83, 392, 74554, 315, 279, 4948, 6566, 13, 362, 4096, 315, 813, 21896, 374, 720, 43068, 3770, 304, 813, 1866, 4339, 25, 720, 1, 16179, 358, 1288, 10932, 311, 5766, 279, 1176, 4443, 19126, 1656, 11, 433, 374, 720, 1962, 3284, 311, 656, 779, 304, 279, 13463, 422, 358, 1097, 311, 6920, 720, 2618, 220, 2166, 551, 36440, 93, 1539, 2006, 36, 350, 3087, 2599, 56, 720, 12296, 2538, 13, 1789, 11, 439, 2736, 6259, 11, 832, 54808, 315, 3217, 720, 412, 57740, 82, 264, 8941, 315, 6105, 13, 720, 46240, 1176, 8893, 574, 7182, 13, 1102, 7077, 304, 420, 1648, 13, 12220, 720, 4354, 4056, 277, 17974, 520, 279, 4325, 315, 27219, 42117, 358, 10666, 7182, 369, 6593, 720, 327, 27935, 1234, 1148, 574, 2663, 279, 46873, 328, 2464, 294, 9787, 294, 293, 384, 11, 459, 574, 720, 265, 41, 440, 68, 662, 379, 3116, 38936, 16410, 389, 279, 21319, 430, 358, 574, 720, 6387, 84, 5940, 11805, 588, 13, 23674, 11, 358, 574, 28932, 311, 2231, 7182, 1234, 279, 2512, 315, 720, 64, 1343, 4989, 82, 39429, 13, 7440, 93, 80, 7448, 62, 4501, 11, 358, 61302, 264, 24687, 13, 1283, 11, 4869, 11, 720, 6387, 16, 1126, 291, 856, 9955, 16, 83, 16, 263, 439, 539, 6129, 568, 3309, 9787, 1174, 757, 220, 16, 83, 574, 810, 264, 720, 4719, 277, 1745, 71, 93, 75, 2211, 3537, 323, 26160, 11510, 315, 7878, 3805, 11, 52495, 323, 720, 77, 60086, 93, 12591, 10173, 13, 358, 52506, 68467, 813, 9650, 323, 304, 832, 1060, 2231, 389, 1403, 19398, 13, 720, 1073, 16923, 13, 35053, 11, 539, 1694, 20097, 449, 856, 3044, 220, 16, 720, 49512, 291, 2500, 24687, 889, 16369, 757, 430, 2225, 296, 358, 720, 13, 1051, 11754, 323, 8994, 1148, 279, 3766, 24687, 6520, 2754, 64, 5940, 70, 93, 720, 16514, 4766, 54835, 323, 2011, 2567, 709, 856, 8333, 389, 264, 10173, 9257, 364, 258, 720, 82, 773, 62, 1590, 323, 70181, 288, 13, 40971, 93, 750, 11, 20335, 743, 304, 323, 358, 574, 9277, 389, 459, 720, 306, 556, 398, 502, 323, 60883, 17942, 902, 44660, 315, 54560, 389, 4848, 720, 70, 4355, 93, 9459, 315, 9439, 3090, 320, 82, 6586, 8, 1475, 1938, 369, 3116, 2919, 315, 1475, 2046, 720, 1336, 67, 1284, 389, 259, 93, 68, 18172, 323, 279, 1403, 2768, 2919, 11, 574, 15480, 264, 720, 4014, 77, 302, 68, 93, 949, 1169, 311, 421, 295, 856, 38575, 11, 539, 311, 6420, 279, 2144, 430, 220, 16, 720, 16514, 665, 41, 25111, 311, 37433, 1475, 296, 1105, 301, 315, 433, 311, 1778, 264, 8547, 430, 433, 720, 3323, 9124, 264, 1633, 779, 5940, 11013, 11, 264, 28075, 18311, 11, 76193, 98754, 323, 720, 3576, 25, 980, 93, 77 ]
0xBreath/holistic-books
 those who challenge  this  statement  taste  the Iceni Produce,  grown  from soil treated on the  principle that all that comes from the soil should be put back into the  soil, and they  will soon  be convinced  that the principle is a correct one.  The idea that Nature  is wasteful is erroneous.  She only appears  wasteful  to us because we do not understand  her. The rotting dead  leaves provide the most  valuable mineral  salts  for the soil‐one of the  most  essential  being potash.  Even the ashes of burnt dead leaves and  burnt  wood (charcoal)  are of great value. Therefore  why should a  principle which  applies  throughout  Nature not apply (with  certain  reservations)  to the human  body? This question  is the more readily  answered  if we consider the constituents  of urine.   Yet before doing so, something  should be said about the unreliability  of  urine analysis as a means of diagnosis.  Though urine‐analysis  is still a  practice among orthodox doctors, it has been found that the elements  in and  general condition  of urine depend  far more  on the character  of  the food and  drink taken by the,  patient than on any fancied  or real  disease condition.  Even the presence of sugar  can no longer be  regarded as an infallible sign of diabetes. This I have proved to my own  satisfaction  by taking for a day nothing but drinks made of chemical 17   sweet powders,  and nothing in the way of  food except a quantity of  heavily sweetened  ices. On such a diet, after twelve to fourteen hours  the urine of an otherwise  healthy person became  charged with sugar  and  suggested  to the doctor that he had  diabetes!  Similar mistakes  have been made with regard to albumen  found in the urine as the  result of an ill‐balanced diet. Some years ago a friend of the writer's  connected  with a Life Insurance  Company  had a number  of "prospects"   turned down owing to heavy deposits of albumen in their urine. Finally  he brought three  of these men along for By dint  of altering their diet, all  the investigation  supposed ‐to‐be indications  of Bright's disease,  nephritis or albuminuria  from which  they  were alleged  to be suffering  very soon vanished,  and at. a subsequent  examination  by the Insurance  doctor they  were  told they  must  have had  "local inflammations"  when  previously  examined  ! Further  comment  seems superfluous.      Urea N. (nitrogen)    Urea   Creatinine  N.   Creatinine    Uric acid  N.   Uric acid   Amino N.   Ammonia  N.  18   Sodium   Potassium    Calcium   Magnesium   Chloride   Total  sulphate   Inorganic  sulphate   682 1459 36 97.2 12.3  36.9 9.7 57 212 1 37 19.5  11.3  314 91 83  Inorganic  phosphate    pH   Total  acidity as C.C.   N/10  acid  127   6.4   27.8  Dr. G. S. Cotton, of Temple, Texas, writes me that urine also  contains "  Allontain " (c4H6.03.N.4).  No mention of the valuable hormones  to  which  Prof. Jean Rostand refers is made in the above.  This is significant  as showing the amount of valuable mineral salts  contained  in healthy urine; to appreciate  which, one needs to have  studied The Biochemic  System of Medicine.  Even so, as already implied,  there  are wide variations  in urinary composition  according  to the foods  and drinks  consumed.  For instance, taking fifty normal subjects, we find  that whereas with the average. Urea N. amounts  to 682, the maximum  19   amounts  to 1829, whilst  the minimum  is 298.  As to the volume of urine  passed, it varies greatly according  to diet and  season of the year. Also,  urine passed  at night  is about one  quarter to one half  of that passed  during daytime.   In view of the above  analysis, we may well  ask ourselves  the question  :  If the elements  which  urine reveals are not required by the body, then  why do our food chemists and  biochemists  emphasise  their value and  declare  them to be essential  to the body upkeep?  The idea that urine  contains poisonous  elements  which  the body is  endeavouring  to eliminate  is based upon theory  only, and  is not  demonstrated  by the facts. As survivors in open boats  and  rafts often  drink  their own urine when their water supply becomes deficient,   surely if they were drinking a poisonous  fluid they  would die or become  very ill? Far from this being the case,  the practice of drinking urine is  pronounced  to be harmless,  but  (as the Medical Department  of the  Navy pointed out in a letter to an inquirer) "the benefit obtained  is not  as great as would appear at first sight  because in dehydration  the  output of urine falls to a very low level…" I shall comment  on this later.  Meanwhile,  I may  remark that what may  be a "poison" when separated   from its natural environment  may not act as a poison when The  Medical remaining  in its natural  environment.  Profession  may  have  been impressed  when, at the beginning  of the century,  Charrin  wrote  a  whole book on the "poisons " of urine, but  as Prof. Jean Rostand  (already quoted) has since written: " The time is not far off when it will  be 
[ 4194, 54719, 4194, 14965, 4194, 58465, 220, 4194, 576, 52050, 25159, 220, 108135, 5642, 4194, 279, 4194, 40, 66, 34229, 4194, 1360, 13677, 11, 4194, 15042, 4194, 505, 4194, 708, 321, 108135, 2920, 4194, 263, 4194, 1820, 52050, 652, 16379, 4194, 9210, 4194, 543, 4194, 9210, 4194, 6716, 4194, 1527, 4194, 1820, 4194, 708, 321, 4194, 5562, 4194, 1395, 4194, 631, 4194, 1445, 4194, 18614, 4194, 1820, 52050, 708, 321, 11, 4194, 438, 4194, 20670, 4194, 690, 4194, 67156, 4194, 387, 4194, 444, 9799, 2041, 220, 4194, 9210, 4194, 1820, 4194, 652, 16379, 4194, 285, 4194, 64, 4194, 20523, 4194, 606, 13, 52050, 791, 4194, 42877, 4194, 9210, 4194, 79519, 4194, 374, 4194, 86, 561, 52221, 4194, 285, 4194, 618, 606, 788, 13, 4194, 3005, 4194, 3323, 4194, 34531, 1590, 52050, 86, 561, 52221, 4194, 311, 4194, 355, 4194, 28753, 4194, 906, 4194, 3055, 4194, 1962, 4194, 8154, 2752, 220, 4194, 1964, 13, 4194, 791, 4194, 4744, 1303, 4194, 34854, 52050, 273, 4798, 4194, 62556, 4194, 1820, 4194, 3646, 4194, 15525, 4194, 1083, 3333, 4194, 78235, 4194, 369, 4194, 1820, 4194, 708, 321, 31021, 606, 4194, 1073, 4194, 1820, 52050, 3646, 4194, 7718, 4194, 1694, 4194, 19644, 1003, 13, 4194, 7570, 4194, 1820, 4194, 14380, 4194, 1073, 4194, 22464, 83, 4194, 34854, 4194, 273, 4798, 4194, 438, 52050, 22464, 83, 4194, 7732, 4194, 7078, 41565, 8, 220, 4194, 548, 4194, 1073, 4194, 47991, 4194, 970, 13, 4194, 55915, 220, 4194, 35734, 4194, 5562, 4194, 64, 52050, 652, 16379, 4194, 8370, 4194, 17208, 4194, 6957, 4194, 22037, 4194, 1962, 4194, 10492, 4194, 17411, 4194, 3738, 52050, 417, 46921, 8, 4194, 311, 4194, 1820, 4194, 26380, 4194, 2547, 30, 4194, 2028, 4194, 7998, 4194, 374, 4194, 1820, 4194, 6518, 4194, 888, 1570, 52050, 57824, 220, 4194, 333, 4194, 906, 4194, 25742, 4194, 1820, 4194, 1040, 33462, 812, 220, 4194, 1073, 4194, 324, 483, 13, 122019, 29174, 4194, 15145, 4194, 45359, 4194, 708, 11, 4194, 34431, 220, 4194, 5562, 4194, 1395, 4194, 84359, 4194, 9274, 4194, 1820, 4194, 359, 265, 747, 2968, 220, 4194, 1073, 52050, 324, 483, 4194, 35584, 4194, 300, 4194, 64, 4194, 47321, 4194, 1073, 4194, 8747, 50915, 13, 220, 4194, 27831, 4194, 324, 483, 31021, 35584, 4194, 374, 4194, 44466, 4194, 64, 52050, 60621, 4194, 77405, 4194, 2419, 31162, 4194, 3055, 12816, 11, 4194, 275, 4194, 4752, 4194, 82850, 4194, 15456, 4194, 9210, 4194, 1820, 4194, 22138, 52050, 258, 4194, 438, 4194, 4689, 4194, 9233, 220, 4194, 1073, 4194, 324, 483, 4194, 20080, 4194, 3117, 4194, 6518, 4194, 389, 4194, 1820, 4194, 19740, 220, 4194, 1073, 52050, 1820, 4194, 14239, 4194, 438, 4194, 7172, 4194, 83261, 4194, 1729, 4194, 1820, 11, 4194, 8893, 4194, 54895, 4194, 263, 4194, 3852, 4194, 69, 1149, 1142, 4194, 477, 4194, 8110, 52050, 67, 56407, 4194, 9233, 13, 220, 4194, 13461, 4194, 1820, 4194, 74519, 4194, 1073, 109403, 8734, 4194, 649, 4194, 2201, 4194, 4930, 261, 4194, 1395, 52050, 1610, 21632, 4194, 300, 4194, 276, 115235, 13772, 1260, 4194, 7908, 4194, 1073, 4194, 8747, 16629, 13, 4194, 2028, 4194, 40, 4194, 19553, 4194, 96608, 4194, 998, 4194, 2465, 4194, 785, 52050, 82, 52370, 220, 4194, 1729, 4194, 89894, 4194, 2000, 4194, 64, 4194, 1316, 4194, 42312, 4194, 8248, 4194, 3696, 15872, 4194, 28010, 4194, 1073, 4194, 32056, 4194, 1114, 52050, 4194, 95928, 4194, 22491, 12601, 11, 220, 4194, 438, 4194, 42312, 115235, 4194, 1820, 4194, 3195, 4194, 1073, 4194, 4194, 14239, 4194, 11945, 4194, 64, 4194, 13832, 4194, 1073, 52050, 383, 402, 1570, 4194, 95928, 6901, 220, 4194, 1238, 13, 4194, 1966, 4194, 21470, 4194, 64, 4194, 94942, 11, 4194, 10924, 4194, 15930, 21903, 4194, 998, 4194, 35124, 15247, 4194, 31482, 52050, 1820, 4194, 324, 483, 4194, 1073, 4194, 276, 4194, 61036, 220, 4194, 38128, 4194, 9164, 4194, 17106, 373, 4194, 11684, 4194, 4291, 109403, 8734, 52050, 438, 4194, 12090, 220, 4194, 998, 4194, 1820, 4194, 38083, 4194, 9210, 4194, 383, 4194, 32345, 4194, 20335, 0, 220, 4194, 35502, 4194, 80024, 2094, 52050, 19553, 4194, 82850, 4194, 28010, 4194, 4291, 4194, 1610, 569, 4194, 998, 4194, 21687, 268, 4194, 1766, 115235, 4194, 1820, 4194, 324, 483, 4194, 300, 4194, 1820, 52050, 1407, 4194, 1073, 4194, 276, 4194, 484, 31021, 59502, 4194, 94942, 13, 4194, 8538, 4194, 42820, 4194, 6438, 4194, 64, 4194, 10931, 4194, 1073, 4194, 1820, 4194, 18688, 596, 52050, 15647, 220, 4194, 4291, 4194, 64, 4194, 26833, 4194, 79854, 4194, 8351, 220, 4194, 32345, 4194, 64, 4194, 4174, 4194, 315, 4194, 1, 782, 82, 8132, 1, 106050, 42286, 4194, 2996, 4194, 24060, 4194, 998, 4194, 89945, 4194, 451, 981, 1220, 4194, 1073, 4194, 21687, 268, 115235, 4194, 50828, 4194, 324, 483, 13, 4194, 24901, 52050, 383, 115648, 6478, 4194, 28956, 4194, 315, 4194, 45010, 4194, 5794, 4194, 39393, 4194, 2000, 4194, 1383, 108839, 396, 4194, 315, 4194, 38377, 287, 4194, 50828, 4194, 94942, 11, 4194, 543, 52050, 1820, 4194, 43114, 18413, 4194, 10171, 113287, 998, 31021, 1395, 4194, 86184, 811, 220, 4194, 1073, 4194, 75776, 596, 108839, 56407, 11, 52050, 77, 24453, 38090, 4194, 269, 4194, 21687, 258, 75884, 220, 4194, 1527, 4194, 8370, 4194, 814, 4194, 1051, 4194, 278, 1978, 291, 4194, 311, 4194, 1395, 109403, 2084, 287, 52050, 1225, 4194, 67156, 4194, 88857, 11, 220, 4194, 438, 4194, 266, 13, 4194, 64, 4194, 2008, 72457, 4194, 24481, 220, 4194, 1729, 4194, 1820, 4194, 79854, 52050, 38083, 4194, 20670, 4194, 1051, 4194, 3309, 4194, 20670, 4194, 2011, 4194, 617, 4194, 32345, 4194, 330, 2497, 115235, 45864, 811, 1, 220, 4194, 9493, 52050, 1762, 18785, 220, 4194, 42716, 1619, 220, 4194, 0, 4194, 31428, 4194, 4068, 220, 4194, 325, 12116, 4194, 9712, 1517, 9373, 13, 17529, 52050, 52050, 52, 5325, 118420, 13, 4194, 1471, 275, 26252, 8, 17529, 52050, 52, 5325, 122019, 31844, 83334, 220, 118420, 13, 122019, 31844, 83334, 17529, 52050, 52, 2265, 4194, 58156, 4194, 452, 13, 122019, 52, 2265, 4194, 58156, 122019, 32, 32924, 118420, 13, 122019, 6219, 1677, 689, 220, 118420, 13, 4194, 4194, 972, 52050, 109269, 47876, 122019, 45716, 49163, 17529, 52050, 48268, 2411, 122019, 88755, 41930, 122019, 1163, 9761, 579, 122019, 7749, 4194, 83778, 349, 122019, 644, 61694, 220, 109403, 360, 764, 349, 122019, 25178, 4194, 9591, 24, 4194, 1927, 4194, 3534, 13, 17, 4194, 717, 13, 18, 4194, 220, 1927, 13, 24, 4194, 24, 13, 22, 4194, 3226, 4194, 11227, 4194, 16, 4194, 1806, 4194, 777, 13, 20, 4194, 220, 806, 13, 18, 4194, 220, 16104, 4194, 5925, 4194, 6069, 52050, 644, 61694, 220, 4194, 764, 93473, 17529, 52050, 79, 39, 122019, 7749, 4194, 98026, 4194, 300, 116545, 732, 13, 122019, 45, 14, 605, 4194, 13935, 52050, 6804, 9421, 4194, 21, 13, 19, 9421, 4194, 1544, 13, 23, 52050, 9023, 13, 121890, 13, 109269, 13, 116545, 17307, 11, 4194, 1073, 4194, 22759, 698, 11, 4194, 51325, 11, 4194, 60179, 4194, 2727, 4194, 9210, 4194, 324, 483, 4194, 19171, 4194, 5727, 4194, 1, 52050, 2460, 546, 467, 4194, 1, 4194, 1361, 19, 39, 21, 13, 2839, 2112, 13, 19, 570, 220, 4194, 2822, 4194, 30348, 4194, 1073, 4194, 1820, 4194, 838, 13429, 116781, 494, 3233, 220, 4194, 998, 52050, 8370, 4194, 8626, 13, 4194, 69009, 117331, 537, 438, 4194, 1116, 388, 4194, 285, 4194, 28010, 115235, 4194, 1820, 4194, 49532, 13, 52050, 2028, 4194, 285, 4194, 91645, 220, 4194, 300, 4194, 3528, 287, 4194, 1820, 4194, 6173, 4194, 1073, 4194, 838, 13429, 4194, 1083, 3333, 4194, 19776, 2641, 52050, 53615, 220, 115235, 4194, 38128, 4194, 324, 483, 26, 4194, 998, 4194, 680, 2827, 6629, 220, 4194, 8370, 11, 4194, 606, 4194, 56345, 4194, 998, 4194, 19553, 52050, 76443, 1142, 4194, 791, 4194, 60360, 2464, 292, 220, 4194, 2374, 4194, 1073, 4194, 13613, 55103, 13, 4194, 7570, 4194, 708, 11, 4194, 300, 4194, 46584, 4194, 318, 3523, 11, 52050, 19041, 4194, 527, 4194, 9328, 4194, 959, 17583, 220, 115235, 4194, 324, 3367, 4194, 77907, 220, 4194, 74946, 220, 4194, 998, 4194, 1820, 4194, 96420, 52050, 438, 4194, 3696, 15872, 4194, 27073, 13, 220, 4194, 2520, 4194, 4956, 11, 4194, 89894, 4194, 69, 39724, 4194, 8416, 4194, 65882, 11, 4194, 906, 4194, 3990, 52050, 9210, 4194, 2940, 300, 4194, 4291, 4194, 1820, 4194, 17645, 13, 4194, 52, 5325, 118420, 13, 4194, 6173, 82, 4194, 311, 4194, 25178, 11, 4194, 1820, 4194, 40287, 220, 4194, 777, 52050, 4194, 6173, 82, 4194, 311, 4194, 10828, 24, 11, 4194, 1336, 19839, 4194, 279, 4194, 39088, 220, 4194, 285, 4194, 17690, 13, 4194, 1666, 4194, 998, 4194, 1820, 4194, 26116, 4194, 1073, 4194, 324, 483, 52050, 36522, 11, 4194, 275, 4194, 959, 552, 4194, 47991, 398, 4194, 74946, 220, 4194, 998, 4194, 94942, 4194, 438, 4194, 3280, 4194, 1073, 4194, 1820, 4194, 3236, 13, 4194, 13699, 11, 52050, 324, 483, 4194, 36522, 4194, 520, 4194, 9471, 4194, 374, 4194, 9274, 4194, 606, 4194, 8502, 4194, 998, 4194, 606, 4194, 38106, 4194, 315, 4194, 9210, 4194, 36522, 52050, 82977, 4194, 1316, 1712, 13, 122019, 644, 4194, 1068, 4194, 1073, 4194, 1820, 4194, 49532, 4194, 6492, 11, 4194, 906, 4194, 18864, 4194, 9336, 4194, 2610, 4194, 2530, 4372, 220, 4194, 1820, 4194, 7998, 4194, 551, 52050, 2746, 4194, 1820, 4194, 22138, 4194, 902, 4194, 40335, 4194, 92076, 1147, 4194, 548, 4194, 1962, 4194, 6413, 4194, 1729, 4194, 1820, 4194, 2664, 11, 4194, 3473, 52050, 35734, 4194, 3055, 4194, 414, 4194, 14239, 4194, 2464, 1705, 4194, 438, 4194, 17332, 2464, 1705, 220, 4194, 336, 51480, 1082, 220, 4194, 50828, 4194, 970, 4194, 438, 52050, 18978, 4194, 1124, 4194, 998, 4194, 1395, 4194, 49582, 4194, 311, 4194, 1820, 4194, 2664, 4194, 455, 13397, 30, 52050, 791, 4194, 42877, 4194, 9210, 4194, 324, 483, 4194, 5727, 4194, 5481, 3416, 788, 220, 4194, 22138, 4194, 902, 4194, 279, 4194, 2664, 4194, 285, 52050, 11178, 27089, 287, 220, 4194, 998, 4194, 40895, 3357, 220, 4194, 285, 4194, 31039, 4194, 59723, 4194, 94304, 4194, 1193, 11, 4194, 438, 4194, 374, 4194, 1962, 52050, 67, 7439, 496, 660, 220, 4194, 1729, 4194, 1820, 4194, 69153, 13, 4194, 2170, 4194, 20370, 85, 86493, 115235, 4194, 2569, 4194, 95458, 4194, 323, 4194, 15473, 45544, 4194, 61917, 52050, 98427, 4194, 872, 4194, 785, 4194, 324, 483, 4194, 9493, 4194, 50828, 4194, 13284, 4194, 95783, 4194, 17106, 20969, 4194, 755, 5499, 11, 106050, 19643, 398, 4194, 333, 4194, 20670, 4194, 52898, 4194, 3696, 16113, 4194, 64, 4194, 5481, 3416, 788, 220, 4194, 67125, 4194, 20670, 4194, 1053, 4194, 27591, 4194, 269, 4194, 17106, 638, 52050, 1225, 4194, 484, 30, 4194, 33987, 4194, 1527, 4194, 576, 4194, 35214, 4194, 1820, 4194, 5756, 11, 4194, 279, 4194, 60621, 4194, 1073, 4194, 3696, 16113, 4194, 324, 483, 4194, 285, 52050, 72239, 20018, 4194, 311, 4194, 1395, 116781, 2227, 1752, 11, 220, 4194, 8248, 4194, 320, 300, 4194, 1820, 4194, 53654, 4194, 27725, 220, 4194, 1073, 4194, 1820, 52050, 45, 5781, 4194, 2837, 291, 4194, 412, 115235, 4194, 64, 4194, 9638, 4194, 998, 4194, 276, 115235, 51892, 8, 4194, 1, 1820, 4194, 68244, 275, 124531, 83, 2692, 4194, 374, 4194, 1962, 52050, 300, 4194, 47991, 4194, 300, 4194, 41450, 4194, 41866, 4194, 266, 4194, 3983, 109403, 492, 4194, 1606, 115235, 4194, 80660, 50791, 220, 4194, 1820, 52050, 3081, 4194, 1073, 4194, 324, 483, 4194, 33695, 4194, 998, 4194, 64, 4194, 1225, 4194, 10516, 4194, 3374, 56209, 4194, 40, 4194, 19549, 4194, 6313, 220, 4194, 263, 4194, 576, 4194, 68676, 13, 52050, 26054, 11, 220, 4194, 40, 4194, 18864, 4194, 14162, 4194, 9210, 4194, 12840, 4194, 18864, 4194, 387, 4194, 64, 4194, 1, 5481, 3416, 1, 4194, 9493, 4194, 325, 50700, 106050, 1527, 4194, 1220, 4194, 53980, 4194, 24175, 220, 4194, 18864, 4194, 1962, 4194, 533, 4194, 300, 4194, 64, 4194, 5481, 3416, 4194, 9493, 4194, 791, 52050, 53654, 4194, 44536, 220, 115235, 4194, 1220, 4194, 53980, 4194, 4676, 13, 220, 4194, 19105, 1362, 220, 4194, 18864, 4194, 617, 52050, 82850, 4194, 318, 14655, 4194, 994, 11, 4194, 266, 4194, 1820, 4194, 7413, 1251, 220, 4194, 1073, 4194, 1820, 4194, 1189, 3431, 11, 4194, 921, 1138, 258, 4194, 6267, 4194, 264, 52050, 67733, 4194, 2239, 4194, 263, 4194, 1820, 4194, 1, 5481, 19941, 4194, 1, 4194, 1073, 4194, 324, 483, 11, 4194, 8248, 4194, 439, 4194, 19105, 13, 4194, 69009, 117331, 537, 438, 52050, 18109, 2359, 4194, 64825, 8, 4194, 4752, 4194, 11536, 4194, 26650, 25, 4194, 1, 4194, 791, 4194, 1712, 4194, 285, 4194, 1962, 4194, 24470, 4194, 1885, 4194, 9493, 4194, 275, 4194, 14724, 52050, 1395, 4194 ]
0xBreath/holistic-books
withdrawal from a fast) ............................................. 363 13.7. How to prepare Bolotov’s whey (serum) .... 369 13.8. What are the potential complications during withdrawal from fasting? .......................................... 371 14. What’s the ideal scheme for conducting a dry fractional fast at home? .......................................... 379 15. How many kinds of dry fasting exist? ............ 384 15.1. Interesting facts: Secrets of Japanese monks ...................................................................................... 392 15.2. Interesting facts: Dry fasting and dousing with cold water ........................................................... 399 16. How should you conduct a long dry fast? ...... 401 17. Dry fractional fasting. Who do we recommend it to?............................................................................ 473 18. How to come out of a 9 -day dry fasting course? ................................................................................. 480 A nutritional program for coming out of a fast .. 495 19. What diseases can be cured through dry fasting? ................................................................................. 499 19.1. Dry fasting for acute diseases. ...................... 499 19.1.1. Fasting for acute infections (acute respiratory diseases, influenza) ........................... 502 19.1.2. Dry fasting for the relapse of gastric ulcer or duodenal ulcer, chronic pancreatitis, cholecystitis, colitis, etc. ....................................... 516 19.1.3. Dry fasting for diabetes ......................... 521 19.2. Dry Fasting for chronic diseases .................. 524 19.2.1. Dry Fasting for endointoxication and atherosclerosis............................................................ 529 19.2.2. Dry Fasting for hypertension .................... 532 19.2.3. Why dry fasting helps fight chronic diseases ...................................................................................... 539 19.2.4. Dry fasting for cystic tumors in the body 543 19.2.5. Dry Fasting for Infertility .......................... 546 19.2.6. Toxemia in Pregnant Women .................. 551 19.2.7. Endometriosis ............................................. 558 19.2.8. Dry Fasting for Benign Tumors ................ 561 19.2.9. Mastopathy .................................................. 566 19.2.10. Prostatitis and benign prostatic hyperplasia ...................................................................................... 568 19.2.11. Dry Fasting for Bronchopulmonary Diseases....................................................................... 573 19.2.12. Cardiovascular Diseases: Hypertension and Atherosclerosis ................................................... 591 19.2.13. Neurological diseases: degenerative disc disease, protrusions, disk herniation, migraine. ................................................................................. 600 19.2.14. Rheumatoid arthritis, ankylos ing spondylitis, deforming osteoarthrosis, infectious polyarthritis........................................................... 604 19.2.15. Can dry fasting treat AIDS and hepatitis C?............................................................................ 627 19.2.16. Dry Fasting against Cancer ................ 631 19.2.17. Dry Fasting against Skin Diseases ..... 637 19.2.18. Functional Nervous System Disorders ................................................................................. 649 19.2.19. Dry Fasting against Obesity ............... 652 20. How does doctor Filonov debunk myths about dry therapeutic fasting? .......................................... 679 Literature .............................................................. 722 Foreword by the curator of English and Italian edition Vera Giovanna Bani Between 29 June and 13 July 2019 I had the honor and the privilege of organizing the first dry fasting practice in Europe (Strunjan - Slove- nia), with Dr. Filonov and his team of masseurs: his daughters Olga Kulikova, Anastasiya An- tonova and nephew Andrey Cherkasskyj. We worked with a fantastic group of almost thirty people, all Italians except for one German girl, one French and one Swiss. The experience was wonderful, effective and constructive for every- one (see the p hoto dossier at the end of the book). But how did this project of disseminating dry fasting begin?... …In October 2016, I began to get interested in dry fasting without suspecting that this path Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] eventually propel me into an unexpected world. I disco vered that in the post -war Soviet Union, where pharmaceutical lobbies were en- tirely inexistent, and a strong spirit of innova- tion and scientific research prevailed, a medical - scientific approach entailing therapeutic fasting was formally consolidated. Drawing on a tradi- tion previously established in Russia, the mech- anisms of therapeutic fasting had been success- fully investigated and clinically tested on thou- sands of patients over the course of 60 years. This provided the scientific foundation that eventuall y made it possible for the Ministry of Health to approve its methodological indica- tions. Many Russian doctors had the oppor- tunity to cultivate this approach and even Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] a radical branch, as the dry fast could be defined. In November 2016, I worked to meet Dr. Fi- lonov, who is considered the top dry fasting ex- pert in Russia. I offered him to become the fore- runner of dry fasting in Italy and he gave me “carte blanche”. Thus, in March 2017, thanks to the invitation of the Italian University of Health heade d by Dr. Valdo Vaccaro, I had the oppor- tunity to introduce Dr. Filonov to the Italian au- dience. In the summer of 2017, I tested this fantastic method on myself at Dr. Filonov’s headquarters in Altai Republic (Ust -Sema, West Siberia) and finally in mid -December 2017 the monograph, Digiuno secco. Gli ultimi sviluppi della digiuno- terapia in Russia (Dry Fasting: the latest Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] in fasting in Russia), came to life. It’s the first non -Russian book about dry fasting! This 687 -page volume comprises the al most complete version of the first book by Dr Filonov, Suchoe lechebnoe golodanie. Mify i realnost (Dry medical fasting. Myths and reality) and selected chapters of his second book, Lechenie organizma sobstvennymi silami (Curing the body with its own strengths)1. 1 Our monograph in italian: Digiuno secco. Gli ultimi sviluppi della digiunoterapia in Russia (Dry fast: the latest developments in fasting in Russia), Macerata, edizioni Simple 2017, brings together the translation of the two writings of S. Filonov and is composed as fol- lows: - Suchoe lechebnoe golodanie. Mify i realnost - (Therapeutic dry fasting. Myths and reality), 2008. This book is reported here in an almost integral version, separated into the shorter chapters: Interesnye svedeniya o suchom golodanii (Interesting facts about Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] book was received with great interest in It- aly: its emergence attracted the attention of the community of complementary medicine sup- porters, and many bought it without hesitation, despite its weight and hefty price. Nonetheless, we’d like to emphasize, however, is that the subject of our work has had repercus- sions outside of a circle of enthusiasts of the al- ternative medicine scene: today, our website Si- berika.it receives continuous requests for dry fasting), Zenshchina, kotoraya ne est (The woman who does not eat ), Solntseedy (The sun -eaters) - Lechenie organizma sobstvennymi silami (Curing the body with its own strengths), 2015 - the chapters regarding the vetero - slavic massage Staroslaviyanskie metody lecheniya (Vetero - slavic treatment methods) have been omittedy Copyright © Vera Giovanna Bani 2019 www.dryfasting.infoThis Ebook was purchased by Gilberto Franchi email: [email protected] from ordinary people who are in
[ 63546, 278, 505, 264, 5043, 8, 220, 82472, 4095, 18575, 220, 18199, 2355, 1032, 13, 22, 13, 2650, 311, 10772, 25007, 354, 869, 753, 15240, 88, 320, 805, 372, 8, 220, 22666, 220, 19929, 2355, 1032, 13, 23, 13, 3639, 527, 279, 4754, 36505, 2391, 720, 63546, 278, 505, 54560, 30, 220, 82472, 4095, 497, 220, 18650, 2355, 975, 13, 3639, 753, 279, 10728, 13155, 369, 31474, 264, 9235, 720, 82190, 278, 5043, 520, 2162, 30, 220, 82472, 4095, 497, 220, 220, 19867, 720, 868, 13, 2650, 1690, 13124, 315, 9235, 54560, 3073, 30, 220, 46196, 1975, 220, 220, 12910, 720, 868, 13, 16, 13, 71770, 13363, 25, 53179, 315, 11002, 66477, 198, 82472, 8054, 497, 82472, 1975, 220, 19695, 220, 220, 868, 13, 17, 13, 71770, 13363, 25, 31941, 54560, 323, 294, 22485, 720, 4291, 9439, 3090, 220, 82472, 8054, 497, 22666, 18575, 220, 18572, 2355, 845, 13, 2650, 1288, 499, 6929, 264, 1317, 9235, 5043, 30, 220, 75208, 220, 10841, 720, 1114, 13, 31941, 69309, 54560, 13, 10699, 656, 584, 7079, 433, 720, 998, 30, 87172, 4095, 1975, 220, 220, 21505, 720, 972, 13, 2650, 311, 2586, 704, 315, 264, 220, 24, 482, 1316, 9235, 54560, 3388, 5380, 87172, 4095, 62073, 220, 220, 11738, 720, 32, 43226, 2068, 369, 5108, 704, 315, 264, 5043, 220, 5354, 220, 21038, 2355, 777, 13, 3639, 19338, 649, 387, 64688, 1555, 9235, 54560, 5380, 87172, 4095, 62073, 220, 220, 18162, 720, 777, 13, 16, 13, 31941, 54560, 369, 30883, 19338, 13, 220, 90014, 29249, 220, 18162, 2355, 777, 13, 16, 13, 16, 13, 435, 15067, 369, 30883, 30020, 320, 32590, 720, 417, 5682, 5382, 19338, 11, 62937, 8, 220, 220, 57341, 1131, 220, 17824, 2355, 777, 13, 16, 13, 17, 13, 31941, 54560, 369, 279, 1375, 7629, 315, 89385, 96971, 720, 269, 3930, 55836, 278, 96971, 11, 21249, 62268, 82801, 11, 720, 971, 35853, 599, 20000, 11, 1400, 20000, 11, 5099, 13, 220, 82472, 49711, 220, 20571, 2355, 777, 13, 16, 13, 18, 13, 31941, 54560, 369, 20335, 220, 90014, 62073, 220, 20767, 2355, 777, 13, 17, 13, 31941, 435, 15067, 369, 21249, 19338, 220, 90014, 497, 220, 21177, 220, 220, 777, 13, 17, 13, 16, 13, 31941, 435, 15067, 369, 842, 787, 5241, 20901, 323, 720, 1894, 437, 91711, 13, 82472, 4095, 497, 46196, 62073, 220, 21618, 2355, 777, 13, 17, 13, 17, 13, 31941, 435, 15067, 369, 63308, 220, 90014, 1975, 220, 20711, 2355, 777, 13, 17, 13, 18, 13, 8595, 9235, 54560, 8779, 4465, 21249, 19338, 198, 82472, 8054, 497, 82472, 1975, 220, 23033, 2355, 777, 13, 17, 13, 19, 13, 31941, 54560, 369, 63581, 292, 56071, 304, 279, 2547, 220, 220, 19642, 720, 777, 13, 17, 13, 20, 13, 31941, 435, 15067, 369, 15268, 62587, 220, 220, 57341, 497, 220, 22048, 2355, 777, 13, 17, 13, 21, 13, 2057, 87, 22689, 304, 60747, 519, 11215, 220, 90014, 497, 220, 21860, 2355, 777, 13, 17, 13, 22, 13, 4060, 4512, 462, 10934, 220, 82472, 4095, 18575, 220, 22895, 2355, 777, 13, 17, 13, 23, 13, 31941, 435, 15067, 369, 7505, 625, 350, 372, 1105, 220, 90014, 220, 20460, 2355, 777, 13, 17, 13, 24, 13, 37582, 54042, 220, 82472, 8054, 497, 220, 220, 23477, 720, 777, 13, 17, 13, 605, 13, 1322, 10079, 20000, 323, 65309, 463, 2020, 17508, 501, 36259, 198, 82472, 8054, 497, 82472, 1975, 220, 22049, 2355, 777, 13, 17, 13, 806, 13, 31941, 435, 15067, 369, 20407, 110459, 360, 55892, 720, 35, 1082, 2315, 82472, 8054, 90014, 49711, 220, 22529, 2355, 777, 13, 17, 13, 717, 13, 92976, 33945, 70674, 25, 39515, 531, 2711, 720, 438, 362, 91882, 91711, 220, 82472, 8054, 497, 662, 220, 24380, 220, 220, 777, 13, 17, 13, 1032, 13, 32359, 31356, 19338, 25, 5367, 75989, 2624, 720, 67, 56407, 11, 81458, 36807, 11, 13668, 72909, 7246, 11, 92981, 627, 82472, 8054, 497, 220, 57341, 49711, 220, 5067, 2355, 777, 13, 17, 13, 975, 13, 71636, 46313, 590, 55652, 11, 459, 8050, 2353, 6892, 720, 82, 3595, 4010, 20000, 11, 409, 55857, 52368, 78, 47601, 63412, 11, 50600, 720, 34535, 277, 40485, 82472, 62073, 90014, 497, 220, 20354, 2355, 777, 13, 17, 13, 868, 13, 3053, 9235, 54560, 4322, 46060, 323, 73975, 720, 34, 30, 82472, 4095, 62073, 220, 57341, 1131, 220, 23103, 2355, 777, 13, 17, 13, 845, 13, 31941, 435, 15067, 2403, 26211, 220, 90014, 220, 21729, 2355, 777, 13, 17, 13, 1114, 13, 31941, 435, 15067, 2403, 28049, 70674, 220, 68229, 220, 21788, 2355, 777, 13, 17, 13, 972, 13, 55550, 452, 651, 788, 744, 73133, 198, 82472, 8054, 497, 220, 57341, 49711, 220, 24734, 2355, 777, 13, 17, 13, 777, 13, 31941, 435, 15067, 2403, 95171, 220, 46196, 49711, 220, 23181, 2355, 508, 13, 2650, 1587, 10896, 16807, 263, 869, 78293, 51286, 922, 720, 54310, 37471, 54560, 30, 220, 82472, 4095, 497, 220, 220, 25136, 720, 87115, 1598, 220, 82472, 57341, 29249, 220, 220, 23024, 33006, 8371, 1178, 555, 279, 87805, 315, 6498, 323, 720, 70211, 14002, 68200, 61678, 12930, 426, 5676, 1084, 26556, 220, 1682, 5651, 323, 220, 1032, 5887, 220, 679, 24, 358, 1047, 279, 720, 71, 55137, 323, 279, 26632, 315, 35821, 279, 1176, 720, 54310, 54560, 6725, 304, 4606, 320, 2645, 359, 23685, 482, 26685, 588, 7058, 21557, 705, 449, 2999, 13, 16807, 263, 869, 323, 813, 2128, 315, 58617, 1759, 25, 720, 26301, 30968, 12225, 6885, 85606, 1609, 12949, 11, 94425, 10426, 7911, 1556, 7058, 783, 12949, 323, 63904, 1628, 8233, 921, 17172, 395, 8050, 73, 13, 1226, 720, 71214, 449, 264, 14964, 1912, 315, 4661, 27219, 720, 16455, 11, 682, 97333, 3734, 369, 832, 6063, 3828, 11, 720, 606, 8753, 323, 832, 30791, 13, 578, 3217, 574, 720, 86, 14518, 1285, 11, 7524, 323, 54584, 369, 1475, 7058, 606, 320, 4151, 279, 281, 305, 2117, 53576, 520, 279, 842, 315, 279, 720, 2239, 570, 220, 2030, 1268, 1550, 420, 2447, 315, 34000, 65383, 720, 54310, 54560, 3240, 30, 1131, 2355, 1981, 644, 6664, 220, 679, 21, 11, 358, 6137, 311, 636, 8173, 304, 720, 54310, 54560, 2085, 15562, 287, 430, 420, 1853, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 41450, 9778, 89483, 757, 1139, 459, 16907, 720, 14957, 13, 358, 54969, 2807, 291, 430, 304, 279, 1772, 482, 11710, 19953, 720, 33758, 11, 1405, 35410, 326, 41412, 1051, 665, 7058, 83, 556, 398, 55981, 18620, 11, 323, 264, 3831, 9090, 315, 9721, 64, 7058, 28491, 323, 12624, 3495, 85814, 11, 264, 6593, 18722, 85930, 5603, 1218, 14612, 37471, 54560, 720, 16514, 37402, 60391, 13, 38859, 389, 264, 124979, 7058, 28491, 8767, 9749, 304, 8524, 11, 279, 84596, 7058, 276, 13978, 315, 37471, 54560, 1047, 1027, 2450, 7058, 3725, 27313, 323, 70432, 12793, 389, 34223, 7058, 82, 2914, 315, 6978, 927, 279, 3388, 315, 220, 1399, 1667, 13, 720, 2028, 3984, 279, 12624, 16665, 430, 720, 3163, 84, 543, 379, 1903, 433, 3284, 369, 279, 20214, 315, 720, 14884, 311, 29251, 1202, 1749, 5848, 75780, 7058, 83, 919, 13, 9176, 8690, 16410, 1047, 279, 4083, 269, 7058, 83, 2498, 311, 67632, 420, 5603, 323, 1524, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 16219, 264, 18336, 9046, 11, 439, 279, 9235, 5043, 1436, 387, 720, 9910, 13, 2355, 644, 6841, 220, 679, 21, 11, 358, 6575, 311, 3449, 2999, 13, 40971, 7058, 12490, 869, 11, 889, 374, 6646, 279, 1948, 9235, 54560, 506, 7058, 77468, 304, 8524, 13, 358, 9076, 1461, 311, 3719, 279, 2291, 7058, 42836, 315, 9235, 54560, 304, 15704, 323, 568, 6688, 757, 720, 2118, 11707, 68, 1529, 29097, 11453, 14636, 11, 304, 5587, 220, 679, 22, 11, 9523, 311, 720, 1820, 29788, 315, 279, 15155, 3907, 315, 6401, 720, 383, 1037, 294, 555, 2999, 13, 4196, 3055, 59788, 17606, 11, 358, 1047, 279, 4083, 269, 7058, 83, 2498, 311, 19678, 2999, 13, 16807, 263, 869, 311, 279, 15155, 8065, 7058, 67, 1873, 13, 2355, 644, 279, 7474, 315, 220, 679, 22, 11, 358, 12793, 420, 14964, 720, 4492, 389, 7182, 520, 2999, 13, 16807, 263, 869, 753, 26097, 720, 258, 24610, 2192, 5545, 320, 52, 267, 482, 50, 9355, 11, 4410, 68600, 689, 8, 323, 720, 40276, 304, 5209, 482, 33246, 220, 679, 22, 279, 1647, 3257, 11, 720, 35, 30637, 16711, 513, 58761, 13, 480, 747, 8675, 25877, 13871, 321, 455, 2554, 15587, 4170, 72, 16711, 7058, 466, 80470, 304, 8524, 220, 320, 86315, 435, 15067, 25, 279, 5652, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 16219, 1392, 304, 54560, 304, 8524, 705, 3782, 311, 2324, 13, 2355, 2181, 753, 279, 1176, 2536, 482, 48807, 2363, 922, 9235, 54560, 0, 720, 2028, 220, 21897, 482, 2964, 8286, 41095, 279, 453, 1455, 720, 15079, 2373, 315, 279, 1176, 2363, 555, 2999, 16807, 263, 869, 11, 720, 37559, 971, 68, 514, 1557, 65, 2201, 68, 45549, 347, 19700, 13, 386, 1463, 602, 1972, 32557, 320, 86315, 720, 69216, 54560, 13, 3092, 17323, 323, 8903, 8, 323, 4183, 720, 331, 17881, 315, 813, 2132, 2363, 11, 2009, 7674, 648, 25286, 1764, 720, 101035, 267, 1055, 49221, 72, 5554, 10830, 220, 320, 34, 1711, 279, 2547, 449, 1202, 720, 785, 36486, 8, 16, 13, 2355, 720, 16, 5751, 1647, 3257, 304, 29048, 25, 423, 30637, 16711, 513, 58761, 13, 480, 747, 8675, 25877, 13871, 321, 455, 2554, 15587, 720, 67, 30637, 359, 26464, 80470, 304, 8524, 220, 320, 86315, 5043, 25, 279, 5652, 26006, 304, 54560, 720, 258, 8524, 705, 7553, 261, 460, 11, 1608, 79259, 9170, 220, 679, 22, 11, 12716, 3871, 279, 2355, 3129, 315, 279, 1403, 43422, 315, 328, 13, 16807, 263, 869, 323, 374, 24306, 439, 9630, 7058, 75, 4336, 25, 2355, 12, 17360, 971, 68, 514, 1557, 65, 2201, 68, 45549, 347, 19700, 13, 386, 1463, 602, 1972, 32557, 220, 482, 320, 1016, 261, 32486, 9235, 720, 9533, 287, 13, 220, 3092, 17323, 323, 8903, 705, 220, 1049, 23, 13, 1115, 2363, 374, 5068, 1618, 304, 720, 276, 4661, 26154, 2373, 11, 19180, 1139, 279, 24210, 30732, 25, 720, 3386, 288, 3919, 68, 274, 2111, 34229, 7911, 297, 1778, 316, 45549, 347, 276, 3893, 320, 85415, 13363, 922, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 791, 2363, 574, 4036, 449, 2294, 2802, 304, 1102, 7058, 5893, 25, 1202, 49179, 29123, 279, 6666, 315, 279, 720, 29502, 315, 58535, 16088, 1043, 7058, 403, 388, 11, 323, 1690, 11021, 433, 2085, 65437, 11, 720, 5919, 6100, 1202, 4785, 323, 65242, 3430, 13, 2355, 8284, 27163, 11, 584, 7070, 1093, 311, 47032, 11, 4869, 11, 720, 285, 430, 279, 3917, 315, 1057, 990, 706, 1047, 74488, 355, 7058, 82, 919, 4994, 315, 264, 12960, 315, 43448, 315, 279, 453, 7058, 4253, 1413, 16088, 6237, 25, 3432, 11, 1057, 3997, 12095, 7058, 655, 11755, 15965, 21879, 19815, 7540, 369, 33006, 54310, 54560, 705, 1901, 729, 71, 81236, 11, 597, 10088, 12874, 841, 1826, 220, 320, 791, 5333, 889, 1587, 720, 1962, 8343, 7026, 11730, 406, 325, 9497, 220, 320, 791, 7160, 482, 68, 11796, 8, 5996, 12, 2009, 7674, 648, 25286, 1764, 11752, 267, 1055, 49221, 72, 5554, 10830, 320, 34, 1711, 279, 2547, 449, 720, 1220, 1866, 36486, 705, 220, 679, 20, 482, 279, 30732, 9002, 279, 12854, 78, 18722, 3306, 89545, 6378, 7834, 48558, 6321, 88, 598, 31422, 2322, 1094, 514, 7674, 80574, 220, 320, 91177, 78, 18722, 3306, 89545, 6514, 5528, 8, 617, 1027, 40542, 88, 2355, 720, 13857, 7388, 68200, 61678, 12930, 426, 5676, 220, 679, 24, 8604, 962, 894, 9533, 287, 5506, 2028, 89771, 574, 15075, 555, 46092, 78, 2939, 3581, 72, 2613, 25, 342, 321, 9339, 1073, 81, 3581, 72, 59131, 19328, 13115, 2461, 505, 19664, 1274, 889, 527, 304 ]
0xBreath/holistic-books
astringent) in each meal. The typical American diet tends to be dominated by the sweet, sour, and salty tastes (the main flavors of a hamburger). We do need these tastes, but they can lower metabolism, especially if eaten in excess. The pungent, bitter, and astringent tastes, on the other hand, are anti-inflammatory and increase metabolism. These tastes are found in foods such as radishes, ginger, mustard, peppers, spinach, mushrooms, tea, lentils, lettuce, and so on. Along with the six tastes, filling your plate with the colors of the rainbow promotes a long and healthy life. We can literally ingest the information of the universe into our biology. Foods that are deep blue, purple, red, green, or orange are leaders in antioxidants and contain many nutrients that boost immunity and enhance health. Examples of foods of the rainbow: • Red: Red tomatoes (particularly cooked), red peppers, red/pink grapefruit, watermelon, red grapes, beets, red cabbage, apples, strawberries, cherries, raspberries, cranberries • Orange/yellow: Squash, carrots, sweet potatoes, yams, pumpkin, cantaloupe, mangoes, papaya, nectarines • Green: Broccoli, kale, spinach, cabbage, peas, avocado, collard greens • Deep blue/purple: Plums, blueberries, black raspberries, blackberries, purple grapes, eggplant (with skin)NURTURE YOUR BODY WITH HEALTHY FOOD7 STEPS TO RADICAL WELLBEING: Step 4 www.chopra.comSTEP 4I rejoice in the miracle of my body by moving, stretching, and strengthening it every day. 7 STEPS TO RADICAL WELLBEING: Step 5One of the most important ways to grow younger and live longer is regular exercise. Drs. William Evans and Irwin Rosenberg from Tufts University have documented the powerful effect of exercise on many of the biomarkers of aging, including muscle mass, strength, aerobic capacity, bone density, and cholesterol. Not only does exercise keep the body young, but it also keeps the mind vital and promotes emotional well-being. In his book Spark: The Revolutionary New Science of Exercise and the Brain, Harvard University professor John Ratey, M.D. describes how physical activity sparks biological changes that increases the brain’s ability to learn, adapt, and perform other cognitive tasks. A complete fitness program includes exercises to develop flexibility, cardiovascular conditioning, and strength training. Find an aerobic activity that you can do regularly—three to four sessions each week for twenty to thirty minutes is usually enough to give you substantial benefits. After your body is warmed up, spend five to ten minutes stretching. You will also want to include strength training in your program to systematically exercise the major muscle groups of your body. The important thing is to start off slowly, find physical activities you enjoy, and do them regularly. If the most you can do right now is walk around the block, do that, and you will be surprised how quickly you increase your endurance and enthusiasm for moving and breathing.MOVE YOUR BODY EVERY DAY7 STEPS TO RADICAL WELLBEING: Step 5 www.chopra.comSTEP 5I openly give and receive love to those around me.7 STEPS TO RADICAL WELLBEING: Step 6Isolation and loneliness create the conditions for rapid aging. Heart attack and death rates are known to increase among the recently widowed and among men who have been suddenly terminated from their jobs without warning and against their will. The emotional value of social bonding is immense, yet in some countries, including the U.S., we have moved in the opposite direction for decades. With increasingly long hours spent working, more time in front of the television, and a population constantly on the move, social bonding keeps declining. The trend will be exacerbated as the fastest-growing population, those eighty and older, move into retirement homes. It’s becoming increasingly rare for older people to be cared for at home, and there is still a stigma about seniors being a burden to the young and a drag on society. The key here is to stay connected and open to new relationships throughout your life. Resist the impulse to go quietly into semi-isolation because you assume that society expects that of you. Losing friends and spouses is an inevitable part of aging, and many people can’t find replacements or lack the motivation to. By “replacement,” I don’t mean a new spouse and family (though that is certainly a possibility), but emotional bonds that mean something to you and offer continued meaning to your existence. No amount of reading and television substitutes for human contact that nourishes on the level of love and caring. One of the most effective steps is for older people to become involved with mentoring programs, education, and youth programs.CULTIVATE LOVING RELATIONSHIPS7 STEPS TO RADICAL WELLBEING: Step 6 www.chopra.comSTEP 6I make time to play and explore each day, approaching new experiences with the curiosity and openness of a child. 7 STEPS TO RADICAL WELLBEING: Step 7An ancient Vedic aphorism says, “Infinite flexibility is the secret to immortality.” When we cultivate flexibility in or consciousness, we renew ourselves in every moment and reverse the aging process. Children offer the finest expressions of openness and flexibility. They play and laugh freely, and find wonder in the smallest things. They are infinitely creative because they haven’t yet built up the layers of conditioning that create limitations and restrictions. To maintain a youthful mind, write down two or three things you can do that are totally childlike. Think of something that evokes childhood for you—eating an ice cream cone, going to a playground to swing, coloring a picture, jumping rope, or building a sand castle. Find something that brings back the sense of fun you had as a child, even if you think you’ve outgrown it, and choose one of these activities to do today. As you carry out your childlike activity, let yourself embody the archetypal carefree and innocent child. The feeling you’re aiming for isn’t a return to childhood, but something more profound, as expressed by the brilliant therapist A.H. Almaas: “When we look at a child, we see that the sense of fullness, of intrinsic aliveness, of joy in being, is not the result of something else. There is value in just being oneself; it is not because of something one does or doesn’t do. It is there in the beginning, when we were children but slowly it gets lost.” By re-experiencing our childlike nature, we not only cultivate a youthful mind, but we also connect to the part of us that is never born and never dies—our eternal spiritual essence.MAINTAIN A YOUTHFUL MIND7 STEPS TO RADICAL WELLBEING: Step 7 www.chopra.comSTEP 7<|eot_id|><|begin_of_text|>Praise for The 80/10/10 Diet “Dr. Graham is wise, insightful, and a leading-edge thinker. Read, savor, and use his brilliance, and I hope it serves you as well as it has me.” —Mark Victor Hansen, coauthor of the Chicken Soup for the Soul series of books “For people who want to create balance in their lives and reach a nd sustain the level of health they deserve, I highly recommend this book.” —Kimberly Mac, The “Naked” Vegan, radio talk show host and live-food chef “Dr. Graham’s 80/10/10 diet has literally saved my life! By putting hi s advice into practice, I have recovered from serious illness and attained a level of health I never dreamed possible. If you des ire the tools necessary to create a permanent and life- changing level of health, look no further than this book!” —Jeremiah Neese, Santa Barbara, CA “When I stick with Dr. Graham’s 80/10/10 diet program, I am full of energy a nd vitality. I am able to live life to the fullest and enjoy every moment. As an added bonus, I start to lose extra weight and I f eel healthy. I don’t want for anything when I can eat all the strawberries and watermelon that I desire.” —Rachel Johnson, author of Wake Up Running! “I have been following Dr. Graham’s 80/10/10 diet and lifestyle for seven years, and it is the best thing I have ever done. His program has allowed me to fine tune my eating habits so that I’m func tioning at my best. For me, the benefits of this lifestyle include high energy, disappearance of all ailments, cessation of depression, m ore patience, a reverence for life, and much more.” —Gary Orlando, author of Beyond Raw eBook “I am so grateful to Dr. D. for introducing me to the 80/10/10 diet! I just start ed working out for the first time in many years, and I am having the most amazing results! My energy is skyrocketing, and I am feeling better than I’ve felt in my entire life.” —Kira Donnellan, Hartford, Connecticut “The 80/10/10 diet as explained and advocated by Dr. Graham in his book, is in my opinion, the greatest breakthrough ever made in the field of nutrition. Read it, study it, and apply it as if your
[ 264, 928, 306, 8, 304, 1855, 15496, 13, 578, 14595, 720, 29518, 10173, 28335, 311, 387, 30801, 555, 279, 10437, 11, 20897, 11, 323, 74975, 36263, 320, 1820, 1925, 720, 1517, 51585, 315, 264, 89847, 570, 1226, 656, 1205, 1521, 36263, 11, 719, 814, 649, 4827, 39097, 11, 720, 36046, 422, 35661, 304, 13937, 13, 2355, 791, 281, 2234, 306, 11, 26242, 11, 323, 264, 928, 306, 36263, 11, 389, 279, 1023, 1450, 11, 527, 7294, 67595, 720, 438, 5376, 39097, 13, 4314, 36263, 527, 1766, 304, 15657, 1778, 439, 9038, 21168, 11, 44768, 11, 720, 25849, 569, 11, 58573, 11, 68798, 11, 48251, 11, 15600, 11, 48907, 8839, 11, 71655, 11, 323, 779, 389, 627, 50909, 449, 279, 4848, 36263, 11, 21973, 701, 12235, 449, 279, 8146, 315, 279, 48713, 39990, 720, 64, 1317, 323, 9498, 2324, 13, 1226, 649, 16280, 89372, 279, 2038, 315, 279, 15861, 1139, 720, 414, 34458, 13, 40160, 430, 527, 5655, 6437, 11, 25977, 11, 2579, 11, 6307, 11, 477, 19087, 527, 6164, 304, 720, 519, 42651, 1821, 323, 6782, 1690, 37493, 430, 7916, 40368, 323, 18885, 2890, 13, 2355, 41481, 315, 15657, 315, 279, 48713, 25, 2355, 6806, 3816, 25, 3816, 41613, 320, 74039, 30205, 705, 2579, 58573, 11, 2579, 4420, 771, 52252, 36698, 11, 720, 13284, 72218, 11, 2579, 66008, 11, 387, 1441, 11, 2579, 74873, 11, 41776, 11, 76203, 11, 23008, 4108, 11, 720, 13075, 79, 36989, 11, 70637, 36989, 2355, 6806, 22725, 27589, 5412, 25, 20685, 1003, 11, 62517, 11, 10437, 35267, 11, 379, 4214, 11, 50625, 11, 16869, 278, 283, 375, 11, 720, 76, 5281, 288, 11, 26365, 12874, 11, 308, 39916, 1572, 2355, 6806, 7997, 25, 6031, 60803, 11, 63577, 11, 68798, 11, 74873, 11, 47136, 11, 68346, 11, 4631, 569, 52011, 2355, 6806, 18682, 6437, 4420, 36805, 25, 1856, 6370, 11, 6437, 36989, 11, 3776, 85146, 36989, 11, 3776, 36989, 11, 25977, 720, 911, 9521, 11, 19151, 21494, 320, 4291, 6930, 8, 45, 1539, 42586, 21592, 69683, 4874, 73725, 56, 88227, 22, 27597, 5119, 5257, 75250, 15942, 91252, 11855, 1753, 25, 15166, 220, 19, 198, 2185, 5442, 454, 969, 916, 51489, 220, 19, 40, 92859, 304, 279, 45125, 315, 856, 2547, 555, 7366, 11, 42949, 11, 2355, 438, 48513, 433, 1475, 1938, 13, 220, 22, 27597, 5119, 5257, 75250, 15942, 91252, 11855, 1753, 25, 15166, 220, 20, 4054, 315, 279, 1455, 3062, 5627, 311, 3139, 14992, 323, 3974, 5129, 374, 5912, 720, 64562, 13, 2999, 82, 13, 12656, 30563, 323, 12227, 7678, 97707, 505, 29749, 45544, 3907, 617, 720, 6190, 291, 279, 8147, 2515, 315, 10368, 389, 1690, 315, 279, 39538, 91141, 315, 30084, 11, 720, 16564, 16124, 3148, 11, 8333, 11, 91490, 8824, 11, 17685, 17915, 11, 323, 39086, 13, 720, 2688, 1193, 1587, 10368, 2567, 279, 2547, 3995, 11, 719, 433, 1101, 13912, 279, 4059, 16595, 323, 720, 25475, 6429, 14604, 1664, 33851, 13, 763, 813, 2363, 27565, 25, 578, 67679, 1561, 10170, 720, 1073, 33918, 323, 279, 31417, 11, 25996, 3907, 14561, 3842, 20359, 88, 11, 386, 920, 13, 16964, 720, 5269, 7106, 5820, 76883, 24156, 4442, 430, 12992, 279, 8271, 753, 5845, 311, 720, 12964, 11, 10737, 11, 323, 2804, 1023, 25702, 9256, 13, 2355, 32, 4686, 17479, 2068, 5764, 23783, 311, 2274, 25152, 11, 41713, 720, 9233, 287, 11, 323, 8333, 4967, 13, 7531, 459, 91490, 5820, 430, 499, 649, 656, 720, 23108, 398, 2345, 28956, 311, 3116, 16079, 1855, 2046, 369, 17510, 311, 27219, 4520, 374, 6118, 720, 268, 1409, 311, 3041, 499, 12190, 7720, 13, 4740, 701, 2547, 374, 82830, 709, 11, 8493, 4330, 720, 998, 5899, 4520, 42949, 13, 1472, 690, 1101, 1390, 311, 2997, 8333, 4967, 304, 701, 720, 15252, 311, 60826, 10368, 279, 3682, 16124, 5315, 315, 701, 2547, 13, 2355, 791, 3062, 3245, 374, 311, 1212, 1022, 14297, 11, 1505, 7106, 7640, 499, 4774, 11, 323, 656, 720, 49818, 15870, 13, 1442, 279, 1455, 499, 649, 656, 1314, 1457, 374, 4321, 2212, 279, 2565, 11, 656, 430, 11, 720, 438, 499, 690, 387, 14792, 1268, 6288, 499, 5376, 701, 49286, 323, 36232, 720, 2000, 7366, 323, 27027, 1345, 37855, 21592, 69683, 45974, 38788, 22, 27597, 5119, 5257, 75250, 15942, 91252, 11855, 1753, 25, 15166, 220, 20, 198, 2185, 5442, 454, 969, 916, 51489, 220, 20, 40, 30447, 3041, 323, 5371, 3021, 311, 1884, 2212, 757, 13, 22, 27597, 5119, 5257, 75250, 15942, 91252, 11855, 1753, 25, 15166, 220, 21, 3957, 36062, 323, 75040, 1893, 279, 4787, 369, 11295, 30084, 13, 18449, 3440, 323, 720, 63007, 7969, 527, 3967, 311, 5376, 4315, 279, 6051, 9923, 13111, 323, 4315, 3026, 720, 14965, 617, 1027, 15187, 32372, 505, 872, 7032, 2085, 10163, 323, 2403, 720, 50828, 690, 13, 578, 14604, 907, 315, 3674, 64186, 374, 38883, 11, 3686, 304, 1063, 5961, 11, 720, 16564, 279, 549, 815, 2637, 584, 617, 7882, 304, 279, 14329, 5216, 369, 11026, 13, 3161, 720, 43842, 4522, 398, 1317, 4207, 7543, 3318, 11, 810, 892, 304, 4156, 315, 279, 12707, 11, 323, 264, 720, 45541, 15320, 389, 279, 3351, 11, 3674, 64186, 13912, 43848, 13, 578, 9327, 690, 720, 1395, 92541, 439, 279, 26731, 56657, 7187, 11, 1884, 80679, 323, 9191, 11, 3351, 720, 18614, 21624, 10632, 13, 1102, 753, 10671, 15098, 9024, 369, 9191, 1274, 311, 387, 42777, 720, 2000, 520, 2162, 11, 323, 1070, 374, 2103, 264, 60381, 922, 38349, 1694, 264, 23104, 311, 279, 3995, 720, 438, 264, 11161, 389, 8396, 627, 791, 1401, 1618, 374, 311, 4822, 8599, 323, 1825, 311, 502, 12135, 6957, 720, 22479, 2324, 13, 79968, 279, 49967, 311, 733, 30666, 1139, 18768, 31530, 36062, 1606, 499, 9855, 720, 9210, 8396, 25283, 430, 315, 499, 13, 99239, 4885, 323, 66312, 374, 459, 31352, 961, 720, 1073, 30084, 11, 323, 1690, 1274, 649, 1431, 1505, 54155, 477, 6996, 279, 25835, 311, 13, 3296, 720, 2118, 84731, 2476, 358, 1541, 1431, 3152, 264, 502, 32080, 323, 3070, 320, 4636, 430, 374, 7995, 264, 720, 9007, 3225, 705, 719, 14604, 27460, 430, 3152, 2555, 311, 499, 323, 3085, 8738, 720, 57865, 311, 701, 14209, 13, 2360, 3392, 315, 5403, 323, 12707, 91362, 369, 720, 26380, 3729, 430, 46798, 21168, 389, 279, 2237, 315, 3021, 323, 30598, 13, 3861, 315, 279, 1455, 720, 78995, 7504, 374, 369, 9191, 1274, 311, 3719, 6532, 449, 76579, 7620, 11, 720, 37838, 11, 323, 12822, 7620, 732, 3616, 20032, 5125, 53, 1753, 32612, 3579, 8758, 27034, 22, 27597, 5119, 5257, 75250, 15942, 91252, 11855, 1753, 25, 15166, 220, 21, 198, 2185, 5442, 454, 969, 916, 51489, 220, 21, 40, 1304, 892, 311, 1514, 323, 13488, 1855, 1938, 11, 31047, 720, 943, 11704, 449, 279, 41328, 323, 71160, 2355, 1073, 264, 1716, 13, 220, 22, 27597, 5119, 5257, 75250, 15942, 91252, 11855, 1753, 25, 15166, 220, 22, 2127, 14154, 650, 34383, 89111, 269, 2191, 2795, 11, 1054, 644, 26806, 25152, 374, 279, 6367, 311, 4998, 76052, 2029, 720, 4599, 584, 67632, 25152, 304, 477, 25917, 11, 584, 14195, 13520, 304, 1475, 720, 29699, 323, 10134, 279, 30084, 1920, 13, 15394, 3085, 279, 28807, 24282, 315, 720, 2569, 2136, 323, 25152, 13, 2435, 1514, 323, 12835, 26662, 11, 323, 1505, 5895, 304, 279, 25655, 720, 58174, 13, 2435, 527, 72600, 11782, 1606, 814, 9167, 1431, 3686, 5918, 709, 279, 13931, 315, 720, 9233, 287, 430, 1893, 9669, 323, 17294, 627, 1271, 10519, 264, 65655, 4059, 11, 3350, 1523, 1403, 477, 2380, 2574, 499, 649, 656, 430, 527, 720, 28879, 750, 1716, 4908, 13, 21834, 315, 2555, 430, 3721, 8099, 20587, 369, 499, 2345, 91955, 459, 10054, 720, 47100, 22949, 11, 2133, 311, 264, 42715, 311, 19336, 11, 35987, 264, 6945, 11, 30102, 34520, 11, 477, 720, 24177, 264, 9462, 33684, 13, 7531, 2555, 430, 12716, 1203, 279, 5647, 315, 2523, 499, 1047, 439, 720, 64, 1716, 11, 1524, 422, 499, 1781, 499, 4070, 704, 62376, 433, 11, 323, 5268, 832, 315, 1521, 7640, 311, 720, 3055, 3432, 627, 2170, 499, 6920, 704, 701, 1716, 4908, 5820, 11, 1095, 6261, 81658, 279, 5438, 295, 1100, 278, 2512, 10816, 720, 438, 25226, 1716, 13, 578, 8430, 499, 3207, 38178, 369, 4536, 1431, 264, 471, 311, 20587, 11, 719, 720, 34431, 810, 28254, 11, 439, 13605, 555, 279, 20333, 42863, 362, 3924, 13, 99572, 300, 25, 720, 51928, 584, 1427, 520, 264, 1716, 11, 584, 1518, 430, 279, 5647, 315, 2539, 2136, 11, 315, 47701, 453, 13071, 11, 315, 720, 4215, 304, 1694, 11, 374, 539, 279, 1121, 315, 2555, 775, 13, 2684, 374, 907, 304, 1120, 1694, 57669, 26, 720, 275, 374, 539, 1606, 315, 2555, 832, 1587, 477, 3250, 1431, 656, 13, 1102, 374, 1070, 304, 279, 7314, 11, 720, 9493, 584, 1051, 2911, 719, 14297, 433, 5334, 5675, 2029, 3296, 312, 10397, 32836, 11627, 1057, 1716, 4908, 720, 67812, 11, 584, 539, 1193, 67632, 264, 65655, 4059, 11, 719, 584, 1101, 4667, 311, 279, 961, 315, 603, 720, 9210, 374, 2646, 9405, 323, 2646, 8898, 2345, 414, 35825, 18330, 28591, 1345, 32, 3301, 6979, 362, 816, 41627, 50736, 386, 5358, 22, 27597, 5119, 5257, 75250, 15942, 91252, 11855, 1753, 25, 15166, 220, 22, 198, 2185, 5442, 454, 969, 916, 51489, 220, 22, 128009, 128000, 47, 19223, 369, 578, 220, 1490, 14, 605, 14, 605, 27304, 33006, 2118, 9023, 13, 26181, 374, 24219, 11, 70162, 11, 323, 264, 6522, 48448, 98636, 13, 4557, 11, 274, 3372, 1174, 323, 1005, 813, 83580, 11, 323, 358, 3987, 433, 17482, 499, 439, 1664, 720, 300, 433, 706, 757, 2029, 2355, 2345, 9126, 33412, 58253, 11, 1080, 3170, 315, 279, 720, 84963, 61434, 369, 279, 30242, 4101, 315, 6603, 33006, 75550, 1274, 889, 1390, 311, 1893, 8335, 304, 872, 6439, 323, 5662, 264, 15953, 14201, 279, 2237, 315, 2890, 814, 23528, 11, 358, 7701, 720, 67689, 420, 2363, 2029, 720, 2345, 49436, 655, 398, 7553, 11, 578, 1054, 45, 7897, 863, 63215, 11, 720, 12924, 3137, 1501, 3552, 323, 3974, 64567, 30806, 33006, 2118, 9023, 13, 26181, 753, 220, 1490, 14, 605, 14, 605, 10173, 706, 16280, 6924, 856, 2324, 0, 3296, 10917, 15960, 274, 9650, 1139, 6725, 11, 358, 617, 26403, 505, 6129, 720, 484, 2136, 323, 63260, 264, 2237, 315, 2890, 358, 2646, 57636, 3284, 13, 1442, 499, 951, 44850, 279, 7526, 5995, 311, 1893, 264, 15690, 323, 2324, 12, 720, 52813, 2237, 315, 2890, 11, 1427, 912, 4726, 1109, 420, 2363, 18319, 720, 2345, 45057, 65945, 4275, 2423, 11, 16376, 32207, 11, 9362, 33006, 51928, 358, 9396, 449, 2999, 13, 26181, 753, 220, 1490, 14, 605, 14, 605, 10173, 2068, 11, 358, 1097, 2539, 315, 4907, 264, 15953, 75716, 662, 358, 1097, 3025, 311, 3974, 2324, 311, 279, 77796, 323, 720, 268, 4215, 1475, 4545, 13, 1666, 459, 3779, 12306, 11, 358, 1212, 311, 9229, 5066, 4785, 323, 358, 282, 384, 301, 9498, 662, 358, 1541, 1431, 1390, 369, 4205, 994, 358, 649, 8343, 682, 720, 1820, 76203, 323, 3090, 72218, 430, 358, 12876, 2029, 720, 2345, 84978, 11605, 11, 3229, 315, 41674, 3216, 29125, 0, 33006, 10378, 617, 1027, 2768, 2999, 13, 26181, 753, 220, 1490, 14, 605, 14, 605, 10173, 323, 19433, 369, 8254, 220, 1667, 11, 323, 433, 374, 279, 1888, 3245, 358, 617, 3596, 2884, 13, 5414, 720, 15252, 706, 5535, 757, 311, 7060, 26306, 856, 12459, 26870, 779, 430, 358, 4344, 2988, 73352, 287, 520, 856, 1888, 13, 1789, 757, 11, 279, 7720, 315, 420, 19433, 2997, 198, 12156, 4907, 1174, 52979, 315, 682, 82907, 11, 83460, 315, 18710, 11, 296, 16536, 30401, 11, 264, 98464, 369, 2324, 11, 323, 1790, 810, 2029, 720, 2345, 74067, 28944, 11, 3229, 315, 220, 31886, 23886, 58610, 33006, 10378, 1097, 779, 26259, 311, 2999, 13, 423, 13, 369, 33018, 757, 311, 279, 220, 1490, 14, 605, 14, 605, 10173, 0, 358, 1120, 1212, 1608, 3318, 704, 369, 279, 1176, 892, 304, 1690, 1667, 11, 720, 438, 358, 1097, 3515, 279, 1455, 8056, 3135, 0, 3092, 4907, 374, 75722, 287, 1174, 323, 358, 1097, 8430, 2731, 1109, 358, 4070, 6612, 304, 856, 4553, 2324, 2029, 2355, 2345, 42, 9008, 4418, 49565, 276, 11, 73220, 11, 31461, 33006, 14305, 220, 1490, 14, 605, 14, 605, 10173, 439, 11497, 323, 64854, 555, 2999, 13, 26181, 304, 813, 2363, 11, 374, 304, 856, 220, 9647, 11, 279, 12474, 42445, 3596, 720, 28010, 304, 279, 2115, 315, 26677, 13, 4557, 433, 11, 4007, 433, 11, 323, 3881, 433, 439, 422, 701 ]
0xBreath/holistic-books
to marshal its energies, maintain a positive mental attitude and otherwisestay out of the way. Many people intensely dread missing even one meal. These folks usually are and have been so toxic that their bodies had been stashing uneliminated toxins intheir fat for years. They are usually so addicted to caffeine, cigarettes, alcohol,and so forth, that when they had fasted, even briefly, their bodies were forced todip into highly-polluted fat reserves while simultaneously the body beginswithdrawal. People like this who try to fast experience highly unpleasantsymptoms including headache, irritability, inability to think or concentrate, blurredvision, profound fatigue, aches, etc. Most of these symptoms come from lowblood sugar, but combined with the toxins being released from fat and combinedwith going through multiple addictive withdrawals, the discomforts are more thanmost people are willing to tolerate. Fasting on juice is much more realistic forcases like this. It is little wonder that when a hygienist suggests a fast to improvehealth, this type of case asserts positively that fasting is quite impossible, they havetried it, it is absolutely terrible and know that they can’t do it. This rejection is partly due to a cultural expectation (one reinforced by western medicine) that all unpleasant symptoms should be avoided or suppressed. Tovoluntarily experience unpleasant sensations such as those mentioned above ismore than the ordinary timid person will subject themselves to, even in order toregain health. They will allow surgery, drugs with violent and dangerous sideeffects, painful and invasive testing procedures and radiation—all unpleasant andsometimes extremely uncomfortable. These therapies are accepted becausesomeone else with authority is doing it to them. And, they have been told that itthey don’t submit they will not ever feel better and probably will die in the nearfuture. Also people think that they have no alternative, that the expert in front of them knows what is best, so they feel relieved to have been relieved of the responsibility for their own condition and its treatment. Preventative Fasting During the years it takes for a body to degenerate enough to prompt a fast, the body has been storing up large quantities of unprocessed toxins in the cells,tissues, fat deposits, and organs. The body in its wisdom will always choose totemporarily deposit overwhelming amounts of toxins somewhere harmless ratherthan either permit the blood supply to become polluted or to use secondaryelimination routes. A body will use occasions when the liver is less burdened toeliminate these stored toxic debris. The hygienist’s paradigm asserts that themanifestation of symptoms or illness are all by themselves, absolute, unassailableproof that further storage of toxic wastes in the cells, tissues, fat deposits, andorgans is not possible and that an effort toward elimination is absolutelynecessary. Thus the first time a person fasts a great quantity of toxins will normallybe released. Being the resident of a body when this is happening can be quiteuncomfortable. For this reason alone, preventative fasting is a very wise idea. Before the body becomes critically ill, clean up your reserve fuel supply (fat deposits) by burning off some accumulated fat that is rich in toxic deposits andthen replace it with clean, non-toxic fat that you will make while eating sensibly. Ifyou had but fasted prophylactically as a preventative or health-creating measurebefore you became seriously ill, the initial detoxification of your body could havebeen accomplished far more comfortably, while you were healthy, while your vitalforce was high and while your body otherwise more able to deal withdetoxification. Each time you fast, even if it is only one day, you allow your body to go through a partial detox, and each time it becomes easier and more comfortablethan the last time. The body learns how to fast. Each time you fast it, your bodyslips into a cleansing mode more quickly, and each time you fast you lighten the load of stored toxins. Perhaps you have already eliminated the caffeine your body had stored, which frequently causes severe headaches on withdrawal, not tomention fatigue. It certainly helps to have this behind you before you go on to theelimination of other irritating substances. Many people have gone through alcoholor tobacco withdrawal, and understand that it is very unpleasant, and also that itmust be done in the pursuit of health. Why not withdraw from the rest of theirritating and debilitating substances we take into our system on an ongoing basis,and why not grit your way through the eliminative process, withdraw, from foodaddictions such as sugar or salt, and from foods that you may be allergic to likewheat, dairy products or eggs. It is very wise to invest in your own insurance plan by systematically detoxifying while you are still healthy. Plan it into your life, when it is convenient,such as once a week on Sunday, or even once a month on a quiet day. Take afew days of vacation, go to a warm, beautiful place and devote part or all of it tocleansing. Treat yourself by taking an annual trip to Hawaii, fasting at a hotel onthe beach—do whatever it takes to motivate yourself. And consider this:vacations are enormously cheaper when you stay out of restaurants. If you have accustomed your body to 24 hour fasts, then you can work on 48 hour fasts, and over time work up to 72 hour fasts, all on a continuum. You mayfind it becoming increasingly comfortable, perhaps even pleasant, something youlook forward to. Fasting a relatively detoxified body feels good, and peopleeventually really get into the clean, light, clear headed, perhaps spiritually awarestate that goes along with it. By contrast, fasting when you are sick is much more difficult because your vitality or vital force is very low, you already have no energy, and probably haveunpleasant symptoms that must be dealt with at the same time. There may be theadded stress of being forced into a cleanse because you are too nauseous to eat.Most people let their health go until they are forced into dealing with it; they aretoo busy living, so why bother. The truth is that our body does age, and over time becomes less able to deal with insults; the accumulated effect of insults and aging eventually leads most of usto some serious degenerative illness. Normally this begins happening around age50 if not sooner. Some of us that were gifted with good genes or what I call “agood start” may have reached the age of 60 or 75 or even 90 without seriousillness, but those people are few and far between. Why not tip the scales in yourfavor by preventing or staving off health problems with systematic detoxification atyour own convenience. Climb into the drivers seat and start to take control and gain confidence in your own ability to deal with your body, your own health, and your own life.When it gets right down to the bottom line, there is really only one thing in theworld that is really yours, and that is your life. Take control and start managing it.The reward will be a more qualitative life. Chapter Four Colon Cleansing From The Hygienic Dictionary Autointoxication. [1] the accumulations on the bowel wall become a breeding ground for unhealthy bacterial life forms. The heavy mucus coating in the colon thickens and becomes a host forputrefaction. The blood capillaries to the colon begin to pick up the toxins, poisons and noxiousdebris as it seeps through the bowel wall. All tissues and organs of the body are now taking on toxicsubstances. Here is the beginning of true autointoxication on a physiological level. Bernard Jensen,Tissue Cleansing Through Bowel Management. [2] All maladies are due to the lack of certain food principles, such as mineral salts or vitamins, or to the absence of the normal defenses of the body,such as the natural protective flora. When this occurs, toxic bacteria invade the lower alimentary canal,and the poisons thus generated pollute the bloodstream and gradually deteriorate and destroy everytissue, gland and organ of the body. Sir Arbuthnot Lane. [3] The common cause of gastro-intestinalindigestion is enervation and overeating When food is not digested, it becomes a poison. Dr. John. H.Tllden, Impaired Health: Its Cause and Cure, 1921. [4] a clogging up of the large intestine by a building up (on) the bowel wall to such an extent that feces can hardly pass through. autointoxicationis a direct result of intestinal constipation. Faulty nutrition is a major underlying factor inconstipation. The frequency or quantity of fecal elimination is not an indication of the lack ofconstipation in the bowel. Bernard Jensen, Tissue Cleansing Through Bowel Management. I am not a true believer in any single healing method or system. I find much truth in many schools and use a wide variety of techniques. The word for myinclination is eclectic. The most effective medicine in my arsenal is water fasting followed closely in potency by other, less rigorous detoxifying diets. Colon cleansing ranks next inhealing power. In fact it is difficult to separate colon cleansing from fastingbecause detoxification programs should always be accompanied by coloncleansing. Further down the scale of efficatiousness comes dietary reform to eliminate allergic reactions and to present the body with foods it is capable of digesting without creating toxemia. Last, and usually least in effectiveness in myarsenal, are orthotropic substances (in the form of little pills and capsules)commonly known as vitamins or food supplements. Interestingly, acceptance of these methods by my clients runs in exact opposition to their effectiveness. People prefer taking vitamins because they seemlike the allopaths’ pills, taking pills demands
[ 311, 61871, 1202, 49969, 11, 10519, 264, 6928, 10723, 19451, 323, 1023, 49143, 478, 352, 704, 315, 279, 1648, 627, 8607, 1274, 70733, 36075, 7554, 1524, 832, 15496, 13, 4314, 15687, 6118, 527, 198, 438, 617, 1027, 779, 21503, 430, 872, 13162, 1047, 1027, 357, 19587, 653, 40895, 15846, 62186, 304, 50828, 8834, 369, 1667, 13, 2435, 527, 6118, 779, 57727, 311, 49750, 11, 34576, 11, 13200, 51526, 779, 13544, 11, 430, 994, 814, 1047, 5043, 291, 11, 1524, 27851, 11, 872, 13162, 1051, 9770, 11791, 575, 1139, 7701, 2320, 980, 2844, 8834, 30600, 1418, 25291, 279, 2547, 12302, 63546, 278, 13, 9029, 1093, 420, 889, 1456, 311, 5043, 3217, 7701, 653, 698, 300, 1821, 1631, 52273, 2737, 47846, 11, 30118, 2968, 11, 38550, 311, 1781, 477, 37455, 11, 73500, 13311, 11, 28254, 36709, 11, 264, 8696, 11, 5099, 13, 7648, 315, 1521, 13803, 2586, 505, 3428, 51105, 13465, 11, 719, 11093, 449, 279, 62186, 1694, 6004, 505, 8834, 323, 11093, 4291, 2133, 1555, 5361, 57407, 86304, 11, 279, 44776, 82, 527, 810, 1109, 3646, 1274, 527, 10032, 311, 50134, 13, 435, 15067, 389, 23661, 374, 1790, 810, 26569, 369, 24857, 1093, 420, 13, 1102, 374, 2697, 5895, 430, 994, 264, 6409, 88364, 380, 13533, 264, 5043, 311, 7417, 12393, 11, 420, 955, 315, 1162, 57876, 40646, 430, 54560, 374, 5115, 12266, 11, 814, 31081, 295, 4588, 433, 11, 433, 374, 11112, 17936, 323, 1440, 430, 814, 649, 1431, 656, 433, 627, 2028, 38001, 374, 28135, 4245, 311, 264, 13042, 31293, 320, 606, 49680, 555, 19001, 198, 83543, 8, 430, 682, 47989, 13803, 1288, 387, 31890, 477, 56089, 13, 350, 115766, 3935, 6751, 3217, 47989, 72597, 1778, 439, 1884, 9932, 3485, 374, 6518, 1109, 279, 19664, 99149, 1732, 690, 3917, 5694, 311, 11, 1524, 304, 2015, 311, 1610, 467, 2890, 13, 2435, 690, 2187, 15173, 11, 11217, 449, 16806, 323, 11660, 3185, 81524, 11, 26175, 323, 53354, 7649, 16346, 323, 25407, 87247, 47989, 323, 57753, 9193, 29213, 13, 4314, 52312, 527, 11928, 387, 936, 4881, 638, 606, 775, 449, 11447, 374, 3815, 433, 311, 1124, 13, 1628, 11, 814, 617, 1027, 3309, 430, 433, 20670, 1541, 1431, 9502, 814, 690, 539, 3596, 2733, 2731, 323, 4762, 690, 2815, 304, 279, 3221, 21733, 13, 7429, 1274, 1781, 430, 814, 617, 912, 10778, 11, 430, 279, 6335, 304, 4156, 315, 198, 49818, 8964, 1148, 374, 1888, 11, 779, 814, 2733, 51512, 311, 617, 1027, 51512, 315, 279, 198, 82689, 3225, 369, 872, 1866, 3044, 323, 1202, 6514, 627, 4808, 688, 1413, 435, 15067, 198, 16397, 279, 1667, 433, 5097, 369, 264, 2547, 311, 5367, 13523, 3403, 311, 10137, 264, 5043, 11, 279, 198, 2664, 706, 1027, 28672, 709, 3544, 33776, 315, 653, 35122, 62186, 304, 279, 7917, 14287, 18934, 11, 8834, 34751, 11, 323, 36853, 13, 578, 2547, 304, 1202, 24278, 690, 2744, 5268, 311, 3975, 97254, 16946, 22798, 15055, 315, 62186, 15038, 53997, 4856, 54895, 3060, 11810, 279, 6680, 8312, 311, 3719, 95869, 477, 311, 1005, 14580, 40895, 2617, 11543, 13, 362, 2547, 690, 1005, 25975, 994, 279, 26587, 374, 2753, 23104, 291, 311, 40895, 3357, 1521, 9967, 21503, 35098, 13, 578, 6409, 88364, 380, 753, 49340, 57876, 430, 1124, 276, 7107, 367, 315, 13803, 477, 17563, 527, 682, 555, 5694, 11, 10973, 11, 653, 395, 2141, 16157, 430, 4726, 5942, 315, 21503, 82320, 304, 279, 7917, 11, 39881, 11, 8834, 34751, 11, 323, 1813, 598, 374, 539, 3284, 323, 430, 459, 5149, 9017, 44032, 374, 11112, 95317, 13, 14636, 279, 1176, 892, 264, 1732, 5043, 82, 264, 2294, 12472, 315, 62186, 690, 14614, 1395, 6004, 13, 21347, 279, 19504, 315, 264, 2547, 994, 420, 374, 12765, 649, 387, 5115, 359, 19975, 481, 13, 1789, 420, 2944, 7636, 11, 97420, 54560, 374, 264, 1633, 24219, 4623, 627, 10438, 279, 2547, 9221, 41440, 5986, 11, 4335, 709, 701, 21137, 10633, 8312, 320, 45283, 198, 451, 981, 1220, 8, 555, 20252, 1022, 1063, 41165, 8834, 430, 374, 9257, 304, 21503, 34751, 323, 3473, 8454, 433, 449, 4335, 11, 2536, 4791, 14668, 8834, 430, 499, 690, 1304, 1418, 12459, 6225, 6623, 13, 1442, 9514, 1047, 719, 5043, 291, 40334, 4010, 533, 2740, 439, 264, 97420, 477, 2890, 12, 46002, 6767, 15145, 499, 6244, 14243, 5986, 11, 279, 2926, 61987, 2461, 315, 701, 2547, 1436, 617, 82850, 27332, 3117, 810, 45769, 11, 1418, 499, 1051, 9498, 11, 1418, 701, 16595, 9009, 574, 1579, 323, 1418, 701, 2547, 6062, 810, 3025, 311, 3568, 449, 19842, 5241, 2461, 627, 4959, 892, 499, 5043, 11, 1524, 422, 433, 374, 1193, 832, 1938, 11, 499, 2187, 701, 2547, 311, 733, 198, 20322, 264, 7276, 61987, 11, 323, 1855, 892, 433, 9221, 8831, 323, 810, 10882, 54895, 279, 1566, 892, 13, 578, 2547, 47310, 1268, 311, 5043, 13, 9062, 892, 499, 5043, 433, 11, 701, 30111, 104501, 3153, 1139, 264, 60052, 3941, 810, 6288, 11, 323, 1855, 892, 499, 5043, 499, 83608, 279, 198, 1096, 315, 9967, 62186, 13, 19292, 499, 617, 2736, 34373, 279, 49750, 701, 2547, 198, 32345, 9967, 11, 902, 14134, 11384, 15748, 55403, 389, 30836, 11, 539, 311, 30348, 36709, 13, 1102, 7995, 8779, 311, 617, 420, 4920, 499, 1603, 499, 733, 389, 311, 279, 40895, 2617, 315, 1023, 85077, 33155, 13, 9176, 1274, 617, 8208, 1555, 453, 40375, 795, 27531, 30836, 11, 323, 3619, 430, 433, 374, 1633, 47989, 11, 323, 1101, 430, 433, 25849, 387, 2884, 304, 279, 33436, 315, 2890, 13, 8595, 539, 15142, 505, 279, 2800, 315, 872, 1018, 1113, 323, 92890, 33155, 584, 1935, 1139, 1057, 1887, 389, 459, 14529, 8197, 51526, 3249, 539, 42018, 701, 1648, 1555, 279, 38416, 1413, 1920, 11, 15142, 11, 505, 3691, 723, 22155, 1778, 439, 13465, 477, 12290, 11, 323, 505, 15657, 430, 499, 1253, 387, 57596, 311, 3208, 365, 20559, 11, 34479, 3956, 477, 19335, 627, 2181, 374, 1633, 24219, 311, 2793, 304, 701, 1866, 8276, 3197, 555, 60826, 198, 19842, 5241, 7922, 1418, 499, 527, 2103, 9498, 13, 9878, 433, 1139, 701, 2324, 11, 994, 433, 374, 17125, 10900, 1412, 439, 3131, 264, 2046, 389, 7418, 11, 477, 1524, 3131, 264, 2305, 389, 264, 11594, 1938, 13, 12040, 8136, 365, 2919, 315, 20769, 11, 733, 311, 264, 8369, 11, 6366, 2035, 323, 48772, 961, 477, 682, 315, 433, 311, 9326, 598, 287, 13, 19409, 6261, 555, 4737, 459, 9974, 8577, 311, 28621, 11, 54560, 520, 264, 9689, 389, 1820, 11573, 2345, 3055, 8996, 433, 5097, 311, 62425, 6261, 13, 1628, 2980, 420, 53749, 582, 811, 527, 84563, 23917, 994, 499, 4822, 704, 315, 15926, 627, 2746, 499, 617, 53184, 701, 2547, 311, 220, 1187, 6596, 5043, 82, 11, 1243, 499, 649, 990, 389, 220, 2166, 198, 25704, 5043, 82, 11, 323, 927, 892, 990, 709, 311, 220, 5332, 6596, 5043, 82, 11, 682, 389, 264, 86901, 13, 1472, 1253, 3990, 433, 10671, 15098, 10882, 11, 8530, 1524, 24729, 11, 2555, 499, 7349, 4741, 311, 13, 435, 15067, 264, 12309, 61987, 1908, 2547, 11321, 1695, 11, 323, 1274, 3163, 1870, 2216, 636, 1139, 279, 4335, 11, 3177, 11, 2867, 19946, 11, 8530, 88853, 8010, 2513, 430, 5900, 3235, 449, 433, 627, 1383, 13168, 11, 54560, 994, 499, 527, 14363, 374, 1790, 810, 5107, 1606, 701, 198, 85, 2223, 488, 477, 16595, 5457, 374, 1633, 3428, 11, 499, 2736, 617, 912, 4907, 11, 323, 4762, 617, 359, 45007, 13803, 430, 2011, 387, 27023, 449, 520, 279, 1890, 892, 13, 2684, 1253, 387, 279, 17249, 8631, 315, 1694, 9770, 1139, 264, 81155, 1606, 499, 527, 2288, 49394, 788, 311, 8343, 1345, 537, 1274, 1095, 872, 2890, 733, 3156, 814, 527, 9770, 1139, 14892, 449, 433, 26, 814, 527, 37227, 13326, 5496, 11, 779, 3249, 20753, 627, 791, 8206, 374, 430, 1057, 2547, 1587, 4325, 11, 323, 927, 892, 9221, 2753, 3025, 311, 3568, 198, 4291, 68989, 26, 279, 41165, 2515, 315, 68989, 323, 30084, 9778, 11767, 1455, 315, 577, 34152, 1063, 6129, 5367, 75989, 17563, 13, 52783, 420, 12302, 12765, 2212, 4325, 1135, 422, 539, 31373, 13, 4427, 315, 603, 430, 1051, 47880, 449, 1695, 21389, 477, 1148, 358, 1650, 1054, 351, 1411, 1212, 863, 1253, 617, 8813, 279, 4325, 315, 220, 1399, 477, 220, 2075, 477, 1524, 220, 1954, 2085, 6129, 484, 2136, 11, 719, 1884, 1274, 527, 2478, 323, 3117, 1990, 13, 8595, 539, 11813, 279, 29505, 304, 701, 75060, 555, 27252, 477, 357, 2370, 1022, 2890, 5435, 449, 37538, 61987, 2461, 520, 22479, 1866, 19679, 627, 34, 4763, 65, 1139, 279, 12050, 10954, 323, 1212, 311, 1935, 2585, 323, 8895, 12410, 304, 198, 22479, 1866, 5845, 311, 3568, 449, 701, 2547, 11, 701, 1866, 2890, 11, 323, 701, 1866, 2324, 51861, 433, 5334, 1314, 1523, 311, 279, 5740, 1584, 11, 1070, 374, 2216, 1193, 832, 3245, 304, 279, 14957, 430, 374, 2216, 18821, 11, 323, 430, 374, 701, 2324, 13, 12040, 2585, 323, 1212, 18646, 433, 11829, 11565, 690, 387, 264, 810, 62129, 2324, 627, 26072, 13625, 198, 89765, 86762, 287, 198, 3915, 578, 10320, 88364, 292, 10685, 198, 20175, 787, 5241, 20901, 662, 510, 16, 60, 279, 15783, 7607, 389, 279, 66358, 7147, 3719, 264, 40308, 5015, 369, 53808, 198, 65, 71034, 2324, 7739, 13, 578, 8987, 296, 38601, 41394, 304, 279, 15235, 12314, 729, 323, 9221, 264, 3552, 369, 631, 1116, 1335, 13, 578, 6680, 2107, 484, 5548, 311, 279, 15235, 3240, 311, 3820, 709, 279, 62186, 11, 3273, 19941, 323, 912, 30351, 451, 29272, 439, 433, 513, 7270, 1555, 279, 66358, 7147, 13, 2052, 39881, 323, 36853, 315, 279, 2547, 527, 1457, 4737, 389, 41569, 1233, 392, 9623, 13, 5810, 374, 279, 7314, 315, 837, 3154, 787, 5241, 20901, 389, 264, 53194, 2237, 13, 35352, 65109, 20594, 11407, 86762, 287, 17331, 18943, 301, 9744, 13, 220, 510, 17, 60, 2052, 8811, 17491, 527, 4245, 311, 279, 6996, 315, 3738, 3691, 198, 652, 5824, 645, 11, 1778, 439, 25107, 78235, 477, 46192, 11, 477, 311, 279, 19821, 315, 279, 4725, 46616, 315, 279, 2547, 10900, 1412, 439, 279, 5933, 29219, 82088, 13, 3277, 420, 13980, 11, 21503, 24032, 75272, 279, 4827, 38450, 661, 40021, 51526, 279, 3273, 19941, 8617, 8066, 7230, 1088, 279, 100216, 323, 27115, 39436, 349, 323, 7066, 1475, 83, 11407, 11, 67169, 323, 2942, 315, 279, 2547, 13, 17177, 87987, 952, 1962, 27109, 13, 510, 18, 60, 578, 4279, 5353, 315, 59349, 20653, 65050, 485, 15505, 290, 374, 665, 8943, 323, 927, 91955, 3277, 3691, 374, 539, 4170, 10185, 11, 433, 9221, 264, 21109, 13, 2999, 13, 3842, 13, 473, 844, 33559, 268, 11, 14727, 25260, 6401, 25, 11699, 45446, 323, 70819, 11, 220, 220, 5926, 16, 13, 510, 19, 60, 264, 272, 26330, 709, 315, 279, 3544, 92234, 555, 264, 198, 24177, 709, 320, 263, 8, 279, 66358, 7147, 311, 1778, 459, 13112, 430, 55061, 288, 649, 20781, 1522, 1555, 13, 3154, 787, 5241, 20901, 285, 264, 2167, 1121, 315, 63900, 738, 49686, 13, 60249, 88, 26677, 374, 264, 3682, 16940, 8331, 304, 1040, 49686, 13, 578, 11900, 477, 12472, 315, 55061, 278, 44032, 374, 539, 459, 28137, 315, 279, 6996, 315, 1040, 49686, 304, 279, 66358, 13, 35352, 65109, 11, 350, 11407, 86762, 287, 17331, 18943, 301, 9744, 627, 40, 1097, 539, 264, 837, 62379, 304, 904, 3254, 21730, 1749, 477, 1887, 13, 358, 1505, 1790, 198, 59677, 304, 1690, 8853, 323, 1005, 264, 7029, 8205, 315, 12823, 13, 578, 3492, 369, 856, 92257, 2617, 374, 78813, 627, 791, 1455, 7524, 16088, 304, 856, 58031, 374, 3090, 54560, 8272, 15499, 304, 198, 19644, 2301, 555, 1023, 11, 2753, 47999, 61987, 7922, 41943, 13, 32042, 60052, 21467, 1828, 304, 383, 6260, 2410, 13, 763, 2144, 433, 374, 5107, 311, 8821, 15235, 60052, 505, 54560, 28753, 61987, 2461, 7620, 1288, 2744, 387, 24895, 555, 15235, 9326, 598, 287, 13, 15903, 1523, 279, 5569, 315, 31914, 266, 1245, 2136, 4131, 34625, 15180, 311, 198, 40895, 3357, 57596, 25481, 323, 311, 3118, 279, 2547, 449, 15657, 433, 374, 13171, 315, 198, 37439, 287, 2085, 6968, 41569, 22689, 13, 8155, 11, 323, 6118, 3325, 304, 27375, 304, 856, 1590, 75497, 11, 527, 30299, 79432, 33155, 320, 258, 279, 1376, 315, 2697, 26153, 323, 65879, 8, 5581, 398, 3967, 439, 46192, 477, 3691, 33690, 627, 82990, 11, 26586, 315, 1521, 5528, 555, 856, 8403, 8640, 304, 4839, 198, 454, 3571, 311, 872, 27375, 13, 9029, 10932, 4737, 46192, 1606, 814, 2873, 4908, 279, 63747, 22354, 529, 26153, 11, 4737, 26153, 18651 ]
0xBreath/holistic-books